2AE1A

Tropinone reductase-ii
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
259
structure length
252
Chain Sequence
b'AGRWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNDCLTQWRSKGFKVEASVCDLSSRSERQELMNTVANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATQDPEQKENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGGLMANCGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPINONE REDUCTASE-II
publication title Crystal structures of two tropinone reductases: different reaction stereospecificities in the same protein fold.
pubmed doi rcsb
source organism Datura stramonium
molecule tags Oxidoreductase
total genus 94
structure length 252
sequence length 259
ec nomenclature ec 1.1.1.236: Tropinone reductase II.
pdb deposition date 1997-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ae1A00
3AM4A 4EGFA 3RBZA 3E8XA 5GZ1A 1TA4A 1YXMA 3JQDA 3UVEA 1VLLA 2PK3A 4E0BA 4BVAA 1XU7A 3DB2A 4OAQA 1N5DA 4HY3A 4YB8A 3KYDA 4C7JA 5CDYA 3AUTA 4FR5A 1R4NB 3ENKA 2R00A 3S2FA 3H8VA 2G1UA 5IDXA 1RJWA 1VL6A 2HMTA 1GY8A 4BKQA 4QX6A 1YBAA 1F12A 4RZHA 1LDBA 4GI2A 2YDXA 2NSDA 4IXTA 1GQQA 4ZD6A 1T1SA 2JCVA 3QVTA 5LCXA 5JSFA 3E9NA 1NPDA 3ZGYA 2O3QA 3VAZA 2X0JA 2WYVA 1ORRA 2NVUB 2GPTA 2NNLD 1PJTA 3NTOA 4BNKA 4ALLA 2C20A 3FTNA 3ETGA 2Y1DA 1CRWG 3R1IA 4OO3A 1KVQA 1YO6A 1HDCA 3UCXA 2BKAA 3I6IA 5BT9A 4Y67A 2E48A 4TRNA 1D8AA 3OMLA 1I36A 3ROQA 1AXEA 1MX3A 2ZATA 4BNTA 1LQUA 1O6ZA 3WB9A 4XZ3A 3SEFA 2AE2A 1SB9A 3AM5A 2Z95A 9LDBA 3LQFA 3ABIA 4KP7A 2CFCA 3IKVA 3FD8A 2ZK7A 5EL0A 1V3VA 3TPCA 4CR8A 1Y8QB 1E7QA 3K9QO 2R00C 2O7SA 1DO8A 2B5VA 4YAIA 5JAIA 4JP3A 1O5IA 2YFQA 2PZJA 3GZNB 3OQBA 1RYEA 3IMFA 3ANLA 4CLEA 4IJWA 1KC3A 3Q9NA 3K96A 5F1OA 3GNSA 3PQDA 1Y8RA 3SC4A 2NTVA 4P38A 4BNJA 2JD0A 1JWBB 4J4TA 1MFPA 4J1TA 3IQDB 5HRUA 3RIHA 1JAXA 1E7RA 4XD2A 1MA0A 1NAIA 4WCFA 5ENVA 3BXXA 2NQ8A 2CF6A 1VE9A 2PD3A 1FDWA 3D7LA 4NH4A 4U6QA 3GHHA 3RVDA 3E82A 1PGPA 3D64A 1B8UA 2YDYA 3MJEA 5DCYA 3MJVA 4L76A 2FPIA 3NJ4A 1LQTA 4N5LA 1I5RA 4WEQA 1DFIA 1ZZEA 2DFVA 4MOWA 5TF4A 3KHUA 4FB5A 5BNFA 3ZWOA 4XRRA 4NHEA 1YJ8A 3OQ1A 4MDHA 5CAEA 1P1HA 2DT5A 2XOXA 3UGKA 1QSGA 3PDJA 2NV6A 4F46A 1DOHA 3DZFA 3V1UA 1ISIA 4CLHA 4BQPA 3BMQA 4I9UA 1CQJA 4I8XA 4H15A 2J3IA 4GX1A 3CSDA 4R1UA 5EINA 1UAYA 1QRRA 4IY1A 4XJTA 3G0OA 3U4DA 4BO9A 2J3HA 5JO9A 3RFTA 4WCFC 4D42A 4O59O 3WGHA 4Z6KA 2VUSA 1PS8A 3RAJA 4CR7A 3PZRA 2PWZA 5TT1A 2WEKA 4QT0A 4CV3A 1XLTA 1NVTA 1YVEI 2DTXA 4GKBA 5JY1A 1T2DA 2HKIA 2X6TA 2YQ4A 4AJ1A 4CL8A 4KQWA 3P5SA 4IQ0A 2BH9A 1BXGB 3GDGA 3JQGA 3NJ8A 2NWQA 3DOJA 2HRZA 5DN9A 3OECA 1WLYA 2J6IA 2P5YA 4PFJA 1AHIA 4Z0PA 1H6BA 2VN8A 2WD8A 3Q1LA 1PGQA 1X7HA 5L3ZA 3VZSA 2CDCA 1GR0A 4GSKA 1U1IA 3OBBA 4B7CA 4BO0A 1MLDA 1NFRA 4UEKA 2G17A 3JQAA 1DJNA 1DSSG 3ROPA 1I24A 1Z7EA 1OMOA 3DHEA 2O2YA 3DL2A 4ID9A 4J16A 3TNLA 5JYDA 3CH6A 3ZWAA 4EDFA 3VHRA 3PFWO 3FRJA 3FPCA 2DPHA 4J49A 5BNTA 2HK9A 3NKLA 4XDZA 1IULA 2Y68A 3D0OA 3S2GA 3ZWMA 5IF3A 5JXWA 1CJCA 1P31A 4I5GA 4CQMD 3E5RA 3TFQA 5ICMA 3AI2A 2PA3A 4AJLA 2AQHA 5G0WA 3WGOA 1RKXA 1HDGO 4XYMA 1CIVA 5L7YA 2E37A 4Y98A 4AJ2A 4RF3A 4FFPA 2D59A 2Y05A 4RF5A 1A9YA 3HN2A 4WLOA 1PWZA 4NDNE 2O3SA 1IHXA 3ZCXA 4E6PA 3KYCA 1JTVA 1WXDA 1KS9A 4FC6A 1NX6A 4IXWA 4G65A 4BV8A 4AJHA 2BI8A 4A0SA 7MDHA 4CM8A 4YR9A 5J23A 4CV1A 2HSDA 2V6FA 3PLNA 4YRAA 2Q50A 1V35A 4J7XA 3QV1A 3PYLA 2VOJA 3VDQA 1PJ3A 2E6UX 4GSLA 1M67A 1P1FA 1VC2A 4I1IA 4XQEA 3SVTA 2P2SA 2ZTUA 3CKYA 4QO7A 5F1KA 1LXCA 3KRTA 2AHRA 2ZJ0A 4CV2A 2QG4A 2VRCA 3GRPA 4YJGB 2IZ0A 3AM3A 1JQBA 1BXZA 1UZNA 2RIRA 3NT2A 3PJEA 3RJ9A 2RCYA 3SBOA 1A9ZA 3I9LA 3GEMA 3JD0A 3MCVA 4RPGA 3VDRA 1ARZA 1PTJA 1SEPA 2Y93A 4BS9A 1E1MA 4CLRB 4DUPA 4PN3A 5KOIA 3ZHYA 2HK7A 1N9GB 3UKOA 3HFGA 3NV9A 3WWZA 4BGIA 4R16A 3O8QA 4GL4A 5G0TA 1GYRA 3GEDA 3KV3O 3MWDB 2OOSA 4IGEA 2X9NA 1H6AA 4J0FA 4MP6A 4BGUA 3V1YA 4JXKA 3JQCA 3C1AA 4E32A 1DB3A 2D4AA 4HFNA 4XR9A 4NFHA 1U5AA 1XEAA 3H2SA 4FFLA 2BFOA 1B8PA 3UN1A 3DFUA 1P1RA 4RVGA 1GDHA 4R54A 1XGKA 4DLAA 4YQZA 3DZBA 3K2EA 5TT0A 1Q7CA 5C3MA 5JY6A 1SC6A 3H2ZA 3L6EA 5F1PA 1LDNA 4BO5A 5I7VA 5I9LA 4TRRA 1RM0A 4XX0A 2ZQYA 1GCOA 1PJBA 3DC2A 3LLVA 2IEBA 5JFOA 2C59A 1GFSA 3LT1A 2FR0A 3VPXA 4AFNA 2DPGA 1DFGA 2G82A 4S1VA 5AOVA 1X15A 1GZ3A 3GDFA 1M75A 2XXJA 3ORFA 4WJZA 3ZW9A 2O3UA 4OYRA 3GR6A 1N1EA 5TIIA 5HM8A 1VJTA 2VHXA 4JBIA 5IG2A 3WGIA 3ZH2A 3PHIA 2VTEA 1R0LA 4AJJA 1U28A 5L7WA 2NU9A 3UF0A 1GUYA 2CF5A 3DHNA 1C0PA 1ULSA 3IP1A 3DO5A 4NJMA 4D3FA 1YQDA 2CDAA 4YDRA 5EN4A 4ZQFA 2EGGA 4PG7A 2JHGA 3UOGA 3MJSA 2CY0A 2FR1A 5KIAA 3DTTA 4Z9YA 5EQFA 3BHIA 4CLXA 3F1LA 4OXKA 4W4TA 4BV9A 2W2KA 6ADHA 3UAGA 1PZFA 4EI2A 2POQX 3KSUA 3W4IA 2NTNA 4BO1A 2B37A 4MPDA 5IXYA 4O5OA 4BNUA 4FD3A 3M2TA 4ZN6A 2I67A 3NT5A 4LK3A 2VCYA 4XEHA 3W1VA 4YAJA 1O94A 1N2SA 3JQ7A 3AUUA 4ZHSA 4J9VA 4EYEA 1NBOA 3H3FA 3N74A 3JYQA 1YBVA 3CEAA 3QWBA 2BGMA 4JX8A 1ZH8A 3V8BA 1GEEA 3A28A 5F5NA 3TRIA 4YT2A 5JCJD 5TJ9A 1NHGA 4FGSA 4R68A 4GLOA 4M55A 3UICA 1LLCA 4JNKA 3ZWXA 2PZMA 2C0CA 1R15A 5G0VA 1I33A 1CEQA 2GN6A 1VI2A 4KUGA 5BSHA 3GGGA 1GU7A 2Z5LA 4L73A 3IUPA 4FBGA 4TZTA 2ZTVA 4RZIA 4DQVA 1PJCA 4R1SA 3JQ8B 2GR9A 3PGJA 3ENNA 1QYDA 1JKIA 1QV7A 5TJHA 4PLTA 4ESOA 4KQXA 1A4UA 1KVTA 1U3TA 4PZCA 2Y0DA 5HS4A 3FNGA 2PY6A 1VL0A 4PLFA 4PLWA 1SO8A 3GDOA 4NNJA 1KVUA 3GMSA 4YAEA 3W6ZA 3B1JA 5DT9A 2FN7A 4DRYA 4XRGA 4Z0TA 3M1AA 1F06A 3VPGA 2CUKA 2HK8A 2GZ2A 2A9FA 3JQ9A 3M2PA 4RF2A 4YT8A 4CLOA 2EW8A 3VVBA 1E3WB 1J49A 3LU1A 4YACA 1T2FA 4ITUA 3ZW8A 3AY6A 2Y0CA 2Q1TA 1U9JA 2VYVD 5AQ1A 4EJ0A 1IUKA 2ZIZA 3T7EA 5B4UA 4FGWA 4OMUA 4AG3A 3CIFA 2ET6A 1BRMA 2VHZA 1NQ5A 3ASVA 1KOLA 3WMWA 4L4RA 4FDAA 1Q0LA 3ZNQA 4GX2A 3EW7A 3RUHA 4Q3NA 2EKQA 4ALJA 4P8RA 4DMLA 4OOFA 3FR7A 2DAPA 3QW2A 1Y6JA 3FTPA 5C5IA 3PXXA 4WUVA 9LDTA 4OM8A 4E4YA 3LT0A 2FY8A 4IM7A 1ISFA 5HS6A 2VZ0A 3ONDA 4NBTA 5EMHA 3GOHA 5GZ3A 1V3TA 1QG6A 5A04A 4WECA 5HWSA 1UR5A 4NMHA 4RCVA 3V5NA 1TT5B 2H5LA 1B26A 3QP9A 4HFRA 4YTEA 1WW8A 4TKLA 2GRAA 3TOXA 3NTRA 1B8VA 2B4QA 4OQZA 3JQ9C 2C2YA 3A4VA 3EZYA 3LC1O 3DOCA 4CMBA 3EC7A 4D45A 1YOVA 1NNUA 5AYVA 4E12A 5IZ4A 1LUAA 2W2LD 4KWHA 3PHJA 5IAAA 3DBLA 2YY7A 2P5UA 2DM6A 3W8DA 1LU9A 1PZHA 4LSWA 3DMYA 1HE2A 4OSPA 1EFKA 3TL2A 1ML3A 1C1XA 3VOSA 1EBUA 2GZ1A 3AFNA 1UDBA 5CEFA 3GG2A 4MVJA 5TGDA 4RJTA 2QZ9A 2EEZA 5EPOA 4BO7A 1K0UA 2X5OA 1CWUA 3HB4X 3OJFA 1ENOA 4WPGA 3W6UA 2Q3EA 4BB6A 2B36A 3WGGA 1UZLA 3IS3A 4UULA 4BO8A 5G2OA 4BNXA 2P9CA 1EDZA 3GC6A 2ZYAA 1B0AA 4M89A 1EUZA 5CFZA 4W82A 4M1QA 1PZGA 5L45A 5KKCA 2JCYA 4W7IA 2DBVO 3KYDB 1HSZA 4HNGA 5FEUA 3QRWA 1HLPA 1NQOA 3GMDA 3BHMA 2WD7A 3IAHA 4WLUA 2ZB8A 4ND3A 2O3TA 2D5AA 3U4CA 3G79A 2Q1WA 5B37A 1PQUA 3WX0A 3BTUA 4CM9D 5EQDA 2HMUA 4UVGA 3FPLA 1FDSA 5A5EA 3VTFA 1DJQA 2O23A 2Y1OA 3TWOA 1GYPA 1KVRA 1LEHA 2D2IA 1M6HA 5A9TA 2PGLA 1LLDA 1E3SA 4TRMA 3D4OA 4CR6A 3RC7A 1XKQA 4TKMA 1NXQA 3JQ6A 3SJ7A 5JC1A 5LDHA 4D46A 1JA9A 4E5KA 2B69A 3AY3A 3DBVO 2JFGA 4E5PA 2IRWA 3RSHA 1T26A 4DC1A 4ZU3A 4GWGA 2HLPA 1KEPA 4RPHA 2B5WA 3QVSA 4Y9DA 2VNAA 4ZQGA 3VKVA 4GVXA 1EVYA 4ND4A 2VZ8A 1YL7A 3GPDG 3WYCA 2NM0A 4JBGA 2QX7A 2FPPA 2V6GA 5IDYA 1WPQA 1YDEA 1P74A 2X5KO 1NR7A 3E9QA 1DLJA 3KEQA 1A7KA 1XQ1A 3WLFA 1Y8RB 4H3VA 2FZEA 4IIVA 3D3WA 3LYLA 4J4BA 2HRBA 3OIDA 1DEHA 4E33A 3H9JA 3HDQA 2VYND 3LSYA 2PZKA 4WCFB 5THQA 4NK5A 3L4BA 1IL0A 5L95A 4PVCA 5JW6A 4PRLA 3OEWA 1LSOA 4M86A 2VWQA 4R3NA 3S55A 1HDYA 1KEUA 4MIOA 2OUIA 3TZQA 4XYGA 2YHIA 3GG9A 4BNGA 1OZAA 2H1SA 1JN0A 3EHEA 4D3SA 4CLDA 3FI9A 1E3JA 4NI5A 5MDHA 1U5CA 3TOZA 1ADGA 4YJHA 1ZO8A 2HMWA 2B83A 5BSFA 4BO6A 2VWHA 1PQWA 3D5TA 2J3JA 3H9GA 3PDUA 2UDPA 3PLRA 4J1NA 5G4LA 3GNQA 4CM3A 3VZPA 2BLLA 1YL6A 2X4GA 5EERA 3RC1A 1XYGA 5CHEA 1T24A 2QRJA 3BMQB 3O03A 1K3TA 4LN1A 4CM5A 1IYZA 1I2CA 3L9XA 3QWHA 3UH1A 4GMGA 1C0LA 1Z7BA 1X7GA 4CUZA 2ZJ1A 4NIMA 3OJEA 4DPKA 4EW6A 5ITVA 3B70A 2GN8A 4MIEA 1E1NA 1CERA 4E2YA 1A5ZA 4RVUA 3AFMA 1EFLA 1GTMA 2BFPA 3F46A 3L4BC 4QEDA 3WWYA 1VRWA 5FF9A 3U3XA 5H82A 1PGOA 1KY4A 5CDGA 1CDOA 2Z1NA 3FNEA 4K28A 4UAGA 4DGSA 4CQMA 2SCUA 4MINA 3KETA 3BMOA 2ILTA 3SC6A 3NX4A 3G1UA 3LK7A 2TMDA 1KIFA 1MC4A 1OFGA 1H93A 1HRDA 4R3WA 4XB2A 3IJRA 2WJPA 1IZ9A 3JQGB 3KM0A 4NBRA 3BA1A 4I9HA 5JPIA 2AQ8A 5A4DA 3DFZA 1F17A 4PLVA 5T57A 4O63O 4EEZA 1Y9EA 4DYVA 2O2SA 2X86A 5JAMA 1XIVA 1FDVA 2JFHA 2V6BA 1ADCA 1BXKA 4YJFA 4R9RA 2WMDA 4OH1A 4KTTE 1KETA 4UVEA 3BZUA 1NPYA 3JQAB 4BO4A 4LMPA 5JMPA 1LJ8A 5AXAA 1YJQA 2ZCVA 2O3JA 1Z73A 1UXGA 1SZJG 4BO2A 3PGXA 4Y6PA 3E5MA 1T1RA 1HYHA 1SOWA 4PLCA 3VKUA 1O8CA 4BKOA 2DLDA 3A06A 3CZMA 3SJUA 2HUNA 1UZMA 3ZWPA 4WLVA 3KUXA 5JYEA 4Z0HO 5EESA 2WYUA 3RKRA 2Q2WA 3WFJA 4YAKA 5IXSA 2GSDA 1Z74A 5IZCA 1VJ0A 3QLJA 1XWFA 3F1KA 5HTOA 4E2WA 1ZSYA 2HQ1A 3F9IA 4WOJA 5A02A 1MXHA 2P68A 4JCOA 3BYZA 1J5PA 4NBVA 1LC3A 4J91A 2W8ZA 3NEPX 3VZRA 3C3XA 4PVDA 4UUMA 1S7CA 2C07A 1UXIA 1I0ZA 3DOOA 4LRTB 1F14A 4UVDA 4A26A 3ZWYA 2V65A 2X0NA 3S2IA 3KYCB 2VWGA 4J6FA 3H9EO 3NDJA 3Q2KA 1JLLA 4CM8B 1MP0A 3OIGA 2QRKA 3JYPA 1E3EA 1LNQA 3EUWA 1H2BA 1TEHA 3TN7A 3ZI0A 4YYZA 1ZK0A 2FWMX 4IS2A 1BDMA 4DA9A 2ZYDA 4II3A 1OBFO 1GUZA 2P91A 1IE3A 5JMWA 2VWPA 3NUGA 4P4GA 5CP8A 3PTZA 3UW3A 4CMEA 1B2LA 1C14A 2XPCA 2AG5A 5LDGA 3TSCA 2YFHA 3C1TA 2PKQP 1GEGA 1E77A 1ZEMA 4XGIA 1YB1A 3ONEA 2IXBA 5IZCC 5JAZA 4IQGA 3ITDA 4OXNA 4TQGA 5FFFA 2AA3A 5FYDA 2X22A 3NT4A 5AXBA 1NQTA 1R4MA 4U6SA 2JAHA 4RF4A 1U7TA 2Y0EA 4PCVA 5A9RA 1D4FA 5CDUA 1EVZA 1ZVMA 3H9UA 1BWSA 3DAFA 4FJ1A 1D1SA 1W8DA 3QWIA 4RVSA 1R12A 3O8QB 4FOSA 4MVJF 1BMDA 1V0JA 3R0IA 4B8WA 2FRDA 2YUTA 3OJLA 3OHSX 1P77A 2FR8A 2RH4A 2PZLA 4QTZA 1Q7BA 1LI4A 1V3UA 3C7AA 2PR2A 5ENDA 3U5TA 1HKUA 3UXYA 4BB5A 2OGUA 1PJ2A 5ILGA 1V6AA 5ER9A 4PIVA 4A10A 4J2HA 2PD6A 4LRSB 3U09A 3GQVA 1E1KA 4N5NA 1EBFA 4FFRA 3D4NA 5KVVA 4FQ8A 1EVIA 1JWAB 5T8KA 3RU7A 2QYTA 1UP4A 4CMEC 1VSVA 3WJ7A 1P3DA 3KO8A 2ZTLA 4AJPA 1UJMA 1RPNA 1NFFA 2CVZA 4BNMA 3EYWA 4DL9A 2I6TA 3LZ6A 1E6WA 2PV7A 5KTKA 2UAGA 3I3OA 4GAEA 3U49A 1JAYA 3C8MA 3IUSA 1HZJA 4RV9A 1LDGA 3OICA 1D3AA 2O7QA 1FK8A 1TT7A 5L7TA 3MTGA 4J0EA 3MTJA 3QA9A 4FFOA 4HWKA 4R5MA 3EY4A 3PPIA 4IZIA 1AHHA 2ZCUA 5T67A 4DTIA 1UXHA 1B15A 2HO5A 2FOIA 3GZ4A 1K2WA 5FI3A 1I2BA 3JQEA 1MC5A 1U2GA 4MVJG 2J3KA 4NJMB 4G81A 4D43A 1PEDA 1WVGA 3QSGA 2WWRA 3RBVA 1VKNA 3HG7A 5A06A 1Z75A 4ZVVA 4RPLA 2X0IA 2W2KB 4XIYA 4D3DA 5KVQA 1ZXBA 5KVCA 4NFSA 2X23A 1LDEA 2EG9A 1EK5A 3LF1A 1I01A 5T8KC 4OJNA 3HFSA 1QR6A 2UUOA 4WNIA 1M2WA 2NU6A 3ONFA 4IBOA 5DDIP 3ZV4A 4CPDA 2IXAA 4BNZA 3D4PA 5KJFA 3IKTA 4BUCA 1V8BA 3INRA 4TVBA 5G0SA 1EE2A 3JQ7B 3GVPA 2PLAA 4L9RA 1A7AA 3H9QA 4MVJM 1HXHA 3AOEA 4Q39A 2OP0A 1DIRA 4Q3AA 3E18A 4CMAA 3UUWA 3VH3A 1IPFA 3FWNA 4MKXA 3IL2A 1K89A 1U3VA 2DC1A 4BKPA 3DQPA 3K73O 1ZMTA 3KYBA 2AEJA 3K31A 4OKIA 1PJLA 1G0OA 2IEDA 2I65A 4AL4A 2E82A 3MWEB 2X9VA 1ISGA 5T5QA 2HJSA 1HE4A 3ZNNA 1X0XA 3INTA 4FJ2A 2GCGA 4OL9A 1TI7A 3B20A 5G4KA 4PLHA 5I9MA 3WJAA 1DXYA 4E3ZA 1P1JA 1EMDA 1W73A 2GERA 4UVIA 3N58A 1X13A 3B1KA 1U4SA 5C37A 1P45A 1N1GA 3RC9A 1MB4A 3K30A 4LSMA 4DXHA 4QFCA 5I7EA 1P33A 2P9EA 5DCWA 3ZNPA 4FS3A 3R3SA 4FOOA 3ST7A 1VPDA 5DNAA 3BMNA 2NACA 2NVWA 1NVGA 3JCZA 1DIHA 3WBBA 3FF4A 5F21A 1YH3A 4R69A 2B0JA 5IN4A 4IIUA 3C85A 5DCUA 1YONA 3HZZA 3I9JA 4CLOB 3HDJA 4IDCA 3T7CA 2C5EA 1T4DA 1XELA 3JYNA 2QRLA 3L4SO 3HSKA 4WASA 4B4OA 5COQA 1UAGA 2EGHA 1EQ2A 1AN9A 5CDTA 2G76A 4CQLA 1E3LA 1UXJA 3K5PA 4D0SA 3QVXA 1O0SA 1O9BA 3E48A 4E30A 4YA6A 4XDYA 2VZ9A 3PJDA 4TZKA 4E5NA 3KTDA 4XYBA 1Z45A 2GN9A 4DBVO 1ZK1A 4MKZA 2CVQA 5TX7A 1GD1O 4XR4A 3QIVA 5ER6A 3HJAA 5ES3A 2RAFA 4CMHA 2P4QA 3AJRA 5G0UA 4CUJA 4C7KA 1C0IA 3ZN2A 1ZSNA 2GDZA 4IDFA 3P7MA 5B1YA 2IE0A 1I3NA 3GN1A 2HCTA 4YAGA 4BKUA 3ANMA 4J3FA 2ZTMA 4PLPA 4RQUA 2Q4EA 4RPKA 4L74A 3LDHA 1QORA 2IODA 2J8ZA 5DF1A 3H4VA 2O4CA 2C7VA 3WYBA 3AU8A 3OJOA 1YOVB 5JS6A 1LRJA 1MG0A 1QYCA 4KWIA 1IPEA 1YB5A 1E7MA 1VM6A 3DBLB 4YVFA 2DVMA 3MJTA 4RGBA 1C1XB 3KXDA 4Q3BA 5DBGA 4WLFA 4ALIA 4E5YA 1E7YA 2QZZA 4BGEA 4ROSA 5BSEA 5A9SA 2Q99A 4DLLA 2WE7A 3OQ6A 3FWZA 1N8KA 4PG6A 3TZHA 3VPHA 2R2GA 3CE6A 1C1DA 3DHYA 4IUYA 3GPIA 4ND2A 3PQFA 2B4TO 3EK2A 3GVXA 3M1LA 3ZWBA 5TNXA 1UP6A 4B3HA 3MOGA 1E1LA 1WZIA 4RVDA 5L4NA 1HTBA 1YQGA 5JLAA 2J5QA 4CV0A 1D1TA 2CD9A 2RBEA 4Z9XA 2WD7B 3ZHZA 2Y67A 3RI3A 3ZU3A 2JHFA 1A27A 1ZW1A 4PG8A 2I3GA 4UUPA 2X9GA 3U9LA 3WGYA 2BF7A 3EVTA 2BHLA 1XU9A 4WNCA 4XYEA 3LT2A 1QLHA 1ADBA 1ZJYA 3PYMA 1GPJA 3RC2A 3DZJA 1XDWA 1ZKMA 3FSRA 3U0BA 1V9LA 2FPGA 1NQAO 3VC7A 1BDBA 3JQBA 2VUUA 3SXPA 4BQRA 4LW8A 4MO2A 3GY0A 1O89A 3L0DA 1ZIDA 4WGGA 1P1KA 1EUCA 2A94A 1UXKA 1H2HA 2NUAA 1U2DA 2RHCA 5DP1A 3DBHA 1S6YA 1HDXA 3H3JA 4NG5A 5B12A 4JN6B 3SX2A 5IFLA 1A71A 3CINA 2IYOA 2O3RA 3H6KA 4YCAA 1T25A 4U0KA 5JDCA 2JFFA 1XR3A 4XCVA 3C24A 3AI3A 3NDIA 4L4SA 4F6CA 4BMSA 3FNFA 3L77A 3F3SA 3H5NA 3PRJA 2AW5A 2OBYA 5KJCA 1B3BA 4ZRNA 5H83A 1SNYA 4P4NA 1JVBA 1ZXLA 3HADA 3ADOA 4AJIA 8LDHA 2BFMA 2OP1A 3KZVA 4RQTA 2B4RO 4CM6A 5C7OO 3K8ZA 3ZWWA 2YHUA 1H0KA 1P9LA 4E31A 5A3JA 3D3WB 3DZKA 4UUNA 1GCUA 5T64A 3TZCA 1M6WA 2VUTA 1L7EA 1LA2A 2GLXA 2DUWA 1K6IA 2AEMA 3BTOA 4INAA 1ISJA 4K6FA 4Z3DA 2OBNA 2BRUA 3LC2O 1XSEA 4Y6SA 1JW9B 4W9NA 4MP8A 1I3KA 2D1YA 3DDNA 3DZHA 5A5FA 3Q0EA 1VL8A 3ZDFA 5JDCC 1N7HA 2BGKA 3B1FA 3I52A 3TDKA 4TMFA 3EMKA 1RYDA 2YHIB 4KUHA 1VJ1A 2EERA 1BHSA 4PLGA 1OC4A 4AICA 1IOLA 4FC7A 2BMAA 2QHXA 3PJGA 3DBRB 4YJHB 2D0IA 3PWKA 3PIDA 4EEXA 4XB1A 3RU9A 1ZUD1 1O95A 2I9PA 5AVOA 1QKIA 1PJSA 3O4RA 3PQEA 4S3MA 4AJ4A 4BNWA 4H7PA 1HYGA 3T4XA 5KNLA 5DBIA 2YQ5A 3WXBA 3ETDA 4A7PA 2WSBA 2EP5A 2Y1EA 1G1AA 3KB6A 3QY9A 4RORA 2EHDA 4BNHA 4JLWA 3QE3A 1T2CA 3Q9UA 4CMJA 4CMKA 3JD2A 5CEEA 3OP4A 3RD5A 4GPD1 5DBFA 3DR3A 3U4HA 3GNTA 1AUPA 4W9NC 4CQMB 3MOIA 2NVBA 3BMOB 2CNBA 4ALNA 3TF5A 2YV1A 3PFFA 2GGSA 4KOAA 5T6BA 1H5QA 2WDZA 2W90A 4D44A 4BNYA 1HWYA 2FSSA 5A3VA 1NPTO 1F8FA 3PEFA 5AXCA 5CPBA 3AUAA 3TZKA 2H9IA 5ILOA 3QQPA 4N54A 1DRUA 2UUPA 4IZHA 4UUOA 4O0LA 4WLEA 4CM1A 1PIWA 2YYYA 4YJFB 4CM4A 1R66A 1YKFA 1PL8A 1NP3A 2GN4A 3ICCA 1NTOA 4WOKA 1PS9A 1T4BA 3WSWA 1LSJA 3TFOA 3JV7A 3G17A 1GV1A 1WAMA 1ZMOA 3BMCA 2UVDA 1WDLA 1R16A 4YQYA 1MV8A 2IDZA 4BL5A 2RHRA 3GFBA 3HB5X 3JD4A 4LISA 4RDHA 4YBZA 1QLJA 3FNHA 3AW9A 5KJ6A 2AMFA 4N7RA 1ENYA 4D7AA 1YGYA 3MJCA 5L51A 3R3JA 5EIOA 1RM3A 3PYXA 4DVJA 4E5MA 1M66A 2F1KA 3AI1A 1DHRA 4WCDA 5I9NA 3F4BA 4EBFA 1EEHA 4BIIA 3PHHA 3LVFO 3B6ZA 2QW8A 3Q11A 3OEYA 1EK6A 1PZEA 4KUEA 3WGTA 1GQ2A 1HE3A 4NU5A 1M76A 4B7UA 2P4HX 5U1PA 1BW9A 3GAZA 3E9MA 1DAOA 4FW8A 1ZJZA 4J9UE 4I5FA 1NVMB 1B3RA 1XG5A 3QWFA 1QYXA 4QQRA 1NWHA 2J5KA 3ULKA 3ETEA 3X2EA 1GL3A 1YS4A 4BNLA 3DBRA 2OL4A 2VNSA 1HT0A 5COBA 4D0RA 4EJ6A 4YT4A 3RFXA 4OQYA 5TS3A 2FZWA 1CETA 5EJ2A 3INGA 4R51A 4Y6RA 4Z9FA 2D5CA 1OOEA 4NBWA 1XHLA 1X1EA 4B4VA 2E49A 1AXGA 4W6ZA 4F3YA 2CDBA 4TVOA 3SLGA 3G3EA 4ND1A 1LDMA 5GMOA 3GT0A 1R4MB 2HJRA 4YXFA 1AE1A 1UDCA 4UEOA 1UDAA 3I9OA 2FHSA 4UREA 3ZU2A 4HADA 3GVCA 2HMSA 4JROA 4K6CA 4IS3A 2VHWA 4PG5A 3ZV6A 3RJ5A 5HA5A 1WZEA 4Q3DA 5KVSA 4XJSA 4IDEA 1Y5MA 4AJKA 4EZBA 1HL3A 3HN7A 4NPCA 4J4HA 4K9DA 2AG8A 2X58A 4A5OA 4B4WA 1KY5A 3HHPA 1WDKA 3I23A 1EZ4A 4LVUA 1Z6ZA 3FBTA 3ANNA 3GAFA 2Y1FA 2DFDA 2EKLA 4YRDA 3VH2A 4WE3A 3GK3A 4JK3A 1ZCJA 4TWRA 5TLSA 1NFQA 2OHXA 3W8FA 4M87A 2GASA 1QV6A 3KLMX 4BNIA 3UFXA 3F5SA 2VQ3A 2O48X 4QXMA 4DIOA 1I8TA 3OIFA 3ZWCA 1BTOA 1R0KA 1Q2XA 1TLTA 1YWGO 2TMGA 4FN4A 4GQAA 3U62A 4Q3CA 5AXDA 2EP7A 3TZ6A 5KCZA 2EJWA 3ADPA 4QUKA 1HDOA 4X54A 3GUCA 4BNFA 4B8ZA 3RUEA 4MVJD 2EF1A 2DBRA 4J7CA 8ADHA 3WDSA 1RM5A 2OFPA 4CM7A 1PR3A 1PJQA 2F00A 4QO8A 4ZJUA 1PR9A 4KTVE 1PL6A 1SB8A 3PJFA 4J1QA 1EVJA 3KOUA 4A03A 4CMIB 1Y1PA 3PWZA 4D41A 4DQUA 4CODB 3PHGA 1J6UA 2JJYA 4LMRA 4WKGA 3RASA 2FP4A 2XXBA 1JKFA 1KYQA 5CEJA 4BKRA 1ONPA 4XQCA 2V6MA 5CPFA 1Y9AA 4PZEA 4OGWA 4CUKA 2DBZA 2IYPA 3WLEA 4L0QA 1ZEJA 5F3RA 3OFSA 3D5QA 2Y66A 3E6AA 1N7GA 4GX5A 1U8FO 2EW2A 5FWNA 2HAEA 3F5QA 3H5AA 3COSA 3C1OA 3PHLA 3QWAA 4HFMA 4R1TA 5IJZA 3RUAA 2H63A 1LBEA 4J90A 1GV0A 4P4LA 4PZDA 1ISMA 2EV9A 1LRLA 2B35A 4IPTA 3A1NA 3DAPA 3QVWA 4GH5A 1HE5A 1FF9A 2VT2A 2X7HA 2GYYA 4WEOA 4DREA 1ID1A 2O50A 4AJEA 1NYTA 2D3TA 3NTQA 4O1MA 4B3JA 4F6LA 4FIZA 1ZNQO 3CMMA 3ITKA 1EQUA 2AEFA 3WTCA 1SEVA 1YL5A 2ZYGA 4FCCA 3K6JA 2Y1GA 5JE8A 4IDBA 4NBUA 4AVYA 1WWKA 1H94A 1Q0HA 2X8LA 2YJZA 4D79A 4JJFA 5DOZA 4DYDA 1Y81A 7ADHA 4RLSA 5DZSA 3Q6IA 1P0CA 1XCBA 4QECA 1DC4A 1ZBQA 3CPSA 1IB6A 3D1LA 3VZQA 3WS7A 4KDFA 1F0YA 5G4KB 4FJ0A 4ND5A 3O26A 3PVZA 1JU9A 4RDIA 1X14A 4NFYA 4R9SA 4ZQEA 1P0FA 1SAYA 3WIEA 1X1TA 4HBGA 3OA2A 1WMAA 1DIAA 2W98A 4J1SA 1BVRA 3V2GA 2NLOA 3U4IA 3WNVA 1WMBA 5BQFA 2CVOA 1R4NA 1FMCA 1HSOA 2J5RA 5FI5A 3KBOA 4ZA2A 3KLPX 3JYOA 5A1TA 4N18A 1NHWA 3BMNB 1KERA 3GGPA 5GZ6A 4MVJH 2HMVA 1HDZA 1E0DA 1TB4A 2ZQZA 4G5HA 4W99A 1Q1NA 3EDMA 2NU7A 1XA0A 3MEQA 5THKA 2XAAA 4GWKA 4RO0A 4URFA 1DRWA 3ZV3A 2NVUA 3DTYA 3JSAA 2DKNA 3C7DB 2C2XA 3WR5A 4YWJA 1E6EA 5JO0A 1Q0QA 4CQLB 4MKRA 5JCJA 2PGJA 4OKNA 1I3MA 2DTEA 2QQ5A 1DBVO 3UHAA 4BMNA 4HXYA 5DULA 3ZHBA 1E7SA 3DMTA 2Q2VA 3GFGA 4CMIA 5K6AA 2YW9A 3PWSA 3VPFA 2DU8A 3ZNOA 2DBQA 3O9ZA 4L4XA 5GY7A 4NQZA 3RUIA 1I30A 1DPGA 1YBMA 4YEDA 1Y8QA 3LC7O 4L75A 3H7AA 3FN4A 1L1FA 3KVOA 3R6DA 3GH3A 3S2EA 1IHYA 2WYWA 3VTZA 2JKVA 1E5QA 4MVJP 4I5DA 3S1LA 3GEGA 3GZNA 1HLDA 4R1NA 1YE3A 4EJMA 5C7LO 1BSVA 3FCOA 1PS0A 3WBFA 5L4LA 1DIBA 3GF4A 2C29D 5ICSA 2FSVA 3HNPA 2GUGA 1PQPA 1E7WA 4U7WA 2X5JO 3LT4A 3RBXA 3JD3A 1Q7GA 3IP3A 3MJ4A 2BD0A 1NAHA 2JD1A 3I9MA 4Z3KA 4HUJA 1T2AA 1OC2A 3ZHXA 2PH3A 3F6YA 1DC6A 1UH5A 5A9SB 1DRVA 2VYVA 3DMTC 4XQGA 4GMFA 3SLKA 5K6AC 1GZ4A 3A9WA 2DUUA 4HFJA 1CYDA 1B14A 2EWMA 3V2HA 1ENPA 2Q2QA 4NR0A 4CMGA 4JIGA 2VHVA 5JC8A 1XQ6A 1DC5A 3WQSB 2Y1CA 1C1DB 1K6JA 4R4JA 4PG4A 4MVJE 4A2CA 4RLHA 1RWBA 1JKJA 4WK6A 3W4KA 5I7SA 1PGJA 3AUSA 2ZKLA 2PD4A 1H9BA 1KEVA 1C0KA 2EIHA 2ZB3A 3I83A 4I5EA 5JBIA 4TRJA 2YZ7A 3ZWNA 4DQXA 1YRLA 4ONEA 5MGBA 3GVIA 3W8EA 1KEWA 4W7HA 2Q4BA 4GVLA 3NRCA 4MIYA 3V2UA 3Q2IA 1IZ0A 4HX5A 4IGFA 4M54A 4I9NA 1ULUA 1FDUA 3CMCO 1KVSA 3AK4A 1W4ZA 3OJ0A 1P1IA 4JJGA 4UEJA 4F45A 6LDHA 4GGPA 4IJVA 3HUDA 4OSOA 3VPSA 3AOEC 4DBZA 3DZIA 4DC0A 3O38A 3TL3A 3LLSA 1EUDA 3WGQA 1R0SA 4IMPA 1ZSVA 1LLQA 4XGNA 3AWDA 3KEOA 4CMCA 4DMMA 1WDMA 2NTJA 2PKQO 2QYSA 4JJIA 5B4TA 3L07A 3RUFA 4XYLA 3VVCA 4L8VA 3GGOA 1N92A 3G49A 1GUFA 4I08A 2W2LA 4BHTA 1LSSA 1BXGA 3BTVA 4YRBA 2GD1O 3WYEA 4DIFA 3DBHB 2HDHA 1CQIA 1PU2A 3D3EA 2ZB7A 3Q3CA 5A03A 3DXFA 1FDTA 4XA8A 1H6DA 4JQCA 1SCUA 4ZGWA 1E6UA 2OMEA 3RFVA 2E4AA 1TXGA 4A73A 5CG2A 1F8GA 1I32A 2OXIA 4OOEA 4ILKA 4WLNA 3A14A 4LGVA 3ZZNA 1R6DA 5I7FA 1ONOA 4R5HA 4DIBA 4DPMA 3DZGA 3NGXA 2NQTA 4GBJA 3PK0A 3STHA 3ZU4A 2NU8A 1X0VA 4E13A 5KKAA 3ROMA 2A92A 3DONA 3GHYA 4KMSA 1BVUA 3L6DA 3H65A 1ADFA 3JYLA 5BSGA 3AY7A 2G0TA 1X7DA 3DAGA 4OXYA 4ZICA 4XKJA 5HBRA 1BG6A 3I9NA 3JQFA 5L9AA 2BFAA 1DDOA 4CM9A 4EITA 4NK4A 1J4AA 1MG5A 3RQSA 3CZRA 4HNHA 4IJUA 4EUHA 2EXXA 3CTMA 4BGVA 3ZV5A 3IDSA 3LF2A 3WG9A 2Y99A 3WMXA 2Z1MA 3T4EA 2PNFA 4JP2A 4ALKA 1QYVA 2VOEA 4U8GA 1OI7A 2A35A 2EJVA 2LDBA 5DP2A 2YV2A 3BIOA 1DLIA 5CDSA 3BTSA 1DIGA 2QIOA 2Q1UA 4CL3A 3JQAD 3NDRA 3K2BA 3C7CB 2I3AA 4HKTA 4RVFA 3W4JA 4E2XA 2OORA 3BHJA 4UVHA 4ZQHA 3S8MA 2I76A 2G5CA 2XF8A 4KZPA 4QSMA 4R41A 2C7GA 3K92A 1H6CA 4YJGA 2EKPA 1WNTA 5I8ZA 1HF3A 4NZ9A 4EUFA 5JAQA 1U3WA 2WTBA 3EGOA 3JQFC 1JDJA 2VHYA 3OM9A 4U5QA 4YT5A 4CLRA 2JCXA 3JTMA 1GZ6A 4XWYA 4U0JA 4EUEA 2A4KA 3OA0A 1N9GA 4GKVA 4C4OA 1LX6A 2YV3A 3N7UA 1NASA 2CSUA 1LSUA 1KBZA 2DTDA 2LDXA 2VYNA 3ASUA 3I5MA 4A27A 4M49A 4GLLA 3WSVA 1C3VA 1SOVA 4XIJA 1AGNA 3RROA 3GVHA 4J43A 5TRTA 5L40A 3QHAA 4ALMA 3I1JA 4BO3A 4G2NA 1NM5A 3OETA 3RUCA 5IN5A 4CJXA 1NWCA 2JL1A 1YDWA 3L6OO 5JDIA 4CM4B 3RKUA 1D7OA 2PKRA 3HQ4O 3M6IA 4OIMA 4Q9NA 2I99A 2O4UX 3E1KA 3OSUA 3P19A 4K1LA 3WFIA 3BMCB 1HZZA 1ENZA 1L7DA 4IDDA 4NJOA 5ITWA 1HYEA 3P2YA 2VTDA 1U7HA 2I5PO 1UP7A 3P2OA 1LRKA 3OF2A 3MZ0A 4GGOA 2VRCD 1BGVA 3G1TA 3GUYA 3PP8A 2CZCA 1LC0A 3RUDA 3WTBA 1E5LA 3HE3A 3IOYA 2PGDA 3EZLA 1DC3A 3F47A 5I8WA 1K5HA 1ZK3A 5CG1A 5U9CA 2C54A 1LLUA 4RL6A 5TC4A 3EAGA 4R01A 1PGNA 1U3UA 2HU2A 5H81A 3QVOA 4XQ9A 4MP3A 4BMVA 5K9ZA 5LC1A 1PX0A 1YB4A 3IJPA 3UCEA 1J0XO 1EDOA 3H5RA 1ONNA 2PH5A 4RPJA 3JQBC 3GN2A 1DHTA 5U4QA 5IDWA 3ZWVA 5BNIA 1BW9B 2GO1A 2JAPA 3ICPA 1Y5RA 3ROKA 1GYQA 4LCJA 5JDIC 1VSUA 4J2OA 1R37A 3VH4A 4YPOA 3KSZO 4PLYA 4Q3EA 1I10A 1MFZA 3WQRA 5L53A 1G6KA 4B7XA 4H16A 1I2ZA 4K26A 1ZK4A 1DAPA 4LVCA 3V1TC 5ADHA 3RCBA 1QP8A 3GA0A 2RH8A 3TJRA 1UUFA 2Q45A 2W4QA 3IIEA 3VH1A 2V7PA 2C5AA 3NGLA 3DWFA 4MVJI 3WOHA 3WNQA 1SPXA 1GPDG 2GZ3A 1H9AA 4IDGA 1B16A 4OHUA 1PWXA 2AXQA 2PFGA 4BOYA 3WQQA 3NYWA 1HDRA 3EVNA 1IY8A 2WM3A 2Q1SA 3HWRA 2I66A 4GX0A 3PZBA 2NADA 3ZU5A 4BNVA 3AU9A 5IDQA 1CF2O 1GQYA 4ZQBA 4TROA 5K0ZA 2BGLA 4IINA 4MJLA 2R6JA 4LCEA 4QFDA 3I4CA 1U8XX 3AOGA 4BNNA 2VT3A 4JGBA 5L4SA 3JQ8A 5COAA 4N5MA 5DOVA 4PLZA 3FHLA 3FBGA 4II2A 1ZFNA 3ON5A 3I9KA 1FJHA 4HV4A 2X0RA 4ZRMA 1G0NA 1MXFA 4HP8A 1HETA 3CUKA 3GLQA 3HDHA 4FPXA 2OZPA 4Y8VA 3DEYX 4IJKA 2BI7A 3E03A 1PL7A 3BAZA 4DLBA 1MUUA 1LTHR 1U4OA 4KDEA 1OAAA 3IC5A 4PRKA 5A05A 1RM4A 5B4VA 1E92A 1GADO 4J7UA 1I3LA 1ISHA 2ZB4A 4FFMA 1W6UA 3PIIA 4XGKA 4TSKA 2BELA 4AJNA 1E3WA 4AJOA 4B79A 1YQXA 4YJDA 1ZK2A 4RVHA 3QJ5A 1JVSA 5KWEA 3NAQA 1PSDA 4E2ZA 5JCXA 1SBYA 2PTGA 4IDAA 1NR1A 4FSHA 1A72A 3CXRA 4P22A 3GRKA 4B4UA 2Q46A 4PGFA 1DFHA 3L9WA 3PI7A 5C7IO 2X1HA 1P44A 1QXSA 2CMDA 1FXSA 2FMUA 1T2EA 3TQHA 1B7GO 2P9GA 3X2FA 1GAEO 1QYWA 1EE9A 4FFNA 2H6EA 1MGOA 1Y7TA 4DPLA 5JNLA 3WGZA 3HDYA 3I6QA 1KC1A 1QMGA 3RWBA 2IZ1A 3JD1A 3I4FA 2AE1A 4DWVA 2VRBA 1TT5A 1SMKA 2Q49A 4IMRA 3KSDO 5KJEA 1K6XA 2OO5A 2D8AA 1E3IA 1LDYA 2AQKA 3UCFA 5TQVA 4M8SA 1W0CA 4NU6A 3WICA 2GNAA 1TVEA 1HEUA 2IZZA 5F5LA 3F4LA 2C82A 4B3IA 1Z82A 5BR7A 5TSDA 2UYYA 2GF2A 2DQ4A 1PJ4A 1WP4A 4E21A 4IQ8A 4JBHA 3FR8A 3OH8A 4O6VA 1VKOA 2UV8A 2WE8A 5KJ1A 2AQIA 2JD2A 1A4IA 3WIDA
chains in the Genus database with same CATH superfamily
3ZQ4A 1IHOA 4EGFA 3QKWA 4QJIA 1RI5A 1Y8CA 1X7ZB 2Q9UA 5HRAA 1NXSA 1N6OA 2WINI 3JQDA 2XUAA 2O05A 2XCOA 1EWVA 3L7CA 4ZZ2A 3RVJA 4EVQA 5B3LA 2AD5A 5C1OA 2HHLA 3FTDA 5HW0A 3DB2A 4NEGA 5AP9A 3MBOA 4HY3A 1Z0UA 2C8VA 3KYDA 1ZI9A 3EXHC 3M4JA 1MW9X 3AUTA 4C7JA 5CDYA 4L5IA 4MS3B 1SH7A 2R00A 1C9MA 5A4IS 3S2FA 3ZDRA 2G1UA 2Q6VA 3L8ZA 1RE0A 4C7MA 1K9SA 3PNQA 3X1YA 1Z4IA 4YWHA 1X70A 4GR9A 2NYUA 3RBAA 4BKQA 2ZRBA 3KQOA 4QX6A 5J2UF 4NV1A 1QJCA 3IEXA 3MRTA 1ODIA 1KE2A 1SHZA 2MSKA 2YDXA 1SELA 4GI2A 4YP0A 4JJEA 1QO0A 2MINA 4ZD6A 3RYFA 3T7KA 3EJWA 3VNUA 1F60A 1SBHA 2HA2A 3DMHA 2V5UA 4EFLA 1A8PA 2NU7B 2P8SA 2PZFA 3G8YA 3VMMA 4QOSA 3Q4GA 3V3KA 1A69A 2ZWVA 2GPTA 4MJXA 3OZUA 2NNLD 5TPWA 3NTOA 2Q3LA 5TQ2B 4CEIA 4GR5A 2C20A 4U1RA 2J3LA 1UFRA 2YMPA 1EFVA 1JPNA 1CRWG 1SN7A 2KHZA 2LVBA 3ETGA 4UDYX 3ZHUA 4CF5A 1FNDA 1P5FA 1YO6A 4UAJA 3S2ZA 4UKDA 4AMZA 2NTYC 3KZKA 1RMYA 3WDKA 3UO8B 5LYJB 3GLIE 2I2CA 5LYYA 3VSBA 2E48A 4NEHB 4TV8A 1D8AA 2DSNA 1OB2A 3ROQA 1AXEA 1DKUA 2R1TB 2ZATA 3DOIA 4NCXA 1VGRA 2CLOB 4PX9A 3P52A 4ME6A 4C05A 3TQQA 4EEKA 2IVFA 1T8PA 3TQTA 1XNGA 4FXOA 3NHMA 2XX3A 4KVFA 4MQEB 1PNTA 4POAA 2NZ2A 2CFCA 5F2NA 1WNFA 5KTRA 3HFJA 3VXKA 1QE0A 1DQPA 821PA 3KKZA 3BXZA 4IL5A 3MNFA 3HWSA 4KN8A 1A5BB 3FVTA 2YJTD 4QHTA 2RHOA 4RVOA 4F3TA 2II6A 5F78A 1CZNA 2HPAA 4G4GA 4L50A 3ZZUA 3V1MA 2BEWA 1N0UA 2SKDA 3C48A 4YAIA 2HA3A 5AM5A 3GZNB 2YFQA 3SE7A 3TPZA 2VDMB 1RYEA 1RBYA 4Z1OA 4HAZA 1X2BA 3Q3HA 3GI1A 3QUSA 3EIUA 4MVYA 4GBMA 4YC7A 4CQNA 1QANA 1Y8RA 2O0KA 1U65A 3DQQA 2F4VB 4J4TA 3WWDA 1K9VF 1QWOA 3IQDB 4ZT4A 4GPBA 4JUBA 2E85A 2WJAA 4F3KA 5ENVA 1EX6A 1MA0A 1NAIA 4CIXA 1RSZA 2PL5A 4DAEA 3BXXA 1KMHB 5DMXA 1N5OX 1Q0SA 1VE9A 2CF6A 4G1FA 4ZKDA 1WB9A 5KWJA 3AZQA 1II8B 4G56A 4NH4A 4OB7A 1JYFA 2VAPA 4N41A 2EARA 3E82A 3RVDA 2YWJA 3QITA 3RU2A 3SYMA 2JGFA 4FFVA 1YE5A 5EFOA 3I5YA 4EAQA 5AI8A 2ZBDA 5DCYA 1K7XB 3B36A 1XEFA 2X8JA 1RBQA 1LQTA 1B73A 4KXFB 3DS8A 4N5LA 3V7UA 4DSOA 1FW6A 1ZZEA 2DFVA 4MOWA 2F55A 3D7SA 2YASA 3KHUA 1OROA 4GPTA 2W2QA 4TTVA 4XRRA 1XJWA 1SCQA 2ATXA 3IQZA 1JHPA 4DLZA 1GTRA 1DINA 2K6GA 3LY9A 4MDHA 3MCAA 4B9AA 1P1HA 1UWVA 1HV8A 1GPH1 4FSDA 2OLJA 3O1JC 3YASA 4EZIA 1E0JA 5A2GA 2CBGA 1NW3A 4CEHB 3AHJA 3REFA 1K8QA 2W6ID 3E2IA 2XOXA 4Y9SA 3B85A 3UGKA 4BNDA 1JVNA 1MB2A 3EEYA 2NV6A 3EMVA 4FMCB 3NHBA 4X3CA 4CRWB 4EHLA 1N34B 4TVSA 2G08A 2IOFA 4CLHA 1KKLA 2HA0A 1J2RA 2B7CA 4G5YA 4H15A 5HG0A 2XDWA 2BGRA 1ECCA 4YP7A 4ACAA 4LYHA 1E2LA 1K08A 5EXDA 3RRZA 1XQXA 5JO9A 3OT4A 4AKSA 4H7FA 4WCFC 4O59O 3G8CA 4R8LA 4LY0A 3TLEA 2VUSA 1DS6A 4HJXA 3LA6A 4BVHA 1EUDB 3AR3A 2C8JA 1QO7A 5KREA 4MV9A 1NVTA 1CS4C 1BFUA 4A8PA 5CA1A 3QXCA 4FGUA 4GKBA 3OZFA 4ZVOA 3MMSA 1ZAYA 2X3UA 3EPKA 4PBRA 1RYHA 5IH3A 4AJ1A 1XV5A 4CL8A 2UZ4A 3NJRA 2FUEA 3DPUA 3TX2A 1Q1ZA 3P5SA 4MS1A 4O4LB 3OQPA 1BXGB 3M83A 5GVRA 2MYNA 4UPVA 1D2MA 2NWQA 3DOJA 1Z68A 1WCIA 2C5SA 2HRZA 3KQTA 4QA9A 4HDAA 2AL7A 1KDOA 2CXHA 1NT2A 2VXYA 2ZROA 3H0EA 4JJ7A 3B1VA 1H6BA 1TK2A 2WPDD 3B9RA 2PGIA 1XQYA 3PSHA 3MT8A 2JLSA 3CZPA 4GSKA 5WRFA 5IMSA 1WUTA 5KTOA 1XYVA 2EBUA 2I6SA 3CIOA 3AWIA 2WSSA 2APJA 5GQSA 4KMOA 3SMVA 5IUNC 2GXUA 1INLA 1YHYA 2PBFA 2J48A 4B40A 3H8SA 3FHJA 1OCEA 1DSSG 1RPJA 2PJZA 5JMOA 4QYMA 1SQ0A 1VMAA 1Z7EA 5BV1A 4UHHA 3R7DA 3DL2A 1RYBA 3KG2A 3CYFA 1H2FA 5JVDB 3UGQA 1SCAA 5E4TA 1XEWY 3N6VA 3PFWO 1J1IA 4GZ3A 3I9FA 4QVIA 5K8LA 2HZBA 1KA9H 2CC2A 1H4QA 3P20A 2Y68A 1P2DA 3PL1A 1C7IA 1XRMA 2AOVA 1XLTC 3S2GA 1S8AA 4LZJA 2ZRMA 1CJCA 1S1CA 1MIHA 1T36B 4KIWA 5C8DA 1RQNA 3PICA 2O2CA 5ICMA 1Y48E 4B8YA 1RLJA 4BMXA 3ZH9B 3AUFA 3WGOA 1G8AA 3CF4A 2P62A 1HDGO 3EAQA 3JAWA 4Y6LA 5L7YA 2E37A 2CSXA 4RF3A 3HN2A 3SYKA 4AMUA 1NKTA 3FYUB 3RRFA 3AVUA 1NQWA 3IV6A 1L7AA 4M8IA 1IHXA 1ZOSA 4NDNE 4Q4HA 5ALFA 5AH0A 4FEAA 4EHDA 3JW8A 4DM7A 5HF5A 2Q7OE 4E6PA 5FV7A 1JTVA 2H06A 2LBPA 1NJ2A 2J5XA 3CB4A 4ARVA 4OQDA 1PZNA 3IOBA 2BI8A 4AJHA 4BV8A 7MDHA 2PKWA 5KHLB 2N1BA 1QV9A 1NL3A 3IE1A 3GFTA 2W5UA 4B80A 4DR1B 4YRAA 1V35A 4FU0A 3ICOA 4J7XA 4L7QA 4LOIA 1HH4A 1Y6QA 2H0RA 2VOJA 1HURA 1PJ3A 3I9V6 3VDQA 2E6UX 3RYCB 2ZUFA 1M67A 1P1FA 4QUAA 4I1IA 3SVTA 2NXNA 5IHPA 1Y42X 3KL2A 1LVHA 1T6NA 4IDOA 1K3FA 1Q1AA 2PUEA 1LXCA 3TFWA 2PCLA 3KRTA 2AHRA 3IAEA 3IO3A 1RLUA 1WCYA 2GZRA 4RHYA 1JQBA 2GPSA 2QMOA 3SBOA 3NT2A 1M34B 1X1BA 2X19A 2R0QC 3I9LA 1YRAA 3GEMA 4UXIA 3HYLA 4JHXA 4JBYA 2CGEA 3VDRA 4HCJA 1PVDA 1U8EA 2ZWPA 2AOUB 5HEKA 2HA6A 4DUPA 2YOHA 2OCBA 1QHNA 4EF5A 5T7BA 2HK7A 1N9GB 4R3UC 5EHQA 3UKOA 3NV9A 1EA5A 4MTCA 3WISA 3B5JA 1U3FA 2W6JA 2CHGA 3GEDA 1JAHA 3KV3O 3DE0X 4IGEA 3L8YA 1PL0A 1BZYA 1QJ4A 1H6AA 4J0FA 5K3OA 2QM3A 4QUGA 2CLHB 3KVRA 4B81A 5JHHB 1YCFA 1NR5A 3B6IA 4JXKA 3VV3A 4EF6A 2HWWA 5K1ZA 2FVYA 3JQCA 3C1AA 3ZIAA 1ABFA 4HFNA 1XEAA 2B6HA 3M6WA 4WFJA 2I78A 3PGVA 4BUJA 4YV7A 5JSQA 1YJBA 3DFUA 3K1AB 4YRFA 2QLLA 1AQNA 4W5NA 4LI0A 2AVNA 4RVGA 4UDOA 4Q12A 2K87A 2OK7A 1OJLA 4YQZA 4OLHA 3N7AA 2I29A 4DEYA 1A50B 1Q7CA 5F64A 1SC6A 3C8HA 3H2ZA 3L6EA 3NBYC 1LDNA 4P58A 4EB6A 4RKFA 3GIWA 4HSEA 1KIAA 1RXIA 4TRRA 4XX0A 1GCOA 3NBFA 1ULHA 1WHSB 4ZT7A 2AMVA 1AQJA 1ULBA 5JFOA 1GFSA 2O20A 2I7TA 2XNHA 3LT1A 1USKA 5K0NA 4G01B 3IDAA 1PTJC 3FKSD 3OZTA 4AFNA 3W6PA 4FE4A 2DPGA 4OQFA 1IBLB 4MV3A 4S04A 5E6UB 3ORFA 2QVGA 3MTQA 1ZESA 3RSFA 3ZW9A 3ER9A 1W5FA 1C41A 4AT1A 3B6MA 3AW8A 3GR6A 4E3WA 4PNZA 3FLBA 5HM8A 3CVVA 1GTSA 4JBIA 4MRAA 1MAHA 1ZNXA 3QI7A 4QUHA 3WLTA 4AN0A 4AZ3A 4B3TB 5C34B 5LQCA 3PHIA 3LBHA 3EEBA 3OZDA 1R0LA 3EH2A 2PGNA 2F17A 2IS2A 5IFKA 1E94E 2C92A 2ZRLA 1DXHA 1NDQA 5L7WA 1Q3KA 2L2QA 1NBEA 2CF5A 1G8JA 1C0PA 3DO5A 2C7PA 1U9IC 2BR3A 1YQDA 3N0TA 4N40A 1GG8A 3NQ41 4YDRA 5I7WA 5KX5F 4PG7A 3GARA 1TCAA 3MJSA 1I6WA 4C3ZA 4ND8B 1JDTA 5DWQA 5KIAA 5EQFA 4Z9YA 4DQLA 4J0QA 1WU7A 3R40A 5IJ9A 3IV9A 4RNDB 3BS4A 4FB4A 4JYCA 2VJLA 1P5ZB 3OLCX 4TYPA 4DZZA 3W4IA 3MUNA 4PZAA 1KGSA 3WYDA 5C1DA 3HEMA 2WFLB 2VEDA 4TTAA 1E63A 3H86A 3GEPA 1TTPB 4LYFA 4LK3A 2VCYA 4XEHA 5KTNA 1XZBA 3IUBA 5KWVA 2B8TA 3AUUA 4RUKA 3RRMA 2VDNB 4EYEA 5CB8A 1KDPA 2VK2A 2ACKA 4MW1A 4HBZA 4C29A 1R0CA 3VBCA 2I6FA 1YBVA 2HHHB 4WZAE 4YAWA 2V97A 5MN5A 2KE5A 3QEKA 3I6YA 3KJFA 1NHGA 3LPLA 3GRVA 2MTBA 1P6UA 2O8NA 4KRYA 4M55A 2ZIUB 1K66A 1LLCA 4JNKA 1JQKA 3KSRA 3PVSA 2PZMA 3F3MA 5A2QA 2BGWA 3K6KA 4QLAA 1YQUA 2B1JA 3FPJA 2GN6A 4KUGA 1JHAA 2RJ3A 4MWDA 2DUNA 3GGGA 2C5LA 1GU7A 2YN0A 2Z5LA 4LVNA 4L73A 5FLYA 3WLKX 4B33A 1XKTA 3IUPA 4TZTA 4OHYA 1D4OA 4RZIA 3ZE8A 1PJCA 3ZE6A 3STYA 4BU1A 4DQVA 4XFDA 4R1SA 4EW2A 3HHEA 3PGJA 4F06A 3U3DA 4C14A 1QYDA 3PC2A 5EG5A 3LLCA 1JKIA 1O6CA 2XB9A 4ESOA 4PLTA 4KQXA 4LK2A 3X1ZA 3LD9A 3KSBC 1U3TA 1R9NA 3CT4A 1PK7A 3DDZX 3FNGA 2PY6A 4B73A 4CKBB 2CLFB 4PLFA 4RCYA 1U0OC 2NYRA 2BJHA 2N0SA 1SBTA 1X3SA 5BWNA 3ZGXA 2EJUA 1KVUA 3GMSA 3L84A 2G6BA 1SJ9A 5D3ZA 2FN7A 4DRYA 4R0VA 4Z0TA 3H4MA 3M1AA 3FWKA 2A8YA 4RTRA 2GZ2A 4HPXB 2XITA 3WMEA 4FN5A 4RXMA 2ZAMA 3VVBA 1U7PA 1HC7A 1J49A 1YR7A 3O90A 4ITUA 5CVEA 1L3IA 2H57A 2ZI9A 4U2EA 1E5XA 4NDAA 5I4BA 4CKCB 3OIWA 2XV1A 1TM3E 3T7EA 3R7FA 5JJIA 4RVNA 3ZS9A 4GD3Q 3NKFA 1Z7YA 2XVZA 1SGWA 4JY7A 3RGGA 1KOLA 3ASVA 3WMWA 1XDZA 4FDAA 4CKEB 2J3EA 1QCCA 1W4RA 2IPMA 4WKBA 3EW7A 1C9YA 1YKSA 3MPOA 4QGBA 4F11A 2HHCA 1QNLA 4CG0A 4TGLA 5AJZA 2WB4A 2C61A 4DMLA 3ISVA 3OF5A 5LWQA 2QPOA 1XRJA 3FTPA 2VDQB 1E61A 3TJMA 5C5IA 1JNYA 3VI3B 5SZKB 3C7TA 2WZQA 4UJ5A 9LDTA 4E4YA 1WETA 2XWPA 3LT0A 3ISTA 4IM7A 5FUXA 4F93B 2IOHA 4NBTA 2C2WA 2CVFA 1L8XA 4QPCA 1QG6A 3LNTA 4TN1A 4C1NA 2JKYA 2XUHA 2HSZA 5HWSA 1J33A 1J2EA 1TT5B 4DDKA 1LPAB 1WZCA 4ZVQA 5CXQA 5KNCH 3TOXA 2GRAA 2A14A 4RH0A 2JAOA 4EK9A 5JJBA 3QX7A 3EQ2A 2RGRA 3I0ZA 3F6CA 3A4VA 1XMVA 1K2VN 2HX1A 5IM4A 4OQ4A 1CX9B 3FCAA 4JYPA 4FOLA 5IVIA 4EJSB 221PA 2RGNC 5E9QA 4D45A 1YOVA 1O3YA 1XJ0A 1YR8A 5CNJA 4E15A 5ULLA 1EA7A 4YP6A 3PHJA 5IAAA 1N5IA 3DBLA 4ARZB 4B17A 2YY7A 2P5UA 2DM6A 2B20A 3DEKA 4JMLA 4LSWA 3J80A 1H42A 1I7DA 3ZKAA 1U2QA 3QLTA 1MPXA 2L19A 3BH7A 4UM5A 1OWPA 3GG2A 3PEVA 1MBZA 1RI4A 3HU5A 4GC9A 5EPOA 4QT4A 4PQGA 4O08A 2IXGA 1A8UA 3LXUX 4WPGA 3OT1B 4KYTA 4C0BA 4XWWA 1MHTA 2C31A 3O0DA 2B36A 3PQ7A 3KAPA 3SHFA 1ZH4A 5K3BA 3A70A 4A0GA 2AUTA 4ZVRA 2Z8YM 3S2SA 1GPUA 5FUYA 1C4XA 4YGYA 5DGXA 4BNXA 1GNQA 2P9CA 3WWPA 3K9FC 1VCOA 3C5WP 5YASA 5CFZA 1PZGA 5L45A 6GPBA 1J2UA 1CUGA 3DLAA 1Q92A 3KYDB 4HNGA 2FZCA 3GXOA 5KSPA 2C57A 3GA7A 1NQOA 1V9SA 5DEIA 3VR6A 3BHMA 1TPZA 4WLUA 3TBHA 3N59A 1NW7A 5G3YA 2ZB8A 2ODNA 1VKZA 3KPVA 2PUBA 1M8JA 3P9NA 1F0KA 1OXVA 1XTSA 2C5FA 2YX1A 3RYFB 2RK4A 1LV7A 3A3PA 2MINB 4M1EA 5AW2A 1NG1A 3GV0A 4XIGS 2XWSA 4ZZ0A 3EGXA 4GSYA 4BFCA 5EQDA 4UBOA 3MB5A 4UVGA 4OA8A 3FPLA 1JQLB 3B3FA 5CITA 1PRYA 3Q8KA 1ZD3A 3A1FA 4EFKA 1AGYA 1L5YA 4NU0A 4WKCA 5TPWB 1DX4A 1J07A 1GYPA 1Z22A 2EWVA 2O7NA 3G7NA 3JQPA 4P53A 4CEIB 4MHOA 1EFVB 3L5KA 3S68A 1QH8B 1E3SA 4TRMA 2JIRA 1SURA 3SYNA 5CVCA 2W6ZA 3JQ6A 1OH8A 4JUDX 3HCWA 3E8MA 3SJ7A 1LBQA 3TQFA 4ISCA 1FRQA 1YBFA 4TV8B 5LDHA 2OCKA 2Y71A 3A1VA 3A7DA 2WUVA 3HXPA 5F51A 1BGXT 1EK2A 1ORVA 4WX2B 3VOBA 1JFRA 2EZUA 4Q21A 1R6VA 2ZJAA 1T26A 1W1IA 1IMOA 4GMXA 5LZ9A 3AL2A 5HUQA 2NTEA 3AKDA 4DUZB 1L7OA 3QVSA 1ECFA 5GVSA 2VNAA 3DEHA 5JSYA 3ZI7A 3FOWA 2JIZA 1Z16A 2ODAA 1VSBA 3G59A 4KPUA 5K3EA 1VOTA 3F4KA 3L82B 1Q12A 4UTXA 3WLIA 5FBVB 3G23A 3LYAA 3I34X 3F9RA 2YWRA 2ARKA 3LRTA 4NSNA 2QX7A 2BEWB 5IDYA 1BMFD 2SNIE 5LB2A 3TZEA 1YDEA 2GM4A 3BSWA 5AFSA 1ODCA 3DUFA 3JASA 1DLJA 2BKXA 2J31A 4IRMA 2RAVA 3F5FA 4YYEA 1Y8RB 5KYKA 1FJXA 1N25A 3CBGA 3D3WA 4J4BA 2QVXX 2HRBA 4RA9B 1DEHA 3D0KA 4N5DA 3AVQA 5AI5A 4AWXA 4FLEA 1IM5A 2O0LA 2A5YB 2VYND 1EINA 3TUIC 3VYWA 2H0QA 2P2DA 3A4TA 3D2CA 1DUSA 1XO1A 3L4BA 4NK5A 2XNKA 3LJKA 4DJEC 3Q10A 4NYMQ 2ZPAA 4QDJA 2AH5A 2C96A 4PBTA 1F5SA 1FYXA 4BEVA 1Z47A 2JH8A 5L95A 1X39A 3Q7IA 2AXNA 1QTNA 1KZGB 2WHPA 2VWQA 2WWWA 3S55A 2Z58A 2R6GA 1ZMBA 2ZDHA 4C88A 1W76A 2QUHA 1L7NA 2WIAA 2X8JB 3CV3A 3DM9B 3TZQA 3UJ6A 1K6MA 1IJKA 2FPLA 3GG9A 4OATA 1MAAA 1FYFA 1OZAA 1EX1A 1UJ4A 1ZISA 2H1SA 1RI3A 3EHEA 4BNGA 1RWXA 4D3SA 1DV2A 4HEHA 1Z9BA 3FI9A 4V03A 4ZQIA 1U5CA 1Z6QA 2HMWA 1NVDA 2HYDA 1IZYA 4BO6A 1M2NA 2QQFA 4Q01A 1AU9A 4MR8A 2ONKA 5DV9A 2CKMA 1PQWA 1RZVA 3V4LA 3D5TA 2J3JA 1L4HA 2FNAA 2SICE 2UDPA 1NUAA 2I54A 3KTAA 3PDUA 1ZI6A 4N39A 5G4LA 3STXA 4BNDB 4CM3A 1HEYA 2BLLA 1JQDA 1GZVA 2A0XA 4LDNA 3VV2A 2FDXA 1OX4A 2X4GA 3LUKA 3QIAA 3R3XA 4RHCA 5FA8A 3GX1A 1KJWA 1T24A 1IIBA 2QRJA 1K3TA 4LHWA 1P7WA 2R5WA 1IYZA 1PDOA 4OBEA 1HOXA 1YU6A 5D8DA 5ANRB 4GMGA 1X7GA 3EB9A 2ZJ1A 2ZRHA 4DPKA 3DH0A 3B70A 1XDDA 2GN8A 1E1NA 5BP7A 4R2JA 1A5ZA 1KY2A 3C3PA 2N1MA 3QVLA 4HLDA 3ZJ4A 1IZ8A 3AFIA 5FF9A 2V7EA 3U3XA 3GUZA 2FWJA 2O7RA 3M89A 1K0FA 3FHOA 1KY4A 2V7TA 1Q95A 2XVXA 3FNEA 3CW8X 4UAGA 3KETA 3GCDA 1CD5A 4MINA 5CA1B 3NG1A 1XZFA 2ILTA 2FE1A 3SC6A 3CU5A 2XUGA 3NX4A 4FCVA 3IULA 4FP9A 3QVVA 3UJHA 3W77A 2CCKA 4BY9E 5DEOA 4WL0A 4ACBA 2XYGA 1OFGA 3BJRA 5CFOA 2KSQA 4IFTA 4R3WA 3PXEA 4MS1B 3VGPA 2WUGA 5JPIA 4BP8A 5KEIA 2HCJB 2HSGA 6CHYA 5GINE 1W36D 2V55B 3QEOA 3ZY5A 1F17A 3R77A 4PLVA 1L8LA 3PI6A 4ZALA 4EEZA 3A4YA 4LZWA 4Y2UA 3T3EA 4NMLA 1FRFS 1P19A 1X80A 2BDEA 2X86A 1CJTC 4RKWA 1FDVA 1ORTA 4RD6A 4CTMA 5JQWA 2R4TA 3HJGA 5MN4A 1BXKA 1Z56C 3HK2A 4H2DA 4YJFA 4UVEA 4X95A 3QPBA 2WWGA 1NPYA 3M4ZA 4OU5A 3RSQA 3TE6A 4HEQA 1ZX1A 4BO4A 2D6FA 1JEQA 5DVZA 2E1RA 2ZCVA 3Q7TA 4BN0A 2HJWA 3F3YA 3FNRA 3U7GA 3I37X 3PGXA 4Y6PA 3BWMA 3VJLA 3IE0A 5GIPE 4BKOA 4KWTA 4PINA 5TVKA 3EVDA 1A5SB 3SJUA 2IYNA 4QRHA 1DKOA 3ZWPA 1IXYA 4WLVA 5DRTA 3WLRA 1H85A 4K40A 3VNRA 1PEYA 3A2LA 4RZUA 2Q2WA 2HYIC 3WFJA 4YAKA 4B3XA 3K9LA 1QKKA 3QV2A 1Y0BA 3B1XA 1W5EA 2CHEA 3F1KA 5HTOA 5DLQC 4E2WA 3L6BA 1X1AA 4QEKA 3F9IA 4RKQA 1R3DA 3ENQA 4ZO7A 1PD1A 4FHGA 4LC9A 3G2QA 1SHUX 2MSLA 1KR2A 1MXHA 2P68A 2PL9A 2R2AA 3JAWB 3BYZA 1XU4A 4JCOA 4NV3A 1JJ7A 1MJ5A 1R8SA 3S44A 2H8KA 2WJ3A 3Q5GA 5LNK1 2W8ZA 3D5EA 3NEPX 1W9MA 3VZRA 4ZYVA 4XIFA 4Q4HB 1XMIA 4Y6GB 4E3ZA 3DOOA 1F14A 3DJYA 2X0NA 4ML3A 4WFIA 4EB0A 3L0PA 8AT1A 3WGNA 4JLPA 4M9XA 4X8HA 3H9EO 2OKCA 3NPAA 1FSZA 3O74A 1PFQA 2GNPA 4MW2A 4YHHB 2E5FA 4GMDA 3ZX4A 2PEZA 5F4BA 3QBTA 1AZWA 2VH1A 4WBSA 3VJKA 1H2BA 2OSVA 4IS2A 1UJ6A 4Q7KA 2ZYDA 1CTQA 1F2DA 1DG1G 2KS6A 4LXGA 1QDUA 4P98A 5JMWA 4P4GA 1B00A 2JGRA 4D6PA 2AG5A 5C1PA 3TSCA 2W2TA 5JAZA 1E77A 4XTCS 2ZQ5A 2IYAA 4MMYB 1BYIA 1XL0A 5EJFA 5JZ9A 4PGAA 1EX9A 3DAYA 1H1TA 1T5LA 2YNMC 2JVJA 4DIUA 3B7WA 4OQQA 4PCVA 2PLRA 2RBGA 5A9RA 1RKVA 1AK2A 2QP9X 3WV5A 4C4XA 1D1SA 1N3YA 3A9UA 5I9IA 4DR7B 4FOSA 4D4GA 1YC2A 5HIAA 2DFTA 2F48A 3H18A 4PAMA 2KMLA 2PRKA 2GYWA 3B1ZA 3IUJA 2Y76A 2X6QA 3LRXA 5DTQA 4C3OB 2FRDA 4YUYA 5LUAA 2D54A 4PHCA 1LI7A 3OHSX 2C4KA 2PX5A 4G41A 2WVAA 1XX6A 3ANXA 3KJQA 4QTZA 2G1JA 4CL2A 5JXJA 1V3UA 2Z8XA 1Y3HA 2JLBA 2OYSA 2Q4TA 2PRZA 3UXYA 4BB5A 3DE5X 5LMNB 5CCDA 4PSVA 1RWKA 3CZ9A 1EWRA 4DCMA 4BXOA 5K6RA 3CVOA 3U09A 4FFRA 2ZYHA 5ADUS 3RRYA 3FPAA 1I0LA 4BBAA 4DDTA 2QYTA 2HT1A 3G89A 1Y63A 4G4SO 4AULA 4EB6B 4IH4A 5DM4A 1VSVA 1P3DA 1Q6ZA 2ZTLA 3L40A 4XX0B 5BUZA 3GLIB 1UJMA 1RPNA 1TCUA 1H66A 5B6IA 3SQXA 4AMVA 2I6TA 3E9CA 4Q19A 3PITA 1TEVA 3LZ6A 1Z15A 4UNPA 1R6XA 4ODIA 4GW3A 5TMBA 3C8MA 5EIXA 4JFRA 1PR4A 1TAQA 3OICA 2NAFA 1B0UA 2GD6A 1MU0A 1RYNA 3VOAA 4OAPA 4FWTA 3QFCA 4AZ3B 3ZDBA 2ZUDA 2BEUA 3QA9A 1W2WB 4FFOA 4JODA 1CUHA 4ITRC 4R5MA 5EUMA 3EY4A 4GU5A 3OMXA 2AHOA 1ZJWA 4NCKA 4YXWA 2JGLA 2OB2A 1UXHA 1B15A 4TUYF 3TOVA 4DTIA 5C5EA 1GO2A 5IT5A 5I9TA 3IB6A 4GXTA 2FX2A 5BSUA 4DMRA 5FOQA 3GLFE 1U2GA 4WXEA 4BLTA 4BV2A 1G4AE 1PD0A 3UBMA 2WWRA 4I4IA 4AMBA 2WF7A 2YV5A 1CUEA 4EG7A 3HG7A 3AR4A 2OZLA 1AQIA 1XBTA 1HE8B 4WN9A 2P2NA 4OHFA 4ZVVA 5E4FA 3EZ6A 5IJ9B 2A1TS 2X0IA 3Q1KA 3N0VA 4ABYA 4FYWA 1PKEA 5AKGA 3SS9X 5KVCA 3ANTA 2EG9A 4LJ6A 1I01A 5T8KC 2IS4A 3SG0A 5A62A 1W8IA 3EEOA 3L01A 4CPDA 2ZVDA 3C6QA 4D25A 1AQUA 2PCJA 3F8WA 4QUBA 4QUEA 3VJRA 1CHDA 2ETVA 3INRA 5DI3A 5EXSA 4NVRA 3Q7SA 3COYA 3GBVA 1EX7A 4NCNA 2I1LA 4CKYA 4DQKA 2FEMA 1Q1EA 1XWIA 2A33A 2DWCA 2JAQA 2ZYUX 3PE4A 3R3UA 4M0FA 4MVJM 2BCGY 3I2JA 4PYQA 2I87A 2OP0A 2VDWA 6ABPA 2BWJA 2NVOA 4FK8A 5B3JA 3UOWA 2GLTA 2I1VB 1E9FA 1EVQA 1IPFA 1P9OA 3FWNA 3VH3A 1DC8A 1JG4A 2N46A 5AW4A 3CLRD 1K89A 1U3VA 3DKIA 1SOMA 1E9EA 3K73O 1XDSA 1YZHA 4D26A 3B8EA 4XSGA 3GMTA 4BQIA 1TVCA 4F8JA 5JQGF 1WBDA 4GP7A 3WDLA 5GJBA 3BGDA 2I65A 4Z3OA 3TTTA 3WO0A 1CU1A 1SUFA 2E82A 3R0JA 2Z5GA 2YJ4A 2PS0A 4GUDA 4KGXA 3KLNA 4W9RA 3MW8A 1KSFX 5JXGA 4RDXA 2Q62A 3LTEA 3DL0A 3WAJA 4OL9A 1U90A 2LE0A 2QPLA 3VR4H 1JSLA 1Z5PA 4B7ZA 1S2MA 3GD5A 4LZZA 1DXYA 4IUCS 1P1JA 2PPVA 3FLEA 1VJGA 5FI0B 3T3PB 4CYMA 1D04A 3N58A 4DJAA 1U4SA 3AB3A 2VJPA 3RC9A 1MB4A 4CBVA 2JHCA 3K30A 1WBBA 2RKWA 3EGCA 1XPRA 4L28A 4LDPA 1IB0A 1WSAA 1TJPB 2NXEA 4HN9A 4IHJF 5HKOA 4FS3A 2UUBB 2PGOA 1VPDA 3D02A 2HA5A 2CLKB 2NVWA 4DR6B 3PC6A 4ISBA 4QOEA 1JIUA 4UZSA 3QU4A 5F21A 4E51A 1YH3A 3ZHSA 4LF4B 2B0JA 3LP8A 1DC7A 3G6WA 3R8FA 3WLHA 1W9HA 1KHTA 4AX4A 3C85A 2XMDA 1Z06A 2PIAA 1X9IA 4TM8A 1I6MA 1QB8A 4WINA 5ERXA 3DLBA 5IAOA 1MJFA 2C3OA 1E0KA 3IQGX 4URYR 3HYSA 4UXJA 3IX7A 4DCGA 4RTQA 3OWOA 4MXDA 5E8JA 3KOWA 1ZRNA 4DHEA 3HSKA 4WASA 5COQA 5GGXA 1O9GA 1Y7IA 2EGHA 3CLSC 1ZHFA 1AN9A 3M6VA 3THOA 3SZRA 4EY6A 5CDTA 4JP1A 1BU8A 2G76A 3G2KA 3K5PA 1DJPA 2OAGA 1O0SA 2PN1A 2HGSA 2CYBA 1G291 3CZCA 1FB5A 3IOEA 1X8KA 4QDXA 1RS0A 2WSLA 2JEZA 4W1PA 2IZOA 2H07A 2O7VA 2VZ9A 5BMVF 2Q4DA 3SE0A 4QTUB 3UBTA 2H65A 2RHWA 2JFXA 2MDTA 1Z45A 2NP6A 4DBVO 3T4PA 1KZHA 3TRJA 1W0KA 1GD1O 1J7KA 4ZAZA 1KJJA 3RC3A 5CM2Z 2FWRA 3U81A 5KMGA 3FH0A 2UXDB 3QPVA 2P4QA 3AJRA 4YX9A 3FF1A 3QBVA 5I48A 3ZN2A 1Y3IA 2GDZA 1O0BA 3FJYA 5DYIA 3V6MA 1T10A 2BY4A 3GN1A 3PD0A 3ZDYB 5IWAB 4NMMA 4H1UA 3U4GA 4YAGA 1KPHA 3ANMA 1HNNA 2YJ5A 2QD4A 4I1PA 4GZMA 4RPKA 1QU2A 3G0IA 3LDHA 1TM2A 1KI6A 4AKGA 1QORA 4HWRA 3G2IA 5DF1A 4DSNA 4JXZA 1WTCA 3AU8A 4AS3A 1MABA 1YOVB 4FDTA 4M7PA 2YHAA 1E7MA 3QYPA 2PT5A 1ZRMA 1REQA 3DBLB 4YCBA 1Z5OA 2WMNB 4H1HA 3MJTA 3WVNA 3BSFA 2GCEA 1JGTA 3IMKA 1MDBA 2J9XB 4Q3BA 5J59A 3R6LA 5E3IA 2XQJA 2VK4A 2P9TA 2XT0A 2GK3A 5FNZA 5K3DA 4BGEA 1OILA 1FTQA 4JB2A 1F8XA 4LDZA 2WSSD 4HAWA 4KWCA 3Q88A 4H3HB 1N8KA 2JGMA 3URMA 3TZHA 3ETCA 4NF2A 2R2GA 3WYFA 1F51E 3LI2A 2N3ZA 3CE6A 3DHYA 4ILEA 5DBHX 2XCIA 4DR5B 3PQFA 2B4TO 3EK2A 3GVXA 4ZARA 5MGNA 3BD8A 3BF7A 4B3HA 3VBEA 3Q7EA 3EPRA 4ZREA 4WDRA 4K8RB 2X6RA 1CC1S 3OD5A 4C0JA 1JIKA 2G5TA 4M0UA 2R8ZA 3UAYA 4PO8A 4RJKA 3SOZA 1YQGA 2J5QA 3C43A 4N49A 3U3OA 2IXEA 3BCHA 2JHAA 2RBEA 4YR7A 1K75A 4R8MA 2OBLA 4EWLA 2BFWA 2X8AA 2W6MA 1XHEA 1MGPA 3EMDA 1JSZA 1BQ4A 2C3MA 3C3KA 3DZ8A 5FOUA 1N6HA 1ZUHA 2W70A 1QHXA 1WW2A 5LBIA 1GNSA 3BCRA 1CRQA 2JHFA 4IXNA 3RR2A 2MOKA 4PG8A 1WV1A 1T8UA 4Z4FA 5LP6F 2BF7A 5HMMA 3EGXB 2QMQA 4XYEA 3WLAA 3LT2A 4KFCA 2QQ0A 3PYMA 5K3FA 1R0RE 3G7SA 3RC2A 2XE7A 3QXHA 4BTEA 2CT8A 4MA4A 1C3JA 1N2IA 2MR6A 3FSRA 4K5QA 1QM5A 1QIEA 2EEPA 2FPGA 2ZVQX 3EIQA 3VC7A 1IBSA 1X3LA 4I2VA 1BDBA 2XZDA 4JJZA 3JVEA 3T7AA 3U7IA 3OZCA 3ZCPA 4LHZA 4LW8A 1JZSA 4AQ7A 4D82A 4GRAA 5FHRA 5HBGA 2XB4A 3G0DA 5DP1A 5GONF 5H80A 3T52A 5KAPA 1WKBA 2HIAA 4WXRA 3PQ3A 4NG5A 3E9DA 4ARUA 5B12A 4NE9A 3ZCQA 5AJXA 3GLSA 2IYFA 4YCAA 3CINA 2IYOA 1L7RA 4JLBA 5JDCA 4U0KA 3UK0A 3EDYA 5JZSA 1XR3A 2F1IA 4F1JA 2WZCA 3C24A 1A97A 2A5GA 3DEIA 5HIMA 4F6CA 1ETHA 4QLBA 2P0AA 3NCHA 1ZVVA 5DJ5A 3FNFA 1NXOA 3F3SA 3H5NA 2AW5A 4YRKA 2IE8A 4KPUB 5IUJC 4LE1A 5E7QA 2J5BA 4KX3A 2WHYA 1FFXA 4NDZA 3PXCX 4P92A 3HADA 3ADOA 1MOPA 3NEYA 4QGHA 5ICFA 2W2OA 2RGUA 3IESA 5JCOA 5JS7A 3GPBA 4BTVA 3N5KA 2YY5A 3DUFB 2CL6X 3JASB 3K8ZA 4CDNA 2R5NA 2J3DA 1SUIA 3AKCA 2M98A 1GTZA 3A05A 1SFRA 3D3WB 3DZKA 4G0PA 1YCHA 1NVUQ 3F7OA 3TZCA 3QTTA 3UK6A 3EMBA 1AKUA 1CUWA 3VMFA 2QUKA 2WF8A 5L6MB 1U3CA 2W6JD 5C8ZA 2UZIR 2DUWA 2AEMA 2OCIA 2UZ3A 3UUGA 5DI9A 1ISJA 4S24A 2XZLA 2PYDA 2BRUA 3R4VA 1RRFA 1QVRA 1JW9B 3OPMA 3ZIUA 4W9NA 2DLCX 4TTTS 3T94A 4ZYUA 1U2DC 3EEFA 2GLUA 2BR4A 2WHPB 4W5TA 5A5FA 5K09A 3GBSA 3ZIAD 4EFDA 1VL8A 4OFBA 2O0HA 1N7HA 2BGKA 3B1FA 2ZBQA 4NP6A 4XFKA 3C6BA 1RYDA 4KUHA 1VJ1A 1MAVA 2EDCA 2WU0A 2XYPA 4FI3F 3R7WB 1C7RA 3PT5A 1QUEA 3H9CA 4PLGA 3FPSA 3QXJA 4QJ3A 4BX9A 2QHXA 5ABPA 1ZN8A 2D0IA 3DMFA 1BHO1 2DZDA 3EUAA 3PIDA 3PF9A 3PIRA 4MR8B 1GA4A 4K2HA 3S7ZA 8GPBA 2CJFA 3KTAB 2RONA 1Z25A 2VYQA 2ZJOA 4PAGA 5HVNA 4AG5A 1JKXA 1QKIA 1FNNA 1PJSA 1OX4B 2VLBA 3PQEA 3LXRA 3W3AA 3UK2A 4JI8B 4BNWA 3SQDA 3HR8A 3R75A 1FC0A 5DBIA 2QTFA 3VHXA 1QGUA 2Z43A 1R74A 4DNXA 3IAAA 4B5KA 1T5HX 4H6PA 1JB9A 3KB6A 1BFKA 1C4KA 1EZ1A 3K32A 4N3BA 5LQMA 3ZBQA 3H17A 3FFAA 3NHSA 4CMKA 1OXSC 1JP7A 3FUVA 4N0QA 5AT1A 2D1SA 3A9VA 4IQFA 3RIGA 4XQ0A 1AMOA 1P9NA 2IDMA 3NNDA 2BZ0A 3RD5A 5DBFA 1GNTA 1KBQA 3GGDA 2XRMA 3K9BA 1K7CA 3W9BA 1GFIA 3ITNA 4Q9HA 1TF2A 5ALWA 3ZPXA 4ZGGA 2CNBA 2UZ0A 3QE0A 1CEXA 4M98A 5FO1A 3T3IA 4DCTA 4ZMRA 3B51X 3EOAI 3PFFA 4KOAA 3LUAA 1O1YA 4LVOA 1DEKA 4JC0A 3KU4A 2W90A 4BNYA 1N5MA 5LIPA 2JGJA 1EFDN 521PA 3I5AA 4NULA 4EY7A 2CNWD 1QOQB 4RY2A 4YRCA 2XVYA 5AXCA 2H9IA 3MAJA 3I62A 2YBEA 3QQPA 2ZUCA 4M76B 2KM1A 2X76A 1I14A 4Y2JA 4F21A 4FGZA 4MRPA 1X80B 5JAHA 1YOBA 4QUDA 3GJZA 4RLFA 2YYYA 4YRTA 3FTCA 1EJ6A 2WNIA 2PM8A 4INJA 4YJFB 1D5CA 3AHIA 5LJLA 1XCGB 2Q2OA 2BFBA 3MIIA 1VMKA 1NTOA 3OQHA 3TFOA 1Z4PX 3JV7A 1XKXA 3GLHA 1JEQB 1GV1A 5KSZA 3I2HA 3WGVA 2AGVA 2UVDA 1J7JA 2WVJA 4G0OA 4Q1AA 3Q7RA 4MARA 3BK1A 2IDZA 2QVBA 3GFBA 4Q7EA 1NW8A 2PMBA 1E2UA 3JD4A 1AGXA 4DCVA 4IWNA 4RDHA 4REMA 2SKCA 3K8QA 1QLJA 1YFZA 4F7WA 1GPKA 3M5PA 5KJ6A 2AMFA 2MYPA 3MF4A 1G2PA 3FVVA 4G84A 1KJQA 2JF0A 3C5CA <