2AE3A

Glutaryl 7-aminocephalosporanic acid acylase: mutational study of activation mechanism
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
159
structure length
159
Chain Sequence
QAPIAAYKPRSNEILWDGYGVPHIYGVDAPSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANLDAFAAGINAYAQQNPDDISPDVRQVLPVSGADVVAHAHRLMNFLYVASPGRTLGEGDPPDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaryl 7-Aminocephalosporanic Acid Acylase
publication title Insight into autoproteolytic activation from the structure of cephalosporin acylase: a protein with two proteolytic chemistries.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Hydrolase
total genus 51
structure length 159
sequence length 159
ec nomenclature ec 3.5.1.93: Glutaryl-7-aminocephalosporanic-acid acylase.
pdb deposition date 2005-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 2ae3A00
1OR0A 4WKTA 1JX9A 1E3AA 2WYDA 1GM9A 4BTHA 1K5QA 1H2GA 1AJQA 2WYBA 2AE4A 4WKVA 1JW0A 4E57A 1FXHA 1AI6A 1GM7A 2WYCA 3JTRA 3L94A 4HSTA 3SRAA 1K7DA 1GM8A 3S8RA 4E55A 3L91A 1GK1A 4YF9A 3JTQA 3K3WA 2AE3A 3ML0A 1GK9A 1K5SA 1JVZA 1FXVA 2WYEA 4HSRA 4PEMA 4YFAA 1GK0A 1GKFA 1PNMA 1AI4A 4K2GA 4K2FA 4WKUA 1AI7A 1PNLA 2AE5A 3SRCA 4M1JA 1AJNA 2ADVA 4YFBA 1AJPA 4WKSA 1PNKA 1GHDA 4PELA 4E56A 1FM2A 1AI5A 1KECA 3SRBA 1CP9A 1KEHA
chains in the Genus database with same CATH superfamily
1OR0A 4WKTA 1JX9A 1E3AA 2WYDA 1GM9A 4BTHA 1K5QA 1H2GA 1AJQA 2WYBA 2AE4A 4WKVA 1JW0A 4E57A 1FXHA 1AI6A 1GM7A 2WYCA 3FGTA 3JTRA 3L94A 4HSTA 1K7DA 1GM8A 3S8RA 3SRAA 3L91A 4E55A 1GK1A 4YF9A 3JTQA 3K3WA 2AE3A 3ML0A 1GK9A 1K5SA 1JVZA 1FXVA 2WYEA 4HSRA 4PEMA 4YFAA 4BWCA 1GK0A 1GKFA 1PNMA 1AI4A 4K2GA 4K2FA 4WKUA 1AI7A 1PNLA 2AE5A 3SRCA 4M1JA 1AJNA 2ADVA 4YFBA 1AJPA 4WKSA 1PNKA 1GHDA 4PELA 4E56A 1FM2A 3FGRA 1AI5A 1KECA 3SRBA 1CP9A 1KEHA
chains in the Genus database with same CATH topology
1OR0A 4WKTA 1JX9A 1E3AA 2WYDA 1GM9A 4BTHA 1K5QA 1H2GA 1AJQA 2WYBA 2AE4A 4WKVA 1JW0A 4E57A 1FXHA 1AI6A 1GM7A 2WYCA 3JTRA 3L94A 4HSTA 3SRAA 1K7DA 1GM8A 3S8RA 4E55A 3L91A 1GK1A 4YF9A 3JTQA 3K3WA 2AE3A 3ML0A 1GK9A 1K5SA 1JVZA 1FXVA 2WYEA 4HSRA 4PEMA 4YFAA 1GK0A 1GKFA 1PNMA 1AI4A 4K2GA 4K2FA 4WKUA 1AI7A 1PNLA 2AE5A 3SRCA 4M1JA 1AJNA 2ADVA 4YFBA 1AJPA 4WKSA 1PNKA 1GHDA 4PELA 4E56A 1FM2A 1AI5A 1KECA 3SRBA 1CP9A 1KEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OR0 A;  4WKT A;  1JX9 A;  1E3A A;  2WYD A;  1GM9 A;  4BTH A;  1K5Q A;  1H2G A;  1AJQ A;  2WYB A;  2AE4 A;  4WKV A;  1JW0 A;  4E57 A;  1FXH A;  1AI6 A;  1GM7 A;  2WYC A;  3JTR A;  3L94 A;  4HST A;  3SRA A;  1K7D A;  1GM8 A;  3S8R A;  4E55 A;  3L91 A;  1GK1 A;  4YF9 A;  3JTQ A;  3K3W A;  2AE3 A;  3ML0 A;  1GK9 A;  1K5S A;  1JVZ A;  1FXV A;  2WYE A;  4HSR A;  4PEM A;  4YFA A;  1GK0 A;  1GKF A;  1PNM A;  1AI4 A;  4K2G A;  4K2F A;  4WKU A;  1AI7 A;  1PNL A;  2AE5 A;  3SRC A;  4M1J A;  1AJN A;  2ADV A;  4YFB A;  1AJP A;  4WKS A;  1PNK A;  1GHD A;  4PEL A;  4E56 A;  1FM2 A;  1AI5 A;  1KEC A;  3SRB A;  1CP9 A;  1KEH A; 
#chains in the Genus database with same CATH topology
 1OR0 A;  4WKT A;  1JX9 A;  1E3A A;  2WYD A;  1GM9 A;  4BTH A;  1K5Q A;  1H2G A;  1AJQ A;  2WYB A;  2AE4 A;  4WKV A;  1JW0 A;  4E57 A;  1FXH A;  1AI6 A;  1GM7 A;  2WYC A;  3FGT A;  3JTR A;  3L94 A;  4HST A;  1K7D A;  1GM8 A;  3S8R A;  3SRA A;  3L91 A;  4E55 A;  1GK1 A;  4YF9 A;  3JTQ A;  3K3W A;  2AE3 A;  3ML0 A;  1GK9 A;  1K5S A;  1JVZ A;  1FXV A;  2WYE A;  4HSR A;  4PEM A;  4YFA A;  4BWC A;  1GK0 A;  1GKF A;  1PNM A;  1AI4 A;  4K2G A;  4K2F A;  4WKU A;  1AI7 A;  1PNL A;  2AE5 A;  3SRC A;  4M1J A;  1AJN A;  2ADV A;  4YFB A;  1AJP A;  4WKS A;  1PNK A;  1GHD A;  4PEL A;  4E56 A;  1FM2 A;  3FGR A;  1AI5 A;  1KEC A;  3SRB A;  1CP9 A;  1KEH A; 
#chains in the Genus database with same CATH homology
 1OR0 A;  4WKT A;  1JX9 A;  1E3A A;  2WYD A;  1GM9 A;  4BTH A;  1K5Q A;  1H2G A;  1AJQ A;  2WYB A;  2AE4 A;  4WKV A;  1JW0 A;  4E57 A;  1FXH A;  1AI6 A;  1GM7 A;  2WYC A;  3JTR A;  3L94 A;  4HST A;  3SRA A;  1K7D A;  1GM8 A;  3S8R A;  4E55 A;  3L91 A;  1GK1 A;  4YF9 A;  3JTQ A;  3K3W A;  2AE3 A;  3ML0 A;  1GK9 A;  1K5S A;  1JVZ A;  1FXV A;  2WYE A;  4HSR A;  4PEM A;  4YFA A;  1GK0 A;  1GKF A;  1PNM A;  1AI4 A;  4K2G A;  4K2F A;  4WKU A;  1AI7 A;  1PNL A;  2AE5 A;  3SRC A;  4M1J A;  1AJN A;  2ADV A;  4YFB A;  1AJP A;  4WKS A;  1PNK A;  1GHD A;  4PEL A;  4E56 A;  1FM2 A;  1AI5 A;  1KEC A;  3SRB A;  1CP9 A;  1KEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...