2AE1A

Tropinone reductase-ii
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
259
structure length
252
Chain Sequence
AGRWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNDCLTQWRSKGFKVEASVCDLSSRSERQELMNTVANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATQDPEQKENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGGLMANCGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPINONE REDUCTASE-II
publication title Crystal structures of two tropinone reductases: different reaction stereospecificities in the same protein fold.
pubmed doi rcsb
source organism Datura stramonium
molecule tags Oxidoreductase
total genus 94
structure length 252
sequence length 259
ec nomenclature ec 1.1.1.236: Tropinone reductase II.
pdb deposition date 1997-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ae1A00
3QW2A 3FCOA 4GSKA 4GX0A 1T2DA 5L3ZA 4H7PA 3RC1A 1FJHA 4BMVA 5I7FA 3QWIA 1PGOA 3LT4A 4GVXA 2JHGA 4FOSA 1I8TA 2JFFA 5DNAA 3VTZA 3PHJA 4YVFA 3RD5A 3DZBA 3V2GA 1SCUA 1JA9A 2EW8A 3HSKA 3KB6A 4FGWA 3WBFA 5C7LO 5JXWA 3TZQA 4GSLA 3ZU2A 1B15A 1I24A 2FR8A 5TQVA 4M49A 4OH1A 4NIMA 3GNQA 5K9ZA 1R6DA 4RQUA 4XWYA 1M6HA 1BRMA 3PWSA 5J23A 3AOEC 1OAAA 2QQ5A 5CAEA 4XDYA 5L4SA 3QY9A 3WNQA 5KJEA 4BQPA 4NJMA 4TRRA 4BNZA 3TN7A 1FDVA 4BOYA 1QRRA 4MOWA 4Y9DA 3PZRA 3H9JA 1P1IA 4GWGA 1JLLA 4TRNA 4AJNA 5KWEA 3PGJA 3WTBA 3UN1A 1IPFA 1KEVA 1GTMA 3GVCA 3GEGA 4IS3A 1E7RA 1DC5A 1UUFA 4BO2A 2HUNA 3OH8A 3L6EA 2C2XA 3VAZA 4CV1A 3AY6A 4AG3A 4ZJUA 1PQPA 4J4TA 2VRCA 1DC4A 1JAXA 4FW8A 2O48X 2BI7A 3GZNB 1K6IA 4A73A 3DTTA 3F1LA 4DIOA 4CLRA 4MVJF 1T2FA 3U4DA 2R2GA 4J6FA 1KC3A 4R1NA 5IZCA 4B4UA 1MC5A 1HTBA 1P74A 3WMXA 3AUTA 3TQHA 2ZB3A 4FPXA 4IBOA 3OECA 2VHXA 1ADFA 1JKJA 2YHUA 4ZQGA 4OO3A 3LC1O 1MXHA 4ND1A 3W6ZA 2X58A 1C3VA 1QR6A 4F6LA 1PR3A 1QV7A 2ZYGA 4ZU3A 4CR7A 1E7YA 3ROKA 4DGSA 1PL6A 2E82A 1LX6A 4AJLA 1ZIDA 3U5TA 4CLDA 1JAYA 3JQBC 1PS8A 1ULUA 1NVGA 4G65A 4PLYA 3GMSA 4YAGA 4CLOB 5BR7A 4HNHA 4DBZA 3ITKA 3RJ9A 3U0BA 3KHUA 4PG5A 1NQOA 3DXFA 3JV7A 5LC1A 2W4QA 4YR9A 5KVCA 2QW8A 2X5KO 4AJHA 1P45A 1F0YA 1X14A 3WGQA 2PD4A 4BO6A 1YGYA 3K92A 1RM4A 4M8SA 1DB3A 4E3ZA 3EK2A 4KUGA 3T4EA 1XEAA 1OC4A 4PVCA 2AE1A 2GRAA 4JBGA 4BNIA 2B5WA 3D1LA 3GRKA 4YB8A 5A9SA 2EG9A 2VCYA 1LC0A 4QT0A 1ID1A 4DXHA 2DTDA 2RIRA 4OSOA 1DBVO 1Z6ZA 3GR6A 5DCUA 4L74A 5ILOA 1ZK1A 3O8QA 5KVQA 1RYDA 2Y1OA 1VJTA 3MZ0A 1XSEA 5JMWA 1HZZA 1HZJA 3VZSA 1YRLA 5JY1A 2D5AA 4Q3BA 2VWQA 3FTNA 5I7EA 2VTDA 4MO2A 4YJFB 3WS7A 3QVSA 1JWBB 1PGPA 2V6FA 2ZK7A 3GAZA 5G4KB 3WMWA 4XB2A 3CPSA 3LLVA 3BHJA 4EZBA 5BQFA 4IDAA 4RVDA 5IJZA 1F17A 1ISIA 4UVHA 4WCFA 1YB1A 1XELA 3TL3A 4QX6A 3MTJA 4YT8A 1GYPA 3VVCA 4BUCA 4I9HA 1HDYA 2NADA 2ZTMA 1ZEMA 4MVJP 5EMHA 5KKAA 4GGPA 4CMJA 2NQ8A 2J6IA 2J5RA 1HWYA 1DAOA 3OFSA 1LEHA 2RAFA 4CODB 1GZ3A 1LLCA 1RYEA 2OP1A 2ILTA 3BMCA 2AQKA 5JO9A 1VL8A 1B16A 4CM6A 2FRDA 4IXWA 3ZCXA 5JAQA 1X1TA 4IGFA 1HEUA 1H0KA 1N9GA 1UP6A 1NQTA 2YW9A 4YEDA 4BNYA 4GMFA 3OIFA 3PYLA 1LJ8A 3OQ1A 3GEDA 4XIYA 4CJXA 2DFDA 2VQ3A 4GL4A 3SC4A 2J8ZA 1EMDA 1LLUA 1U8FO 3D64A 4CUZA 1Q2XA 4ID9A 2GDZA 2JL1A 3RKUA 4YQYA 3STHA 2AA3A 4UUPA 1DSSG 4CM5A 5FWNA 4Q3EA 5TJ9A 1AUPA 4L4RA 5DT9A 1GV0A 1UXKA 1U2GA 1YBAA 3A1NA 1WW8A 1EK6A 4XR4A 1LBEA 3KSZO 4R4JA 1XR3A 3KM0A 2WD8A 3CMMA 4XKJA 2Y0DA 3W6UA 1LDMA 1A27A 2F00A 2O3RA 1BMDA 5TJHA 1DIRA 2IDZA 1O94A 3PYXA 2RHRA 1O95A 4JBHA 5CPFA 4J1NA 5T6BA 1NR1A 3EW7A 1PGNA 1YJ8A 3HJAA 3M6IA 1NAHA 4BNVA 4WE3A 1ZXBA 4Z9FA 4B4OA 2NU8A 4HX5A 2Y93A 2F1KA 5A1TA 2V65A 3E6AA 3KLPX 5AVOA 2PNFA 4OXKA 1SEPA 3OQBA 2FZWA 2VRBA 4YRDA 5KOIA 3ZU3A 2Q99A 3WICA 4EDFA 5I7SA 4OOFA 1QMGA 2JHFA 1KETA 3ZNQA 5C7IO 4LCJA 1EK5A 1ZEJA 2NUAA 3NT4A 4WEQA 5ER9A 3DHEA 3PI7A 3C7CB 4I9UA 4N5LA 1A7AA 3L0DA 2Q4EA 4KP7A 4BB6A 4B3JA 1Q0LA 3NKLA 2O3UA 4JP3A 5G0TA 3ZWBA 3F5SA 1PJLA 1GZ4A 2PKQP 2VHWA 5T5QA 4DQXA 2ET6A 3QIVA 3DMYA 2Z5LA 3FBGA 3WGYA 4B7XA 4CQMB 1G0NA 3I5MA 2BFMA 3C7AA 3EVTA 3GFBA 4R51A 3IL2A 3EC7A 4GAEA 2JJYA 3VDRA 1NFQA 2JAPA 1B7GO 4R01A 4O59O 1N8KA 3DBHA 2JFGA 2EKLA 4XYMA 1V3UA 2NM0A 3K2BA 5JPIA 1L1FA 2UDPA 4PG7A 4XYLA 1MLDA 4UVDA 2PK3A 4P8RA 3GHHA 4YA6A 4OKIA 5BSGA 1E77A 2VT3A 1NR7A 4WK6A 4YTEA 1DIAA 4LW8A 4RCVA 1E6EA 3WGGA 5C5IA 1YONA 2ZTUA 1NAIA 1C1DA 3ONEA 3PGXA 3Q1LA 2QX7A 3SJ7A 3VPFA 3DBRB 3AWDA 3OJFA 1M2WA 2AQIA 4BO8A 4R3NA 2CY0A 3VOSA 3JQ9C 4D79A 2AQ8A 3W4IA 4UEKA 3ANMA 1LRJA 4QO7A 2P4HX 3E5RA 1GYQA 1H2BA 1E7SA 3D0OA 3KXDA 4BNHA 2Q49A 4FDAA 1U9JA 3QE3A 4QUKA 3PWKA 1O6ZA 4BNJA 5DBFA 3QA9A 1E5LA 4BV9A 4B79A 1W4ZA 4FFOA 1R4NA 4J4BA 3PRJA 1F14A 3H5AA 1K89A 1OI7A 1DLJA 3P5SA 5FFFA 2AXQA 4D0SA 1NTOA 1ZMTA 2PD6A 5FF9A 1YBVA 2A92A 2G82A 4GQAA 4NFHA 5F1OA 2ZJ1A 5EN4A 3WXBA 3I9LA 3ZNOA 2AMFA 1B8UA 3PFWO 4J1SA 4W9NC 4NBTA 2EKPA 4Z0PA 1WVGA 3PQFA 1E92A 4RO0A 1UP4A 4O5OA 3V1UA 3GUYA 5CEFA 4PRKA 1I36A 4LSWA 2UV8A 3FBTA 4JN6B 1E3SA 3AOEA 1ORRA 2WYWA 3CTMA 4KTTE 4XZ3A 2AQHA 1BGVA 1PWXA 3RUIA 3W8FA 4HADA 1ZJZA 2LDBA 1YQDA 3DWFA 3ZHYA 4MINA 4WPGA 3TRIA 5HM8A 3VTFA 4ALLA 3LVFO 4ZQBA 4B7UA 4GPD1 1GEEA 4RVHA 1UP7A 4L76A 4LVUA 4XB1A 3FTPA 4ZRMA 4FJ1A 2AG8A 3SVTA 3KVOA 4YACA 2CZCA 1WWKA 1BXZA 1ONNA 3P2OA 3DQPA 2NVUB 3VPSA 1V0JA 4IGEA 3U09A 4NU6A 2DLDA 2O4CA 4EEXA 2P5UA 1LSJA 1P1KA 2J3JA 2EW2A 3OA2A 3P19A 8ADHA 3R0IA 4D3DA 5ILGA 4U0JA 3OEWA 5ICMA 2NU6A 3TWOA 4D0RA 1TI7A 1QG6A 3JQDA 3FR7A 4E32A 1NM5A 5EINA 1GD1O 1DIGA 3KYCA 1T2CA 2W2LD 3PJFA 4IQGA 4L73A 4GKBA 1T2EA 2YJZA 4JIGA 4YJHB 4BO3A 3TPCA 3ICCA 4NBWA 1IPEA 2Q46A 1C1XA 2C5EA 5DOVA 1G1AA 3WIEA 1EVZA 2B83A 1ISMA 4B7CA 3JQBA 5EJ2A 3MJSA 3VDQA 3JQGB 4B3HA 3DO5A 2XAAA 2IXAA 3Q9NA 2R00C 4IQ0A 3LC7O 2BF7A 2DBZA 2JCXA 1OZAA 4M54A 1B8VA 1NQAO 1Z73A 2GN6A 5EQFA 2P5YA 4BKOA 2VNAA 3K9QO 3OMLA 4IINA 5JAMA 4E31A 5TNXA 1WPQA 4L4XA 4XEHA 4U5QA 4BO0A 4AICA 4ZGWA 4R1SA 4E5MA 3A9WA 1C0KA 4R5MA 4CUKA 3GNTA 3RAJA 5AXBA 1WP4A 4JJFA 3MJVA 4D46A 3HE3A 3E18A 3OICA 1HE5A 1EE9A 2OP0A 3ETDA 1GPJA 3DOCA 3QVWA 4IY1A 1ZZEA 2ZTLA 4YYZA 3DHYA 3IJRA 3L4SO 1UDAA 4E33A 4BHTA 3Q0EA 2O3TA 4ESOA 2O2YA 1B8PA 3AUUA 2X0IA 4EI2A 3I9KA 1U3WA 3W4KA 4MKXA 2QYTA 4EITA 1U5AA 3NGLA 3NGXA 2NV6A 2FPPA 5U4QA 4PLPA 3G0OA 2WE8A 1SNYA 1H93A 4IJKA 5FEUA 3K5PA 3MJTA 3MOIA 1P1FA 4RZHA 3GZNA 3V1TC 3BHMA 5ITWA 5KCZA 1Q0HA 3DR3A 4Z9XA 2Z1NA 5CG2A 2VRCD 5DDIP 3F5QA 2DAPA 4M87A 4ND5A 4J0FA 2BKAA 1Z82A 3K96A 2VZ9A 1VJ0A 2HDHA 3GVIA 4II3A 3G1UA 1I5RA 2PKQO 3S1LA 3SC6A 2JCYA 5A03A 2BI8A 5A9RA 2ZB8A 2YV1A 1QLJA 4Y67A 3UCXA 4AJ1A 3NDRA 4CM9D 4BNFA 4NPCA 4J2OA 4DREA 5L53A 2XF8A 1J5PA 3WDSA 2RBEA 1AGNA 1MC4A 1BXGB 1YOVB 3GPDG 4BNNA 5KVVA 3WFJA 2C59A 3VZPA 4MVJE 1EBFA 4FFLA 2BGMA 1ISJA 3L6DA 3JCZA 1N7HA 3PFFA 4Y6RA 4GWKA 3MCVA 3AY3A 3WGIA 3NTOA 3AM4A 4TZTA 4CMCA 3FRJA 1C0PA 1HSZA 4UEOA 4PFJA 5I8ZA 1IUKA 4BMNA 4Q3DA 1PS0A 4D45A 3RVDA 1PJTA 4OJNA 2IYPA 4LMRA 4TRJA 1EVJA 3BXXA 3KSDO 1GAEO 4U0KA 4L75A 3PDUA 3SXPA 2RHCA 3TZCA 1BWSA 5HWSA 2H1SA 3RSHA 5IDQA 1B2LA 1HDOA 2NTVA 4WASA 1CIVA 5G2OA 4YCAA 3EZYA 3NJ8A 1WDMA 3ROPA 2EKQA 3BZUA 2EP7A 4CV0A 1B3BA 3MOGA 4RPLA 1LTHR 4E5PA 4YBZA 2C54A 4LVCA 5B1YA 4BO4A 1LSUA 2RH8A 4WLNA 5HBRA 2W2KB 1KOLA 2BFOA 2CNBA 3H5RA 3GDOA 1TT5B 3BTVA 1X7DA 2GUGA 2VWGA 3OJOA 3PDJA 3S2GA 1LSSA 2Q1TA 2J5KA 3DAGA 2PZMA 4D3FA 1D7OA 1IB6A 4OOEA 1PS9A 3GNSA 3WBBA 3RC7A 2DFVA 3NJ4A 1M66A 2VHZA 2GZ2A 4KMSA 2O7QA 1NP3A 2YFHA 4URFA 4C4OA 3INRA 1BW9B 3BIOA 3U49A 1R66A 4HFJA 4KZPA 4W82A 4DPMA 4YT2A 1BDBA 2ZQYA 1HKUA 3M2PA 4UULA 4XD2A 1JVSA 2VOEA 3UOGA 1GUYA 1ZVMA 2OOSA 4I1IA 4MVJM 3F4BA 4A5OA 1KS9A 3RC9A 3QWHA 3GOHA 2C2YA 2V6MA 1W73A 3HWRA 4DWVA 1R4MA 4DYDA 1NFRA 5BNTA 2W2LA 3LZ6A 1U4OA 4E0BA 1DC3A 1GZ6A 1XHLA 1PGJA 2VZ0A 1IL0A 4B8WA 1NBOA 4TROA 3BMQB 1BDMA 3IP1A 3V2UA 3ZWVA 4RF4A 2HCTA 4LCEA 3IKVA 3KOUA 5LCXA 1GU7A 3ZWMA 1MP0A 2HSDA 1QYCA 1XDWA 2X9GA 1UR5A 1XLTA 1GL3A 1V3VA 3WYCA 2GO1A 5F21A 3EVNA 2PV7A 3EHEA 3GHYA 4M89A 1ZUD1 1EDOA 1EUZA 2OMEA 2OHXA 3JQ9A 2I67A 2FSVA 2IRWA 3C24A 4CM4B 3DDNA 4BNWA 5IDWA 5GZ3A 5DN9A 1JW9B 4LRTB 3QQPA 2NLOA 5B4UA 2JD1A 1EVYA 1PJBA 2Y67A 4NH4A 5CP8A 4IDEA 3H2ZA 5ADHA 1KEWA 4YXFA 2VZ8A 2YUTA 4PLWA 3TZKA 3DZFA 5AXAA 5TLSA 4NBUA 4MIOA 1QYWA 4OXYA 5FYDA 1W6UA 4N5NA 3NAQA 1SBYA 1HE3A 1VI2A 1HYHA 3KEQA 1Q1NA 1U7TA 3G79A 1HDXA 3DBLB 1A72A 2GNAA 3O9ZA 5DZSA 4MVJI 3RI3A 4YPOA 4L8VA 1I3MA 5DBIA 5C37A 4CMBA 4R1TA 3C8MA 4WJZA 4ZQHA 3IIEA 3PZBA 3OJ0A 4U6QA 3UVEA 3GZ4A 4W9NA 4XJSA 4QSMA 3JTMA 4HKTA 4P4NA 1IY8A 3UGKA 3H5NA 4CQMA 1XYGA 2IZZA 4OSPA 4AL4A 3NUGA 2GZ3A 4CM3A 3OEYA 1ZXLA 4LK3A 2VT2A 2BFPA 4BNXA 4CM8B 3DMTC 2YZ7A 3C85A 3HDJA 1I30A 5F5LA 3WGOA 4ALIA 3MJCA 1YH3A 4UAGA 4NZ9A 3TZHA 2NVWA 1J4AA 4JK3A 2WYUA 2FP4A 3RU9A 4BMSA 4XQEA 4XR9A 3UW3A 3G3EA 3DOJA 4IDBA 4E6PA 4PG8A 3LT1A 4RDHA 4CM9A 4CQLA 2C7VA 4ONEA 5T8KC 2I9PA 3H7AA 3I9JA 3O38A 4GMGA 1R0SA 3A28A 3C7DB 3D4PA 4J7UA 3UCEA 1U3TA 2FZEA 4ZHSA 2D5CA 3DZGA 5AYVA 3M1LA 2ZQZA 2EGHA 3DBRA 4D43A 1FDUA 4WKGA 1PTJA 1H6AA 4N7RA 3OSUA 3HNPA 5I9LA 4FB5A 1KERA 1MFPA 4DA9A 4KDFA 1IOLA 2IYOA 1GQ2A 1PL7A 1I3NA 3RBXA 2AEMA 3OBBA 2ZIZA 3I4CA 2HJRA 2FY8A 2VYND 2DU8A 1Z7EA 4ROSA 1SOVA 1XA0A 4AJEA 1E3EA 2DM6A 1B26A 3B1FA 1KVTA 4XDZA 1E0DA 3P2YA 3OJLA 3ZW8A 1NASA 4EJMA 4NU5A 2I6TA 3OIDA 1BG6A 2R00A 2TMGA 4MVJG 1HF3A 1Y8QB 4Z3DA 5JSFA 3HQ4O 5DOZA 1AHIA 2E37A 1QP8A 1I2CA 1RWBA 1UXHA 3D3WA 3VPGA 2PZLA 1HSOA 2DBQA 2VUSA 2HK9A 4WUVA 3UKOA 3H4VA 3D5TA 5ES3A 2P2SA 1DC6A 4HFMA 1LXCA 3TFOA 4MVJA 2B4TO 1MG5A 3PTZA 5JMPA 1NHGA 2Z95A 4JJGA 3G1TA 1X1EA 4IUYA 4BNTA 1PJCA 1ADBA 3JQAB 4A26A 1D4FA 5AOVA 4D41A 1Y8RA 3D7LA 1X15A 1YB5A 2JKVA 3D5QA 3E9QA 3IC5A 1YQXA 1U1IA 1LRLA 1E1MA 2DBVO 3JD4A 1P77A 3P7MA 5JDCC 1UZMA 4ND2A 1K0UA 3K31A 2P4QA 1OOEA 1LNQA 2CF5A 3H3FA 1EDZA 2NVUA 1RM0A 3H6KA 2IZ0A 2I3GA 5AXCA 3ICPA 5ITVA 3DHNA 3JYLA 4WGGA 1C0IA 4K28A 2GN4A 1VL0A 3U4HA 4L0QA 2HMTA 2JAHA 4ZQFA 1EQ2A 1MXFA 2W8ZA 1DO8A 3EMKA 5JS6A 1TA4A 4J91A 9LDTA 4Y6SA 4PRLA 1FDWA 4E21A 4FIZA 2PGJA 4QFCA 1F8FA 1P0FA 5I8WA 2IEBA 1GADO 1D8AA 1D1SA 1PJSA 5A3JA 4NJOA 4FQ8A 1M6WA 3ULKA 1A9YA 2X9NA 5A02A 3JQGA 1PWZA 4HY3A 4LRSB 4A0SA 5BSHA 4JBIA 5KKCA 4RLHA 1A4UA 2YQ5A 3I6QA 4RJTA 4R5HA 5JCXA 2O2SA 3H9QA 2BELA 3EUWA 3GGOA 3RJ5A 3K6JA 1I3LA 3AW9A 3FR8A 2X0JA 3LYLA 5MGBA 3KRTA 2GYYA 1HXHA 1L7EA 2JFHA 1VLLA 2E4AA 3AFNA 3DFUA 4XYBA 1XKQA 4K6FA 4MVJH 3RWBA 2X7HA 3ZHBA 1AN9A 4RGBA 5CPBA 1DIHA 4CLXA 4EJ0A 4HP8A 3JYQA 3WX0A 1FXSA 3OF2A 3PWZA 1ZSNA 1ZSVA 5L4LA 5IN4A 1BHSA 1RPNA 5GZ6A 3FI9A 1HLDA 4IIVA 4M55A 3CEAA 1U3VA 2QRKA 1NPDA 3HN2A 1N1EA 1K6JA 3E1KA 4J7XA 5G0VA 1P9LA 4LN1A 4B4VA 4PCVA 3E5MA 3I4FA 2EIHA 1O0SA 2Q1UA 4DVJA 1EBUA 1HDGO 3E03A 4E2YA 2EGGA 1TXGA 4S3MA 3B70A 1ADCA 1LSOA 4UEJA 5ER6A 3Q11A 5TT0A 1C14A 4NJMB 2Y99A 4XRRA 1LQTA 3CIFA 4XRGA 2JD2A 1EZ4A 1RKXA 3PJEA 3EY4A 5CEEA 2GR9A 5JW6A 2VUUA 3ZWNA 1YQGA 4BKRA 1Y6JA 1YDEA 1F06A 4NBVA 5HRUA 1RM5A 1NHWA 3MTGA 2EHDA 2PZKA 1A9ZA 3NEPX 2HAEA 4DIBA 4CLRB 4HFNA 3LC2O 1Y1PA 2H63A 1IHYA 3U3XA 4CV2A 1YOVA 1BXGA 3DZHA 4NDNE 4E5NA 5C7OO 4TKMA 1D3AA 3CH6A 1P3DA 2VWPA 1CF2O 3U4CA 2FR0A 2XXBA 4XGKA 4WLUA 1BSVA 4W6ZA 4EBFA 1GQQA 4EYEA 4AVYA 1MB4A 3GC6A 2VYNA 5LDGA 4WECA 4IDGA 2Y1EA 3T7CA 2PGLA 5H81A 3LT2A 3U9LA 4AJOA 3JQ8A 4PG6A 3VHRA 1IZ0A 3EZLA 2X0RA 1PSDA 4R1UA 3RROA 2WD7B 3AUAA 2PWZA 4H15A 4MKZA 3F1KA 4JX8A 2AE2A 5ENDA 4JGBA 2QZ9A 3KV3O 3JSAA 1GCUA 4L9RA 3B1JA 3PHGA 1TEHA 4BKQA 4OQYA 2CVZA 4W7IA 4FS3A 3M1AA 4IZIA 5EPOA 5A5FA 3FSRA 4ZRNA 3BTUA 1T1RA 1J0XO 3GN1A 5A06A 3VH1A 3I6IA 3IJPA 3VZQA 1EQUA 3F3SA 5A9SB 2Q45A 5F1PA 1JN0A 5ENVA 1NPYA 3WGZA 3PVZA 5DCYA 3RU7A 3MJEA 2D1YA 1H6CA 2NU9A 2W2KA 4WOKA 5CG1A 2GN9A 2Q4BA 2B36A 3LLSA 4PG4A 1HE4A 1TT5A 3VH3A 1R0KA 2CVOA 3O8QB 4IJWA 3LF1A 1ISFA 3RUCA 3GG2A 3JD3A 3JQFC 1N7GA 2D2IA 2J3HA 4WLOA 2HMVA 1I2ZA 2I66A 1PU2A 3ZNPA 3FNGA 5TIIA 1V9LA 2VHVA 3HB5X 1P1JA 5K6AC 4CR8A 1KYQA 3WQQA 3WLEA 2OXIA 1BW9A 1QYXA 3DZIA 3BTSA 3WQRA 4RZIA 4HFRA 4IJUA 4Q3CA 1T2AA 2A9FA 3C1OA 3E9NA 1IE3A 4MDHA 4WCFB 4BQRA 1M75A 3DMTA 2Y0EA 1GYRA 3FPCA 5MDHA 4RF5A 3NYWA 4ALNA 1HL3A 3SJUA 3KYDB 3RKRA 3TFQA 2GERA 4DUPA 4R9SA 3AI2A 2IODA 1GUZA 1SEVA 2EF1A 2WMDA 4BO5A 3B20A 2Z1MA 3HDYA 1H6BA 4FSHA 5TX7A 3OM9A 1HT0A 3BMCB 3NTQA 2HMUA 2QZZA 3H65A 4WOJA 3K30A 5T8KA 3F47A 2X6TA 4FFPA 3I23A 5BT9A 2ZTVA 2HMWA 3WG9A 4BNUA 2Y1GA 3L4BC 1MUUA 3PQEA 1DRWA 1P44A 2FN7A 3PLNA 3FNHA 4Q3AA 1S6YA 3Q3CA 1LDEA 3CXRA 5A04A 4FCCA 1DRUA 2O3SA 3DB2A 1DEHA 4BO7A 5JCJA 3L07A 2YHIB 3IMFA 3ZI0A 5IFLA 1CQIA 4TSKA 4AJ2A 1LDYA 1X13A 3EAGA 4QTZA 3E48A 4RORA 4EJ6A 3JD1A 4CM4A 2AEFA 1J6UA 3L6OO 2B37A 4I5EA 1ENPA 3U4IA 2UUOA 3PHIA 2QRLA 2GSDA 2QYSA 3GFGA 3FWZA 5A3VA 4DQUA 3DFZA 5KJFA 2PA3A 1PQWA 4BNKA 1QKIA 4ND3A 3V8BA 4HXYA 4CPDA 1FF9A 3ZWYA 4IQ8A 3RBZA 1W0CA 1YVEI 4OM8A 2X5OA 4A7PA 4ZICA 2C5AA 5AXDA 2ZYDA 5JYDA 1LQUA 3GPIA 3H8VA 3H9GA 3HDHA 4IDFA 4IMRA 4Z0HO 1KEPA 3DBLA 3O4RA 2IE0A 3LDHA 3E82A 4O63O 7ADHA 4CLEA 5COAA 4K26A 4B3IA 1MGOA 1DFGA 5F1KA 1H2HA 1LC3A 4W99A 3AI3A 3BYZA 5CFZA 1A71A 1EFLA 3IAHA 3IQDB 4YT5A 1KIFA 3NT5A 3RIHA 4FC7A 2XOXA 2ZCUA 4G2NA 1HYGA 4A10A 1Y7TA 5IF3A 1KVUA 3HDQA 4ZN6A 2B35A 3ORFA 3WTCA 1F12A 2O23A 4CQMD 1A4IA 2VWHA 5IDYA 3VH4A 4CV3A 3JQ6A 2ZCVA 1TLTA 2I3AA 3TJRA 4IJVA 2FPIA 4BGUA 4KQXA 5IG2A 4TRMA 3VC7A 2V6GA 1T26A 4MKRA 3HG7A 3WSVA 4XQCA 2Y66A 2CVQA 1CQJA 4AJIA 1MG0A 4E2XA 1P1RA 3LK7A 3H3JA 1FDSA 2H5LA 4E5YA 5I9NA 1KVRA 1XCBA 1UH5A 4ZA2A 5COBA 3GN2A 4UREA 2O7SA 4MPDA 4OL9A 2CF6A 1DFHA 3ON5A 4O1MA 3D4OA 4XCVA 3ZV3A 4DPLA 5JDCA 4UUMA 3MWDB 4FN4A 4BKPA 3KTDA 3D3EA 1T4BA 4RVSA 4ND4A 3MEQA 1GEGA 2PLAA 5KJCA 3RUEA 3JYPA 3WGTA 4OXNA 1M67A 4DYVA 4CLOA 3E9MA 5L9AA 1YWGO 4R16A 4ZQEA 3ENNA 4HWKA 2H9IA 5TRTA 4GI2A 4M1QA 5AQ1A 3RUFA 1YO6A 1OFGA 4DL9A 4J1QA 4PLHA 4OKNA 2OO5A 1C1DB 1CDOA 2X1HA 3EYWA 4O0LA 1T1SA 4J4HA 1UXIA 2DPHA 3RC2A 2PGDA 4DPKA 5L51A 3CSDA 1ZW1A 3DC2A 5TGDA 1KY5A 3BMOB 2BFAA 3BTOA 4DLLA 3JQ7B 4NQZA 3A4VA 3K2EA 1U7HA 1WNTA 3RFXA 1FMCA 2BGKA 2Y1FA 1DHTA 3PJGA 3F6YA 4ALMA 1DOHA 5DULA 3TSCA 1Q7GA 1YE3A 4NHEA 4WLEA 4XJTA 2R6JA 1C0LA 1LLQA 1EUCA 3TDKA 3ZWCA 3ZHXA 1N1GA 2OGUA 1U3UA 4J9UE 1RM3A 2FMUA 2OZPA 4YJFA 3WSWA 3AOGA 5G4KA 4PLVA 1E3WB 4XA8A 2VUTA 3ZV5A 1R4NB 4UUNA 4Y8VA 4DTIA 1ZK2A 1P1HA 2X8LA 1Y5MA 2WJPA 3CUKA 1E5QA 3HFGA 1ML3A 1YB4A 3ZHZA 3TF5A 2PZJA 4U6SA 1CJCA 3QHAA 4MVJD 2I5PO 2POQX 3JQAA 3H9EO 5IAAA 4Z9YA 4DRYA 4YJGB 3QRWA 4BVAA 1SOWA 1VRWA 4QO8A 1AHHA 3GDGA 1KEUA 3ASVA 1D1TA 2PFGA 1E3LA 2NQTA 4RF3A 4JP2A 1PJ3A 1VC2A 3JD0A 3F9IA 4UVEA 3DZKA 1R37A 1U4SA 5KVSA 4F45A 1ADGA 1JWAB 3FWNA 3AM5A 3DBVO 3O26A 1PIWA 1OMOA 3G49A 5L45A 5L7YA 2D59A 1CRWG 1ONOA 3AJRA 2J3KA 3GEMA 4K9DA 4J1TA 3SEFA 2VYVD 5L4NA 3CINA 2DTXA 3FNFA 5KIAA 1V35A 2P9GA 1HDZA 2IXBA 3QVOA 3HUDA 4E4YA 4I8XA 5JBIA 4HUJA 2C29D 1NVMB 4CM1A 4CUJA 2G0TA 4FFNA 4J9VA 4PN3A 3T7EA 3ZU5A 3GY0A 3QSGA 5EESA 1UZNA 4XQGA 5JYEA 1ZNQO 2B4RO 3I9NA 3ONFA 3L9WA 3JQEA 1HE2A 1IYZA 4BGIA 1EEHA 2FR1A 3W4JA 1PJQA 1MFZA 1SPXA 5JC1A 4PZEA 2E49A 4E2ZA 3BAZA 1E1KA 4DLAA 5KTKA 1NPTO 4OGWA 5COQA 3KSUA 3NT2A 5H83A 3NDIA 4BV8A 3ZU4A 2GN8A 3ZWXA 1NYTA 3CZRA 3ASUA 3KYCB 5CDGA 4Z0TA 3TNLA 1VPDA 4UVGA 1C1XB 5FI3A 3PP8A 4DC0A 4GH5A 4PIVA 1UXJA 3BMNB 3C1TA 1LI4A 1IHXA 3OIGA 3WYBA 5BSFA 1Y9AA 2WSBA 2ZB7A 3PHHA 4YQZA 2OUIA 2PH3A 4KTVE 1BTOA 2C0CA 4U7WA 2VHYA 4J90A 3ANLA 1E1NA 4LSMA 4PVDA 2JD0A 3INGA 1DIBA 4WLFA 4PZCA 4ALJA 3ZDFA 2UYYA 2DUWA 4I5GA 4OYRA 4P22A 3JQCA 3RUAA 2PD3A 3ITDA 4KWHA 5JC8A 2G5CA 4DBVO 2RH4A 3GQVA 4G5HA 4KQWA 5I7VA 6ADHA 2CDCA 4IDCA 4DQVA 2HO5A 4F3YA 4H3VA 4Q9NA 3R3SA 5EL0A 4D44A 1PGQA 1ZCJA 2Y1DA 2HMSA 2OL4A 1H6DA 1ZMOA 3EDMA 4EW6A 5IXYA 4BGEA 2G76A 3ENKA 1B14A 2Q2VA 2X86A 3CKYA 3JQFA 4R69A 2PTGA 1MX3A 1XU9A 4DMLA 1ULSA 2UAGA 3RCBA 1NWCA 2DT5A 3COSA 3ZN2A 1I01A 2PKRA 1DXYA 2DQ4A 4TMFA 3WLFA 1LA2A 2NSDA 4XYEA 5DF1A 4EUEA 4YAKA 5K6AA 3VPHA 1WXDA 2NTJA 2Q3EA 1T24A 4QFDA 3E8XA 1U28A 4FR5A 1UXGA 4FD3A 4E2WA 3B1KA 4PLTA 4WNIA 2V7PA 5A5EA 3QV1A 3ZGYA 2D3TA 2HK7A 3GF4A 4II2A 5CDTA 2EWMA 1GUFA 4N54A 4GVLA 2J3IA 1V3TA 1IULA 2QHXA 2O50A 1R16A 1HRDA 4CMHA 1P31A 4DIFA 3INTA 4G81A 4RV9A 1S7CA 1DJQA 2P91A 3UF0A 1DPGA 3CE6A 1FDTA 4CMGA 2SCUA 4OMUA 4RL6A 3WYEA 4TZKA 3V5NA 3WIDA 3WWYA 3L4BA 4MIEA 4MIYA 5B12A 2WD7A 3FHLA 3GRPA 3GT0A 4FBGA 2B69A 3OA0A 1PL8A 2DTEA 4WEOA 1WMBA 2B4QA 1LDGA 1NQ5A 4GGOA 1O8CA 3PXXA 4JCOA 2Y0CA 3ZWAA 4OIMA 1YL7A 5DBGA 3RUDA 3PK0A 4R68A 4OAQA 4Z3KA 1WAMA 2I99A 3QJ5A 4CMIB 4PLZA 5IDXA 3A06A 3IUSA 3Q2IA 2O3JA 5IN5A 1Y81A 3GDFA 3GH3A 1PZFA 4NR0A 4R54A 1R0LA 3ZW9A 1QYDA 1LDNA 3ST7A 4WCDA 3I9MA 2YDYA 3B6ZA 1T25A 4AJ4A 5B4VA 5LDHA 5U1PA 1VSVA 1WDLA 5L40A 2Q1SA 2P68A 3HFSA 4RPKA 2I65A 3KZVA 3OJEA 4E12A 4RVGA 1SB8A 3NX4A 5F3RA 3V2HA 1KVQA 1NVTA 3I9OA 4P4GA 1WZIA 2CDAA 2GD1O 4P4LA 1PZEA 4RVUA 5FI5A 1HYEA 4BNMA 2GGSA 1Y9EA 1FK8A 2QRJA 4FC6A 1A7KA 3NRCA 2EV9A 1I33A 2VYVA 3MJ4A 1QV6A 5GZ1A 3C3XA 1OC2A 4PLFA 3KYDA 3L9XA 1DRVA 2HJSA 4LMPA 7MDHA 1WZEA 1E7QA 5HS6A 2VNSA 3WJAA 2A94A 1J49A 4ALKA 4CLHA 5TT1A 4YJHA 1DLIA 3PIDA 4WNCA 4B8ZA 5KJ1A 3JD2A 1YKFA 1LUAA 2ZATA 5A9TA 4YRAA 2NTNA 3ETEA 3IUPA 4NBRA 1TB4A 3GGGA 2XXJA 4WLVA 3T4XA 3KLMX 5H82A 2OORA 2BD0A 2YHIA 1EFKA 4RLSA 4MP3A 1R4MB 4K6CA 1BXKA 3WOHA 2NWQA 4Q3NA 5DP2A 1VJ1A 4GX2A 2BH9A 5JCJD 3ZV6A 1SO8A 3R6DA 1SAYA 1GFSA 1SZJG 2X9VA 3S2EA 3UHAA 4CL8A 3UH1A 1ZH8A 4BGVA 1IZ9A 4X54A 4ZD6A 2WDZA 4PLCA 4EUHA 2C7GA 3GAFA 4IXTA 1UAGA 2A35A 3DOOA 3DTYA 4R3WA 3AU8A 2W98A 4NNJA 3RUHA 1YDWA 1K3TA 2H6EA 1B0AA 4MP6A 2AG5A 2VOJA 3QWFA 1GR0A 4N18A 5THKA 5BNIA 5JDIC 3S8MA 3QWBA 5JY6A 2V6BA 4I9NA 4RPJA 4F46A 3AFMA 3QVXA 4NK5A 4ZVVA 1NWHA 4AJJA 1XG5A 4D42A 3RASA 2CFCA 1UDBA 4NMHA 5TSDA 2EP5A 1O9BA 5JAZA 1NFFA 5BSEA 3KEOA 3I1JA 4BNLA 5CEJA 4J43A 3KO8A 1XIVA 1DJNA 4OHUA 3OP4A 4RVFA 2E48A 5K0ZA 2UUPA 3IS3A 2WEKA 1ZK3A 5G0UA 3ONDA 3N58A 2PR2A 3I52A 4Y98A 3LU1A 2GZ1A 5L7WA 1X7GA 3WNVA 2HK8A 4RPHA 2ZB4A 2FWMX 1XU7A 3LQFA 4Z6KA 1U5CA 1H9BA 4QQRA 4KOAA 4YT4A 4HBGA 4CMEC 1CETA 4F6CA 4ITUA 1JKFA 1OBFO 3W8EA 3DONA 4EGFA 1O5IA 4P38A 1Q7BA 1U2DA 4BB5A 1PJ2A 1I2BA 2BRUA 3PIIA 1SMKA 2ZKLA 3PPIA 1GQYA 4MJLA 2Y1CA 3K8ZA 3VKVA 3ABIA 4CMAA 1H5QA 4QECA 3IDSA 4GKVA 4NFYA 1ARZA 3TL2A 1VE9A 2D4AA 3JYNA 4QXMA 3GMDA 1GV1A 4YWJA 3R1IA 2VTEA 3PYMA 2CMDA 4CQLB 1LU9A 4KWIA 2OBYA 4RQTA 3PHLA 2YQ4A 5T64A 3VPXA 6LDHA 5JNLA 4I5DA 4BO1A 5TF4A 3Q2KA 3KETA 2IZ1A 3SBOA 1ONPA 4J7CA 1R15A 2FPGA 5IXSA 4BO9A 1XQ1A 1KVSA 3Q6IA 1VL6A 4U8GA 4OQZA 3GUCA 3BMOA 5KJ6A 4JQCA 3V1YA 1JTVA 2HLPA 1GDHA 3JQ7A 1PZHA 3ADPA 3VVBA 3NV9A 5B4TA 3HHPA 1PJ4A 1ZK4A 1QXSA 4BIIA 4C7KA 1YXMA 5CDUA 3SX2A 5L95A 5T57A 4FFRA 2GLXA 4E30A 2TMDA 3GA0A 1VSUA 1I0ZA 2X23A 1LDBA 3GG9A 1Z74A 4H16A 1E3WA 4I5FA 2CDBA 1Y5RA 1KBZA 3UCFA 2X4GA 3UICA 4GX1A 5JFOA 2ZJ0A 3PEFA 3HADA 1TVEA 4A03A 1ZFNA 3ZNNA 1PQUA 4EEZA 4QEDA 4AJKA 4IPTA 3SLKA 3AU9A 5JAIA 2CUKA 1WMAA 3ZWOA 1CEQA 4IDDA 2PY6A 3D3WB 3FNEA 4TKLA 4W4TA 4YJGA 4A27A 5IZ4A 2G1UA 3JQAD 4NG5A 3UUWA 4ILKA 5C3MA 3QVTA 2P9EA 4CR6A 2WWRA 1VKNA 5G0WA 4IIUA 3ZWWA 2HRZA 2AW5A 1BVUA 1YS4A 9LDBA 3NDJA 1UZLA 2C07A 3TZ6A 2BHLA 2HU2A 3AI1A 2CD9A 3CZMA 1JVBA 1EUDA 1E6UA 2Y68A 5IZCC 2HQ1A 1CWUA 5T67A 2O4UX 4RDIA 1Y8RB 1KC1A 1A5ZA 4L4SA 3RFTA 3G17A 4E13A 3PJDA 4RF2A 1I10A 3F46A 3BMQA 4YAEA 1E7WA 2EXXA 1K2WA 2CSUA 1DDOA 1I32A 4TVBA 5BNFA 3RBVA 4M86A 4DLBA 4KUEA 4O6VA 1N9GB 1E1LA 2JCVA 2WM3A 2XPCA 1GPDG 2UVDA 3KUXA 1ZBQA 3QWAA 4MP8A 2YV2A 3ROMA 4YAJA 1JQBA 3DEYX 2OFPA 3K73O 1PEDA 1ZKMA 1QSGA 2X22A 4PGFA 3RFVA 4CMKA 2X5JO 4J49A 4J3FA 3AUSA 4N5MA 3L77A 4XQ9A 2DPGA 1K5HA 3VKUA 2GPTA 3R3JA 1AXEA 5CDSA 1UAYA 2FOIA 2J5QA 4KUHA 4RPGA 1M76A 4R9RA 4TVOA 4AFNA 3WQSB 4BKUA 1QORA 3HN7A 2HRBA 5A05A 3BMNA 3EGOA 3PLRA 1O89A 5L7TA 1MA0A 3ZH2A 2Y05A 5KNLA 4JJIA 2NACA 2O3QA 5G0SA 2E6UX 1NNUA 3TOZA 3IKTA 2EEZA 2Q2QA 1YJQA 2NVBA 4DC1A 2EJWA 4CL3A 1UDCA 2X0NA 2YY7A 2C82A 5G4LA 4JLWA 1E3JA 2B5VA 2NU7A 1N5DA 2LDXA 2P9CA 1VM6A 5JO0A 2W90A 4INAA 1YBMA 3RQSA 3F4LA 4XYGA 1H9AA 4WCFC 4PLGA 4XGNA 5CDYA 1ZJYA 4CM8A 4UUOA 1ZO8A 3PQDA 1HETA 4S1VA 4IZHA 3OQ6A 3N7UA 4NK4A 4J16A 2I76A 8LDHA 3KBOA 2WTBA 4TWRA 3FF4A 2GASA 2BLLA 2YV3A 3ADOA 1EVIA 3AK4A 1AE1A 4BNGA 2DVMA 1V6AA 1L7DA 2YFQA 3BHIA 5JE8A 3M2TA 2BMAA 3GVXA 4YRBA 1R12A 3IOYA 1JKIA 4XGIA 4Y6PA 4CM7A 5GMOA 5F5NA 1SC6A 2DKNA 2YDXA 3GK3A 4HNGA 3QLJA 1JDJA 1DFIA 1G0OA 1HLPA 2QIOA 3S2IA 1XWFA 3DBHB 2FSSA 3WB9A 5HTOA 3X2FA 1N2SA 1H94A 1E6WA 3QP9A 5EQDA 3ZV4A 4EUFA 1LLDA 2D8AA 3GVPA 5JLAA 3N74A 2PH5A 2IEDA 1V8BA 2QG4A 3UXYA 4GX5A 2DUUA 1B3RA 1DAPA 1I3KA 3U62A 2ZYAA 5U9CA 2WYVA 4FGSA 1E3IA 1P0CA 4NFSA 4FOOA 3UFXA 2B0JA 3OHSX 1WLYA 4IMPA 4W7HA 5HA5A 1X7HA 3WFIA 4GBJA 3NTRA 1YL6A 2WE7A 1PX0A 4FJ2A 1PZGA 4GLLA 5A4DA 4NI5A 3ANNA 3GVHA 3D4NA 3IP3A 3WJ7A 3FN4A 1PR9A 1JU9A 4DMMA 5EERA 1SB9A 5EIOA 5GY7A 1Y8QA 3AM3A 2DC1A 2HKIA 3VH2A 3X2EA 3WGHA 5DCWA 2A4KA 4LISA 1Z45A 3JQ8B 2AHRA 3DAPA 4A2CA 4IS2A 4CMIA 3GLQA 3FPLA 2C20A 4E5KA 3LT0A 2VN8A 4C7JA 1NXQA 3DL2A 5HS4A 1NX6A 4R41A 4XIJA 3SLGA 3VZRA 4TQGA 2EERA 5I9MA 1EE2A 4BL5A 1W8DA 3DAFA 4K1LA 5JDIA 4GLOA 1T4DA 4YJDA 4B4WA 4YAIA 4YDRA 1G6KA 1HDRA 2G17A 4FFMA 4UVIA 1Z7BA 3JYOA 1DHRA 3H9UA 2EJVA 1E7MA 4LGVA 1RJWA 3LF2A 1HDCA 1CYDA 1LRKA 4I08A 5ICSA 3UAGA 1ENYA 3FD8A 4IM7A 5TS3A 4AJPA 2DBRA 3MWEB 1YL5A 3ROQA 2Q1WA 2AEJA 5THQA 3I3OA 3I83A 3A14A 3AY7A 4BS9A 1K6XA 1F8GA 3OETA 4PZDA 3BA1A 3C1AA 1XGKA 4FJ0A 4HV4A 1X0VA 3CMCO 1Z75A 1ISGA 3WR5A 2GCGA 1ZK0A 3W1VA 1ENZA 1CERA 1TT7A 2FHSA 2Q50A 4JXKA 3WWZA 3GGPA 5B37A 4CMEA 1XQ6A 1U8XX 1N92A 3DZJA 4D3SA 1BVRA 1UJMA 4JNKA 4XX0A 1KY4A 3W8DA 3O03A 4Q39A 3ZWPA 5CHEA 3HZZA 3TOXA 1ISHA 2OBNA 3LSYA 1VKOA 1GCOA 2BGLA 1ENOA 3H2SA 1ZSYA 3Q9UA 4KDEA 2GF2A 4J0EA 3S55A 1GY8A 3HB4X 4J2HA 1WDKA 3S2FA 1QLHA 1QYVA 2D0IA 1Q7CA 2Q2WA 1AXGA 2YYYA 5DP1A 3KYBA 1X0XA 2RCYA 1MV8A 3ZZNA 2NNLD 4D7AA 1P33A 4JROA 5TC4A 3ETGA 1Q0QA
chains in the Genus database with same CATH superfamily
4KITB 1Y4SA 3PLAE 1HORA 1UC4B 1WXHA 3FRHA 5JVDF 2FW7A 1JHOA 3CUWA 2I7VA 4P7GA 4N49A 1QS0B 5L3ZA 3RC1A 4BMVA 1SIWA 5FUYA 2XCRB 2YXDA 3D8BA 2QVYX 2XBLA 5K6RA 3ZXUB 3DE0X 1Z88A 2VF5X 1WXGA 4FOSA 1YIAA 3VTZA 1I4DD 1RTKA 4KAXA 1BD4A 3EXIB 3PHJA 3D6AA 3RD5A 4AG6A 2JAUA 5CT4A 1JA9A 1EK2A 2EW8A 3KB6A 5C7LO 4MAMA 3E9EA 2O2JA 5EPEA 2ORED 5JXWA 1LS6A 3FCYA 3L0YA 3ZU2A 1L9XA 2JNWA 4M49A 3I0NA 4OH1A 1FZQA 1NE7A 2QD3A 1CF9A 3GNQA 2I4IA 3QKIA 4NIMA 3SJZA 3D3QA 4O4JF 2QENA 2XTAA 1R6DA 4KGZA 3WHPA 4REQA 1BRMA 3ZGZA 1XE3A 5CAEA 2QQ5A 5E9AA 4QU9A 4L5CA 2X0FA 1YB2A 1N5IA 4BQPA 3D2AA 3NMUF 1HE1C 2G8NA 3I04A 3RAEC 3UENA 1F7VA 4BOYA 1QRRA 4Y9DA 4QICA 4ZT6A 4LF9B 3H9JA 2OZKA 1QHHA 4J94A 3KPJA 3ZKWB 4AJNA 1NATA 2QN8A 3KPYA 3L0PA 1CRPA 1KEVA 1GTMA 2AXPA 4HRYA 5SZJA 3GPCA 1XRJA 1QGZA 1IY0A 1QFYA 2J0SA 3GEGA 1MKYA 1E7RA 1DC5A 1TDJA 2CUNA 3OH8A 4WW0A 1MD9A 4AG3A 3SYLA 3H84A 1EGQA 1YA6A 1DC4A 1UCFA 4UHKA 4UXIA 4IUCS 1L5LA 4RAQA 3WB0A 4YS6A 2CXQA 5JXHA 4G5FA 2GFIA 2WUWE 3MBIA 4Q01A 1JAZA 3DTTA 1T5OA 4IIDA 1WS6A 4UE3S 1E61A 1YDFA 4CLRA 4OQMA 2A9VA 4L3OA 2ID4A 5CDHA 1SVOA 2AGVA 1T9KA 4JU9A 1K97A 1S7GA 2R2GA 2ZAMA 3B13B 3C45A 5AJXA 3U4DA 3V32A 4HAWA 1MC5A 1P74A 1Z5GA 2OQVA 3WMXA 1JDVA 3EVDA 3QX3A 3C3YA 4URHA 3I01M 5AW3A 3PG5A 2EATA 2P30A 3T1HB 1O08A 2ES4A 1ADFA 1RQ2A 1LK0A 3EPLA 4PBSA 4ZQGA 5DK6A 2DY0A 1NM5C 3LC1O 4XDHA 1MXHA 3ZJYA 3Q3HA 3W6ZA 1D6SA 1C3VA 4BC0A 1DAKA 1VI5A 2XVXA 4N40A 1OI2A 4BRWA 3ESZA 4Z4HA 4NOLA 1N5RA 1NN1A 1WA5A 5E6SB 3QTBA 2E82A 1JMKC 1C1YA 1LX6A 3WYDA 1XQWA 2OK8A 2W0MA 2HNAA 4CLDA 5CBPB 4MIKA 5DM70 2JHPA 1E2GA 4ZVOA 3LYUA 3IUJA 4CLOB 2G3YA 1WV1A 4INOA 5I7UA 2OZLA 3BXFA 3M5PA 4HNHA 4KQ1A 2DWPA 1ZXXA 3UBMA 1ZUNB 1BQEA 4M3NA 3SR4A 4DBZA 5F2EA 3OPMA 3EGXB 1WOYA 4PG5A 3FPFA 4RHYA 1ZHOA 1NP6A 3DXFA 2QXYA 2PYDA 3LKDA 4RIEA 1ZMXA 5BWLA 1Z8NA 2G8LA 2GRUA 5CD9A 4LHEA 3WGQA 4B6FA 5HDQA 4BO6A 1YGYA 3K92A 1RM4A 1EWVA 4E3ZA 4BMCA 3VPBA 3AGQA 3D1JA 1KJWA 3EK2A 4BJHB 2XHZA 1SCAA 2PGIA 3AONB 1OC4A 3BXZA 3KG2A 3LUFA 2QY9A 4X0EA 3ER6A 3LPMA 3O1HB 5LZ2A 2ISQA 1GRNA 1HYQA 2B5WA 3OFJA 4YB8A 5EKXA 4BJ6A 5JS2A 2EG9A 4X6XA 2MSEB 1LC0A 4LX8A 3CBGA 4IFBA 4U2BA 3WIUA 1U2QA 2DTDA 2RIRA 3P32A 4OSOA 1DBVO 1Z6ZA 3GR6A 4TLDA 5KINB 4EECA 1FDIA 1DAMA 1UWKA 3RLFA 1QZUA 3MRSA 1RYDA 3N7TA 1VJTA 4YDSA 5A4FS 4F1JA 3EG9A 3OWHA 1PDWA 2HT6A 3H8JA 4GS5A 4C21A 1DP4A 5AIBA 3NC1C 5KNCA 2PL3A 4BRSA 1T0IA 1XTVA 2AYYA 5I7EA 4BBPA 1QIEA 4KK3A 3L5OA 1LLFA 3QVSA 3FPGA 1YHZA 4PZ0A 3LNCA 5FAXA 2CJYA 3VPDA 2ZUTA 3HTXA 2R5FA 2RHLA 3AUFA 2H2FA 2DFTA 2KB0A 1NW6A 3H0KA 5K4HA 4EVQA 2ZAOA 4PBRA 1WV0A 4QLAA 1N3BA 2ZRQA 5JTUA 1JFTA 3SY8A 4HAIA 4WCFA 1XA4A 1RYFA 4JDUA 4Y1FA 1XELA 2GAJA 4DW8A 4Q05A 3KVNA 3ZEIA 3JS5A 3C6QA 4BUCA 4YRLA 2ODBA 4ZZ1A 1YSCA 2FWJA 1JEOA 2V59A 1ZEMA 4YP6A 3N59A 3SEZA 4ENQA 4F4HA 2ZVPX 3VJKA 4EQZA 1VE1A 1HWYA 1G8MA 1OXBB 4XQ0A 2RAFA 3DWIA 4CODB 1LLCA 3LL4A 5K0NA 4ZIRA 3DKPA 1U9CA 1J7KA 4KLCA 1NMEA 1JDBB 1CPYA 1CZKA 1EK1A 5AHWA 4COKA 4CM6A 1WDWB 4RDCA 5LFAA 5I7HA 1YFKA 3KT8A 3QXCA 1HEUA 2WIJA 1UP6A 4LY0A 5CH8A 1VL2A 2X3YA 1NQTA 4YEDA 3RYCB 3UZUA 3PUZA 3M0EA 2RAVA 3OQ1A 4QOHA 3GEDA 4XIYA 4CJXA 2VJBA 4BWYA 2R11A 1H42A 4ZZ3A 2H11A 4WN3A 2CC2A 3TNYA 4AN0A 4B6GA 1UFOA 3O9VA 2IF0A 1VE5A 4WZBA 1BOFA 5CM2Z 2BFNA 5KKNB 3L02A 4UFPA 4F56A 1C3OA 1G4AE 2WRZA 4LJ6A 3STHA 4BVKA 4RA9A 1XPJA 2AA3A 1DSSG 1F2UB 5FI1B 2Y2VA 5LR6A 5DT9A 1AKVA 1QNFA 3RS2A 3A32A 3N3AC 4K9MA 2Q5FA 2C8LA 1EWKA 2PZ8A 3UO8B 1LBEA 2QRMA 4R4JA 3PQ5A 3KM0A 4PE5B 1P73A 3UAZA 3ORQA 1WZUA 2O5RA 4Y2QA 3W6UA 4RD0A 2OXRA 3S7TA 4PZPA 1BMDA 2C96A 1K75A 4JLDA 1N2IA 1HBJA 4CTJA 5HQTA 1O94A 2WABA 3A1VA 3KJNA 1JL3A 4MUAA 1O95A 1W5BA 1M3SA 2E4YA 2ZYUX 4RTQA 3EW7A 4HVLA 2OCDA 3KYIB 4UNIA 1NAHA 5YASA 5ENZA 1GITA 3ONNA 4X65B 4CG1A 4B4OA 2R8YA 2K4MA 2NU8A 3VNVA 5LP1A 1ZNYA 2PNFA 3SVZA 4OXKA 4HLDA 1SEPA 1A9TA 3ORRA 5DNCA 1B73A 3D3KA 1XO1A 4EDFA 1GZHB 4U2FA 3TIVA 3P26A 1QPGA 1TMKA 3DEFA 4EW3A 1XHEA 3FGPA 3USCS 2DSTA 5KTRA 2H1WA 1BO6A 3VPCA 1EK5A 1M2KA 1RU3A 2Q29A 3PNPA 2NUAA 3NT4A 1Z39A 3G9QA 3PITA 3IAFA 4WY5A 4QNRA 4RELA 3W77A 4UBKA 4FD2A 4I9UA 3AESA 3L0DA 4AF8A 3JAKA 3KJHA 4EHKA 3NKLA 4X84A 3GCDA 4GOMD 3RRBA 2AOTB 1A9QA 1CRLA 3F5SA 2I8LA 2D1SA 2PKQP 2VHWA 5KTNA 4PGMA 1I7SB 4QM6A 4LHXA 4PTZA 4A8JA 2ATIA 3DMYA 1T4MA 2Z5LA 3DMFA 2YJ5A 3FBGA 4QYMA 4N5IX 5DHFA 1P6XA 4B7XA 5F23A 2OBMA 5AO9A 3RF7A 1QWSA 4P08A 2FU5C 2PLRA 3EH2A 3IVXA 3L4EA 4R51A 2ID8A 5IASA 1DOAA 1J8YF 3EC7A 4GAEA 5EAIA 1LPMA 1NQUA 1NFQA 2BKEA 5K6TA 4NAVA 4R98A 5DGCA 1BS9A 3V1NA 3V8PA 2WT4A 4DRZA 1Z2OX 1M1XB 3FLMA 3ABZA 5FWXB 1JSCA 2X8JB 5E3HA 3DBHA 4C0QC 3A1UA 2NM0A 5DTEA 5JWHA 3GCXA 3INYA 3Q3GE 3A6ZA 2G5PA 4GF5A 4QNNA 1ILEA 1NU6A 1X80A 3K0CA 5TQ0B 1P0QA 4JU8A 4AZVA 5FPHA 3TQFA 4IHJB 1W0JD 3AYZB 3C3DA 4YTEA 3FZGA 4RCVA 3RIGA 3S70A 3R8FA 3RV4A 4B34A 5K8JB 4M1YA 1NAIA 3G59A 1WUJS 2V55B 4P82A 3VU1A 3L8EA 4YRZA 3H2JA 1J9ZA 2AQIA 3F7TA 4IZOA 5AKYA 1Z2EA 1Y3DE 4P34A 3MCTA 3D4IA 3QLTA 4IUBS 1M10A 3GD5A 3JQ9C 1FQOA 4PFSA 4Y1RB 1MJNA 1VGQA 3W4IA 1CW2B 2HA7A 3A10A 5EFOA 2WFAA 3DPSA 3UXEA 1WCIA 3H13A 1N6OA 2HSZA 4A2PA 1GYQA 5AR1A 2PJDA 3KXDA 3NONA 5TQ2A 3E2MA 1W88A 4BNHA 3EQ6A 5IJAA 3HMKA 2Q49A 4ATNA 4OLHA 1OJLA 2JRCA 3D7NA 1VMIA 4QUKA 2V7QD 1WKCA 4GOND 5HQJA 3BUSA 1E5LA 1VOTA 1XXHB 2CJXA 1MO6A 4PFKA 2C04A 2FN8A 1OI7A 2VPIA 2XQGA 3EEIA 3P5SA 4ZVPA 1OUMA 1II8A 5E2AA 8AT1A 4NV1A 1RRGA 1NTOA 1WSAA 1ZD9A 2P2LA 1Z0AA 4NRDA 5FF9A 3TFWA 1JEYB 3Q9SA 2ZBQA 5F35A 5F1OA 4PZLA 4QQFA 2K2QB 4ZAWA 3GUVA 1PEKE 1H85A 5EN4A 3A6EA 3D7MA 2RGXA 3PFWO 3U37A 1OPXA 2ZPAA 1G20A 4GLBA 2EKPA 1RZUA 1WVGA 4Z0PA 2OV2A 4QOIA 4RO0A 3TLEA 1MEEA 4F3RA 3F2IA 2I78A 3LQQA 4O5OA 3WL4A 2VP2A 4D26A 2ANBA 4DR6B 2A0YA 1OAOC 1MJ5A 1JGTA 2QZPA 1E3SA 3ECCA 3R0JA 1QHNA 1ORRA 1Z08A 4KTTE 3CNOA 4EVRA 3CG0A 3OZFA 3PFNA 5DPMA 4PAWA 1QJCA 3RUIA 5KTPA 4HYEA 1DQSA 1MOSA 3BWVA 4MR7B 4PPFA 4OHXA 1N77A 3QU5A 3DWFA 3TLXA 2Y71A 4MINA 5HM8A 2HTEA 3TRIA 3MTEA 1VIYA 3VTFA 1K63A 1FUUA 4QRDA 1TA0A 4ALLA 4CDRA 2A0FA 4IVPA 4NCNA 4R9UC 4ZQBA 3L1KA 1GEEA 4B7UA 3B5JA 1UP7A 3DDSA 2FDRA 2UZ0A 4LVUA 1FFSA 5F7ZA 3T95A 4TTRA 5CGQB 4YACA 5DLYA 3JZAA 4YJ3B 2XT9A 4JJ4A 2VSYA 1BXZA 1EDBA 2I55A 2QVLA 2XODA 3MMNA 4R8VA 1DXQA 4WUTA 3VPSA 3ICWA 2J3EA 3QYJA 3C5EA 1NC3A 3GRYA 5EE1A 4CF7A 2UVPB 3U09A 1QPBA 2DLDA 2FNAA 1PTJC 4LZLA 4EEXA 3DDOA 1ZJ4A 3C3JA 1QP0A 3ZJUA 3P19A 1ZBDA 1X7ZA 3R0IA 1Z7GA 3V4PB 2E2WA 1KYXA 1Y6RA 3F8SA 1PTKA 1ZAYA 4DDKA 3K9NA 3NVKI 5ICMA 1IOVA 3TWOA 1UKYA 1YIDA 2C9ZA 2FW6A 1XA3A 3JQDA 3FR7A 1TUBB 2BCJQ 4E32A 3UJNA 4JX9A 3KYCA 4YP9A 2CL5A 2W6ID 1T2EA 4UEWA 1H8HD 3ND8A 2YRWA 4CU2A 3LUHA 3GELA 1OWPA 3TPCA 4B1FA 4EJ2A 5ELXA 3AJ9A 4TMVA 1C1XA 2C5EA 5DOVA 4JI8B 3BGSA 3O94A 4FOPA 1OX6A 3IE0A 1EVZA 1CXZA 3LVBA 4CQNA 2C92A 5HIKA 3AF4A 4AY6A 4X90A 1W59A 2O54A 3Q5DA 5ARBA 2HBYA 5CB8A 3Q9NA 4AN4A 4OHCA 1UFQA 2ZJOA 1HG0A 1SBZA 3PD7A 4ZXFA 2RC6A 1W1UA 1W1WA 1Z73A 3L43A 5JXGA 3MUFA 3B3QA 3NORA 1Z33A 2FK8A 3ENZA 3EPRA 1SCQA 5IXJA 3ZY4A 3BCUA 4MA0A 1YI0A 4V38A 2ZS8A 1PR0A 1WPQA 1JHAA 1APBA 2MSDB 5AW2A 3H11A 4OYYA 4WK0B 3PD0A 1U7XA 2LR0A 3GROA 4Y7DA 5HF9A 5EA2A 3HP7A 4EZIA 2I9KA 2CWDA 1JQKA 1X3LA 2R85A 5EIHA 1L7NA 5AM4A 1CQPA 3CUUA 1NW5A 1TCUA 4YAFA 1QZXA 3SPXA 4D46A 3DZDA 2JGRA 1GPJA 5ED0A 2JIOA 5JRZA 1HFJA 3ZD8A 1ZZEA 2ZTLA 4OL0A 2VBCA 2H2IA 1KSJA 3UMJA 3HCAA 5B36A 5HJ7A 3IJRA 1A82A 1PW7A 1HQDA 4B87A 1UAAA 4O0MA 4GI7A 2XNDA 4MJXA 2ZJ5A 5DGHA 4HATA 5LWHA 4JLNA 2O2YA 1D04A 3AUUA 4NATA 4KE9A 4BQIA 4EI2A 5T6MA 3B48A 2NPFA 4EM6A 2QTGA 4FGJA 3VYUB 4MKXA 5BUCA 2QYTA 5CCEA 2XAUA 4LDZA 3SDZA 2IOFA 5KYXB 1PX2A 3O47A 4PLPA 1XZMA 4P83A 4DLRA 3MPOA 1N6NA 2RHDA 3O73A 1PVDA 2W6JA 1WL8A 3K5PA 3T52A 3DUWA 3MOIA 1P1FA 4FN5A 4YCJA 1G7CA 1GTL1 3HY4A 5ITWA 5KCZA 2Z6AA 4Z9XA 5H80A 1ZIOA 5C8YA 4A23A 2XA2A 4O4IB 3PIRA 1RAAA 2VRCD 5FOUA 5JATA 5BQ3A 1H1TA 2F1RA 2DAPA 3F5QA 3H0EA 2FMIA 2J7PA 2HXSA 2JI8A 1DWUA 2FLVA 1TQ2A 4WESB 4I81A 1SXJC 1VJ0A 4OIFA 3GGDA 3GVIA 4JSYA 4BC1A 1IFXA 4L5JA 5HSGA 1XTQA 1G5RA 2JCYA 4X61A 1OH8A 1Y3BE 1W0KA 3PQ4A 1Z37A 3BXGA 4R2IA 4Y67A 5H68A 1WMSA 2O9JA 4DMRA 4CM9D 1KI3A 3HPQA 4EPRA 3WMRA 5CBPA 4NPCA 2ZAIA 2C4WA 1NT4A 1K4KA 5SZHB 4RKFA 1J5PA 3AEZA 2YX1A 1MVNA 5FNZA 1AGNA 1YOVB 2CLCX 1KOGA 4HH0A 2O0JA 2K7FA 2WVAA 3EGXA 2ZRLA 2PWAA 3NR2A 3U16A 4FUQA 1W85B 4FFLA 3RIXA 1NBIA 1LVHA 3N75A 4GWKA 4UNPA 5IC6A 3VDMA 1U0FA 2QB5A 1GZ5A 4NG4A 4HSGA 1PRYA 5CMLA 1X3SA 4G4GA 4JYPA 4ZO8A 1A88A 1XDBA 4TZTA 1C0PA 4HDKA 1RR6A 2D0DA 3V7WA 3KOWA 5I8ZA 5E1DA 4D25A 3I42A 1RMYA 1K3UB 2X2FA 2I4MA 3BXHA 4KCGA 1X9GA 1EGVB 3RVDA 2QBYA 1PJTA 1CS0B 2IYPA 3CR7A 4LMRA 4GXTA 5F3WB 1OFVA 3SS9X 5EJEA 3P4UA 4JXXA 1T2VA 1RKBA 3GRUA 4OMFG 2C1EA 1MB9A 5FTMA 3MQ4A 2CSXA 3IGFA 2RARA 4FT4A 2FW8A 3CNHA 1OD6A 4Y9TA 4NMMA 4NZMA 4DDTA 2H1SA 1B6GA 4FBMA 1ESDA 2GEFA 2MSKA 1B2LA 1D2NA 1PHPA 3RSHA 5G2OA 4YCAA 3EZYA 5KQGA 1J1ZA 1E9RA 1IY2A 3BZUA 2QPLA 1XF1A 3SWWA 3MOGA 1N25A 4E5PA 2YOFA 3RO7A 2O8CA 3TTSA 5AJWA 1ZU4A 4LVCA 2GEVA 1J1IA 3OEHD 3VMMA 2J0QA 4BO4A 4PO9A 4HWPA 2RH8A 1OW3B 3ZE2B 4WLNA 5AVVA 2W2KB 3KOYA 3EXHB 5CR9A 1GG9A 1L7XA 3ESBA 5E1OA 3EZ9A 4N7MA 4X3OA 5K99A 4H1WA 2Q1TA 1CU1A 2H54A 3DE4X 3A6PC 2PZMA 2PPVA 1FL9A 2C3UA 3KQSA 1LV8A 5JS1A 1TF7A 1L5MA 2ZR7A 1NLUA 3OLVA 4Y7CA 5DE3A 3KTAB 4Y9UA 3DP7A 1M66A 1OA1A 2VHZA 3NBUA 2F8LA 4LPSA 3SM9A 3TRDA 4UNNA 4URFA 3INRA 1VYTA 5TMEA 3BIOA 3RS3A 3P71T 1J1UA 4KZPA 3ZCSA 1WMEA 5LZ7A 1QO0A 3HJNA 2ACKA 2QE7D 1Q7EA 1GQFA 3HJCA 3PQ8A 4XJXA 1KYYA 2A9PA 2ADFA 2LBPA 1NMZA 1W9MA 2VSNA 2ETVA 3I0ZA 3BXPA 3S1AA 1J21A 3ZV7A 3KDSE 5E8JA 3F4BA 4A5OA 2D5IA 4ZQCB 3RYCA 1JEAA 1SUEA 3QWHA 3RC9A 4OREX 4WA7A 5AM2A 3G89A 2G88A 3LPCA 3NAMA 1R4ZA 2GCIA 4O4LB 1E6KA 4WSOA 2NUBA 4KXNA 4FKZA 2IPNA 4PC2A 3N6VA 3LZ6A 1U4OA 1XX6A 4K9KA 1GZ6A 3KFXA 4KR6A 3SMVA 1RLIA 3PC6A 1JR3E 2A7XA 4TKZA 5HIMA 1ZLYA 1P1CA 1ZESA 4B17A 3PICA 2TRSB 2Z9BA 1U0OC 3QLEA 1J22A 3H5OA 2X9GA 1UR5A 1XLTA 1JLSA 1JQLB 4FOTA 4QVGA 4AM8A 1B6SA 4AT1A 5IM4A 3MFQA 3D81A 3T1NA 5J2UF 3RVPA 2ICAA 2FSVA 2IRWA 2R44A 1RE0A 3MINB 4K2HA 2G83A 5CNMA 2ZRJA 2Z56A 4NBNA 1H2YA 3DS8A 1QQ6A 3HYRA 4GNRA 3V7NA 1OWMA 4Z99A 4JJZA 2QP3A 2PR7A 3MAGA 3RYHB 3V8RA 4LRTB 5IJ9B 2PUBA 4JXZA 5B4UA 2JD1A 5LOVF 1PJBA 1R4AA 2QJWA 3KAJA 1YCHA 2DHEA 4NH4A 1TM4E 3H2ZA 1GPYA 1FJ2A 1KEWA 3CEMA 3PDHA 2FZGA 3WIVA 5ALDA 4AYXA 4YXFA 1OKKD 3UA3A 2HSGA 1VE3A 2HJHA 5AXAA 1SBTA 4NBUA 4OXYA 1QYWA 4QPDA 4E09A 3DE5X 5FBQB 3GJ4A 5FYDA 1SBYA 4PM4A 4RANA 3ZCUA 4ERNA 3CB4A 4IAOA 1T15A 1COZA 1J25A 1Q1NA 3A11A 2NO9A 1LF0A 3DAOA 3GJ0A 3GZTB 3G2LA 3DXXA 3N53A 4MVJI 3RI3A 4B81A 2XDWA 1VSBA 1I3MA 1JDPA 2JLYA 5C37A 5KS2A 3ESCA 4R1TA 2ZVDA 5AI9A 1H5NA 5E4TA 1F2DA 3K8QA 2Z5GA 3CLHA 4WJZA 1JB9A 3OJ0A 4TT3D 3AIOA 1MGPA 4KSBA 2IQIA 1KKMA 2J9ZB 4FUTA 4P4NA 2G25A 1XTPA 1IY8A 3K70B 3H5NA 2VDNB 4C0BA 1X9HA 2QAGA 3MB8A 3TTXA 2YN4A 2VI5A 3GP5A 3I28A 4B2YA 4F5YA 3AF3A 2GZ3A 2VJCA 3QH4A 1XD8A 4CM3A 4LK3A 3O8BA 1Q0RA 4HN2A 5E8RA 4BNXA 2Z9DA 1FS5A 4CM8B 5A4AA 1W44A 3C85A 3HDJA 3WGOA 4AAYA 2YXLA 1ABBA 1HMPA 5KYYB 3O2SB 4YHHB 4G0UA 1EH5A 5FWXA 2X8JA 1OFHA 3DVSX 3RYFA 4Y9RA 1YH3A 4FNOA 4UAGA 3WMFA 4NZ9A 3IUQA 2NVWA 4QFMA 2FVXA 5I5EA 2H0AA 2WYUA 1PW5A 4JC5A 4MUXA 1M74A 3QKSB 5TQ0A 4ZOEA 3G3EA 4KN9S 1R2QA 2A9KA 4KO8A 1JG4A 4UTXA 1U8ZA 1FYFA 1DJPA 2FJ0A 2Q4TA 3IEKA 3O2NA 4S1NA 5AW8A 4MGZR 1Y7LA 2ZETA 2ACWA 4EA6A 1K5PA 4R7TA 4GYYA 1MC1A 3MSCA 4ZHSA 1I6MA 1DBRA 1LI5A 2D5CA 1N2ZA 2GLUA 3IEIA 4XDGA 2IDKA 4D43A 1Z4PX 4WXPA 4F2WA 4NXNB 2IIVA 4BUZA 4BU0A 4M7PA 5H3HA 4KXMA 3R5TA 3KLBA 2J0VA 2CK3D 3FMGA 2HWKA 1LW7A 2QAJA 1O2DA 1MFPA 4KB5A 1CP2A 2A5LA 3COVA 5KOJB 4HQLA 2IYOA 3ED5A 1FP4B 1I3NA 4V0LA 5AIAA 3TLCA 4DUGA 2AEMA 3JWHA 5JG7A 2ZIZA 4G8DA 4I19A 1UZAA 1FEZA 4UHJA 3RANA 2VYND 2ZT6A 1X1AA 1GO2A 3TQIA 3LXXA 3F9CA 1PG0A 3T15A 1KDRA 1QOZA 4XJVA 2HEIA 2HF2A 3OX4A 1XXHA 4OYLA 4D92A 4DVGA 2Z5VA 1B26A 1SC4A 1P81A 5ED4A 1VI6A 3NBMA 1E0DA 4OUDA 4EJMA 5DWDA 4NU5A 3EC2A 2ACVA 4FWBA 2HPHA 1DKNA 2TMGA 2QMHA 1JV2B 1NA5A 4BO3A 5JSFA 4RJIA 1O4WA 3T5GA 2ACEA 2WVGA 1FYVA 3ITNA 3UJHA 4DM7A 2FX5A 5LQSA 1RWBA 3RGWS 2PZLA 1HSOA 1X42A 4JUFA 5LMNB 3DFFA 3KKNA 3SZ3A 3CLKA 3VYRB 3L7AA 3UK6A 3NJRA 1DC6A 3K8OE 3EARA 1LXCA 4FYMA 4JVSB 1T1IA 2B4TO 1T5SA 4OGKA 4KH1A 3BWDD 3VGPA 1E69A 1GHTA 3PTZA 5JMPA 4IV0A 1NHGA 4DT1B 4YUVA 1ADBA 3JQAB 4QTYA 3KP1A 1D4FA 4M8IA 5AOVA 3W2HA 3FVRA 4MGKR 5H9VA 3F6BX 3N05A 1ZUIA 4DE5A 2C1ZA 4NYIQ 4IXDA 1YB5A 3E9QA 4KXWA 3ZQKA 5BMVF 1OLSA 4B80A 1YQXA 1FYDA 4MWCA 2QTZA 4I6JA 4MKHA 2GKGA 5JDCC 3P0JA 4ND2A 2V5AA 1LVUA 4YJ3A 2P4QA 1EFPB 4JB8A 1WBDA 4RD2A 3UHOA 4CKCB 1UPCA 2ZDHA 3H6KA 3PCTA 4BFTA 4ER3A 2B7BA 4XWGA 2DT8A 2QQFA 4BTLA 3T4PA 2CJFA 3LUBA 3LHFA 3C87A 3ICPA 4FOLA 1GU0A 4D9CA 1J8VA 3JYLA 4RHUA 2GN2A 4N82A 5FJJA 2C5SA 1P18A 2GN4A 2VJLA 5CDFE 1P7WA 5AKHA 5D7BA 3WNBA 3U4HA 1FLAA 5F7OA 2HMTA 1AGXA 1Z5PA 2AG1A 3I8OA 5IP5A 1EQ2A 2OVFA 2NMVA 5LYJF 1TUBA 3G0BA 3T7KA 5K45A 5ECWA 3MC1A 1ZPDA 3KQMA 1N6LA 4PRLA 3V7UA 5B3JC 3U13A 2PGJA 3FBWA 3R9WA 1P0FA 4YJ2F 3VHXA 2OXEA 3TQCA 5LYYA 5ALEA 1VRVA 2H00A 4PAGA 1QB7A 4F9TA 3LZCA 5A3JA 4FQ8A 3TBKA 3NFYA 4UJ3A 1MEJA 3RM3A 2VNIA 1W2GA 3ILVA 5A02A 4A0SA 3IT3A 2LKCA 4XIGS 5KKCA 1F0NA 2PRZA 4H3KB 2Q4RA 2QNRA 3AF5A 3I6QA 4XE5A 1IZ7A 4UM7A 2Q6KA 3WADA 2CEKA 3H9QA 3A4NA 3FYCA 3MJHA 2W6MA 4OMCA 3RJ5A 1TK9A 1MOPA 1QTNA 2OYCA 1A7UA 1XZFA 4M37A 4F8EA 3LYLA 1J7JA 1HK7A 2GYYA 2MYUA 2VQEB 1HXHA 2PMWB 1ZUWA 2RHWA 4J0IA 3TPFA 4EKYA 2JDID 4BP8A 2GXSA 1A97A 3G0CA 1I2MA 2MTBA 4MVJH 3RWBA 1HLFA 3ZHBA 3OTOB 5CPBA 4EJ0A 3OMXA 2UYHA 1ZSNA 3OOEA 5CTAA 3VV3A 1JR3A 3Q8MA 1DJLA 1RPNA 3M49A 1WHSA 1WRBA 4JYAB 1HLDA 1QG0A 3CEAA 4UMDA 1G5TA 2M6LA 1NPDA 3A37A 4IRMA 2VZLA 5FOWA 3W3ZB 2W2QA 4CKXA 1N1EA 2BFDB 1Q95A 1XZBA 3BE8A 2XGOA 2Z09A 5KYXA 3R7WA 2CCJA 2G1JA 4GP9A 1TFUA 1VMAA 2PGNA 4JBWA 4XLTA 2EIHA 1O0SA 4G4SP 1Z12A 1EA7A 4E2YA 1TXGA 4DJTA 1MORA 1UZUA 2NYVA 1UFRA 3B70A 2GARA 1QZZA 2HC9A 4AS2A 1ADCA 2MU1A 4O4IA 3AETA 3IT0A 2Y1LA 4NJMB 2Y99A 3KAQA 4GE3A 4CXMA 1ZGZA 1XEWY 1N32B 3KQKA 4J1TC 3RTGA 3W1WA 4B6JA 5BSVA 4F38A 1ZD2P 5FFNA 3PJEA 1QK3A 2JCGA 2UXCB 3R4VA 1WO8A 2XCTB 1VHQA 1YQGA 3IBYA 3R3WA 2H7CA 4XD7D 2C4TA 1YR2A 3JR7A 3F7NA 5IWCA 5G40A 2PKEA 3SOZA 4QTUB 1YDEA 4UEQA 1F06A 4DLUA 5HRUA 2NYAA 1EHCA 3N70A 2QX4A 2B82A 5JOQA 2QL6A 2PZKA 4PGHA 3NEPX 2HAEA 2E18A 3UAWA 5EEGA 7YASA 1FZTA 2CLKB 3LC2O 4KLRA 3U3XA 1YOVA 1TVCA 3DZHA 2ZJAA 4I55B 4MV4A 3OJCA 4E5NA 2GJSA 5DEOA 3CH6A 2VWPA 3L8HA 4DARA 1ZRMA 5FPYA 3FCCA 5ADVA 1AB5A 2VT7A 4KO2S 1DT5A 1W85A 1QK5A 1YASA 4AVYA 1XZDA 1YVDA 1TYAE 2Q5HA 2F67A 1UEJA 2HIAA 5LDGA 3H3XA 3ZBQA 4BVLA 3U60B 5GOTA 3T7CA 4JJEA 4B44A 2GCNA 2PGLA 1P8AA 2JGDA 5H81A 3U9LA 3JQ8A 4O2RA 1U3FA 3ZQ6A 3C3CA 4TTTS 1IZ0A 2J46A 3D2BA 1L4FA 4JP8A 3RSGA 5HM6A 4FYXA 4R1UA 3RROA 4HB3A 4A82A 4AYWA 1CS0A 2A9QA 2WSSD 3B6IA 4H15A 3WB2A 4GFDA 3F1KA 3VYSB 3RSZA 1VGVA 1RHJA 2WILA 5AW6A 2C0QA 2ZOSA 3OU2A 4JGBA 3MQFA 1X8KA 2BM1A 1P8JA 3JSAA 4UNRA 3B1JA 4OQYA 4C2AA 2CVZA 1CUWA 2II6A 1OGJA 2JEOA 2G9NA 1A98A 1T1RA 5JARA 1V4BA 5FLEX 1TEZA 2JHCA 4DMGA 1ID8A 5LXTF 1RYHA 5AK6A 1P2TA 5A06A 3DYIA 3F3SA 3TRFA 5A9SB 2IXDA 2ZSJA 5IH7A 3ZHRA 5ENVA 2GJAA 2H1HA 3I34X 4QE3A 5DCYA 1XQVA 2BMVA 3WGLA 4D8UA 4DIKA 3MJEA 3Q7RA 1H6CA 2W2KA 3EXHA 3VKHA 4BQOA 3EULA 2GN9A 3C8UA 1V16A 1XC7A 2J9FB 2CVOA 4YP7A 3O8QB 4IJWA 4D9FA 2HWWA 1ISFA 1OZGA 3H75A 2WP0A 5BYJA 2CCGA 2J3HA 2RGNC 1V8DA 1BQ4A 1PU2A 4TL8A 1PDVA 2RFLA 5TIIA 2Q8NA 2H2HA 3IQFA 2VHVA 2VSOA 2NZJA 5DNUA 5FV4A 3N8GA 4YBRA 3Q12A 1EEXB 1GCIA 1KYQA 1XVIA 3N5CA 4HXFB 4C5BA 5IVPA 1YZHA 3P9ZA 1A95A 2AB0A 3P2EA 4L8FA 4MWZA 3VKWA 1USWA 5C1PA 1VFNA 4IIBA 1H3FA 3DZIA 1FNSA 2ZJBA 2AJLI 4GOLD 4CE6A 1SXIA 2XLCA 4HFRA 2P6OA 1ESZA 1T2AA 2XQVA 3UAOA 4BQRA 3LYAA 1Z4MA 3MWGA 3LI2A 5DLEA 4M1TA 1GNLA 3V55A 3VX4A 5D3MB 4DIUA 1H8EA 3FPCA 3HVUA 5MDHA 3U44B 4JT9A 4EFKA 3U9SA 4DUGD 2A1TR 3I2HA 4O4LA 4LX0A 1HL3A 2VJMB 4DKXA 5C81A 3SJUA 3RKRA 3TFQA 3VX3A 1AA6A 2NV0A 3AI2A 4G1CA 4M53A 4Q3LA 1DUSA 1TZMA 2QXTA 2HHHB 1GG8A 5T3YA 1XI2A 2R8RA 3HDYA 5LD2B 1H6BA 4RZUA 1BQ3A 2G9VA 2I7DA 4GMDA 3DCYA 4MUJA 2WW8A 2QZZA 1WZNA 4Q7KA 4WOJA 1OBHA 4FFPA 2BI4A 2HMWA 3HEMA 3P94A 5LZ5A 2FPXA 3T12A 4BNUA 2X6RA 4JYCA 4IGKA 2FN7A 4RPCA 1RW4A 2XCOA 3PNVA 2A4MA 4V0MA 5IULC 4FCCA 1DRUA 2O0HA 1CNEA 2GBIA 4NOKA 2FX3A 2NO0A 3L07A 1Q1GA 2QM8A 2YHIB 3O4GA 4JR2A 2GPWA 3HUUA 1USVA 3G85A 3TAHA 1CR1A 5J2TF 4RORA 3V1LA 1U7PA 2OCGA 3JD1A 3MINA 2AEFA 3GFPA 3L18A 3L6OO 4N0QA 4AULA 2FVYA 3U4IA 3PGLA 3RYHA 5FUMA 2EEPA 4KV7A 1UT5A 5K51A 5IJ9A 2GSDA 5DM60 2OHFA 5KJFA 3FWZA 4K6KA 3DFZA 4LQDA 4QUAA 5AW9A 3FTDA 4BNKA 4P0PB 4CPDA 3H16A 4M36A 2WKWA 4CTOA 4IQ8A 2GAAA 2H51A 4KE8A 3D7KA 4RY0A 4NDZA 5CDFA 1YVEI 4IO0A 2FW1A 3TDNA 1JS1X 2W5UA 3OTGA 2QGNA 1JE0A 1Q1AA 2C5AA 4Q21A 1K5DA 4FKBA 5AVJA 4DNXA 5HTKA 5JYDA 3GPIA 4Z0HO 1SUDA 2BISA 4IDFA 3NNSA 1TYEB 1UKAA 2JKZA 2WT9A 3PFBA 3THWB 2COUA 1GTSA 3LDHA 3E82A 7ADHA 2AN3A 2SNIE 4ZVTA 3AFIA 3KCNA 1SK8A 5COAA 5GJCA 1D2GA 4E94A 5HOQA 1EXDA 4B3IA 2IKSA 1EM6A 2JLAA 4MWBA 1LC3A 5F1KA 3W8NA 5J4YA 3BYZA 4L6AA 1ZGJA 1D4AA 3Q7PA 2VKTA 1O97C 3KOMA 1JIIA 3UB2A 3HY3A 1KXJA 2HRRA 2OAEA 2XOXA 3NT5A 3OTQA 1GGVA 1ZP6A 3OKFA 1Y7TA 2EZUA 3W3AA 3JX9A 4AMVA 1ZN2A 4HUTA 1B0PA 4TYNA 3WTCA 3WGMA 4Y2HA 3LPLA 4LHVA 2O6LA 4CQMD 3VH4A 4CV3A 1L9KA 3JQ6A 1L2TA 4R8RA 4X85A 5HIAA 2I3AA 2J7KA 4L5BA 2QXUA 4G6ZA 4OHOA 3GA5A 1X8JA 5FXMA 2JI6A 3TD2A 4E6EA 5LNK6 1EYZA 1KA9H 1T26A 3MT8A 4X92A 1IJBA 1SUIA 2KWIA 3PV0A 4EMUA 1C3XA 2P35A 2Y66A 1G98A 3QKSA 1BCSB 5J59A 2ECPA 4Z7JA 1MG0A 2D7CA 4G5SA 1GGNA 3LK7A 3STVA 4E2XA 1PI3A 4HF7A 1KVRA 1M7GA 2IHTA 5ALUA 2IHBA 5BR1A 3NFRA 2A88A 3GN2A 4UREA 1P5FA 5COBA 1N2CB 3NLLA 4EUKA 5DTQA 1QAMA 2CF6A 1DFHA 1UK7A 2DWCA 2X41A 3ZV3A 4E4RA 2IYFA 3H6GA 1OIWA 4UUMA 2MR6A 3IQGX 4Q1BA 4MVCA 4DJJA 5JMTA 4FN4A 1BKSB 1QV9A 3KTDA 1SD1A 4O33A 4RVSA 3EJWA 1T9BA 3OAAA 4AW9A 2ATCA 2R8OA 2WLSA 3EIXA 4BZZA 1BHQ1 3OOJA 5HFNA 3G68A 2OGZA 4R16A 5KOJA 2EFCB 4NXMB 1FP4A 2H9IA 2P27A 5TRTA 5HF8A 1MX9A 3N9IA 4M1QA 2C7OA 1RJDA 1YO6A 3ZWKA 2MT9A 4M7RA 1OFGA 1X8XA 2YXBA 1PL0A 4B7AA 4DL9A 5DSZA 1A5SB 2OE2A 2OO5A 1C1DB 3H86A 3LC0A 3EYWA 4K9QA 4R1PA 2O8NA 1UXIA 2H1RA 4BFXA 2FPGB 5KDOA 2PGDA 1TAQA 2G07A 3KB1A 2CHVA 3CBQA 4IQ4A 3TLGA 1OIXA 4PSDA 3CSDA 5KMGB 1YVPA 3LZDA 2BP7B 1T3TA 3BTOA 4HUQB 4DLLA 1A9PA 3JQ7B 3K2EA 4EHAA 2XUHA 4ZVQA 1WNTA 2PMCA 3LBFA 4WRRA 1FMCA 3EX7C 4V0QA 1Z06A 2RG1A 3NHFA 3PTAA 3MTAA 3P0IA 4HZUB 3TM4A 1DOHA 3PXBA 1Y3IA 4P86A 4ALMA 3AXSA 4FHFA 4YQFA 1ICIA 2O8DB 2WU1A 4XJTA 4WLEA 4C2BA 2R6JA 4AZWA 3A4IA 4KHZA 2OGUA 3ZHXA 4IIJF 1XNQB 1XZQA 3LD9A 1MC8A 1QQ7A 2OZPA 4YJFA 3DW1X 3E0XA 4IGAA 2G9RA 5HGJA 1THMA 5G4KA 2R8PA 4PLVA 5TY0A 4AUEA 3OHMA 1ZCZA 3EXEB 5HGXA 1JSZA 3M5CA 3HVKA 4UUNA 5HKBA 5AVWA 4QU5A 4QDUA 5DB4A 3W5BA 3TQRA 2VBIA 1COWA 5BSUA 2AF3C 3HFGA 4R3UC 3TF5A 4HPWA 2PZJA 1MX5A 9MHTA 4B9AA 2GXAA 4U6SA 1U2EA 4ZCSA 4LEIA 2I5PO 5IEBA 4C78A 1JLHA 3JQAA 5EJ9A 3D0RA 4M9XA 1OCEA 4N0DA 5FQOA 2N1MA 3LLUA 1YKSA 4WVFA 2NIPA 4IH1A 1UT6A 2OLJA 1NXTA 4YJGB 1J56A 3V4SA 3BT7A 1Q21A 3MCZA 1W48A 2WA1A 3RHZA 1D1TA 3CH7A 4AMZA 2I87A 4KQEA 1OB5A 1UPFA 1J9GA 1P2BA 2FETA 3F9IA 1XT6A 1JZSA 4WK4B 4P7KA 5SZIA 1EFPA 1NGSA 2DCUA 5I7WA 3AR4A 2HM7A 2BLNA 3ET4A 3AR7A 3O26A 2WNIA 2Z1DA 3REOA 1AH2A 4WQMA 5EWLA 2IXFA 1PT8A 4ITRC 4HWTA 2D59A 1FVXA