2AE4A

Glutaryl 7-aminocephalosporanic acid acylase: mutational study of activation mechanism
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
160
structure length
160
Chain Sequence
PQAPIAAYKPRSNEILWDGYGVPHIYGVDAPSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANLDAFAAGINAYAQQNPDDISPDVRQVLPVSGADVVAHAHRLMNFLYVASPGRTLGQGDPPDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaryl 7-Aminocephalosporanic Acid Acylase
publication title Insight into autoproteolytic activation from the structure of cephalosporin acylase: a protein with two proteolytic chemistries.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Hydrolase
total genus 53
structure length 160
sequence length 160
ec nomenclature ec 3.5.1.93: Glutaryl-7-aminocephalosporanic-acid acylase.
pdb deposition date 2005-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 2ae4A00
2AE4A 1FXHA 1JX9A 1GK0A 4YFBA 3SRBA 1JVZA 1GM9A 4PEMA 1PNMA 2WYBA 1GKFA 1KECA 3K3WA 4YF9A 1GK1A 4WKTA 4HSRA 1K5SA 1H2GA 1FM2A 2WYCA 1GHDA 4WKSA 4E57A 1K7DA 1AI6A 1JW0A 4WKVA 3JTRA 4WKUA 3JTQA 1E3AA 4BTHA 3ML0A 1PNKA 4HSTA 3L94A 4K2GA 1GK9A 2AE5A 2WYEA 2AE3A 4M1JA 3SRAA 1AJNA 1AI4A 1K5QA 1AI5A 4PELA 2WYDA 4E56A 3S8RA 4K2FA 1OR0A 1AJQA 3SRCA 2ADVA 1CP9A 1KEHA 1GM8A 4E55A 4YFAA 1PNLA 1AI7A 3L91A 1AJPA 1GM7A 1FXVA
chains in the Genus database with same CATH superfamily
2AE4A 1FXHA 1JX9A 1GK0A 4YFBA 3SRBA 1JVZA 1GM9A 4PEMA 1PNMA 2WYBA 1GKFA 1KECA 3FGTA 3K3WA 4YF9A 1GK1A 4WKTA 4HSRA 1K5SA 1H2GA 1FM2A 2WYCA 1GHDA 4WKSA 4E57A 1K7DA 1AI6A 1JW0A 4WKVA 3JTRA 4WKUA 3JTQA 1E3AA 4BTHA 3ML0A 1PNKA 4HSTA 3L94A 4K2GA 4BWCA 1GK9A 2AE5A 2WYEA 2AE3A 4M1JA 3SRAA 1AJNA 1AI4A 1K5QA 1AI5A 4PELA 2WYDA 4E56A 3S8RA 4K2FA 1OR0A 1AJQA 3SRCA 2ADVA 1CP9A 1KEHA 1GM8A 4E55A 4YFAA 1PNLA 1AI7A 3FGRA 3L91A 1AJPA 1GM7A 1FXVA
chains in the Genus database with same CATH topology
2AE4A 1FXHA 1JX9A 1GK0A 4YFBA 3SRBA 1JVZA 1GM9A 4PEMA 1PNMA 2WYBA 1GKFA 1KECA 3K3WA 4YF9A 1GK1A 4WKTA 4HSRA 1K5SA 1H2GA 1FM2A 2WYCA 1GHDA 4WKSA 4E57A 1K7DA 1AI6A 1JW0A 4WKVA 3JTRA 4WKUA 3JTQA 1E3AA 4BTHA 3ML0A 1PNKA 4HSTA 3L94A 4K2GA 1GK9A 2AE5A 2WYEA 2AE3A 4M1JA 3SRAA 1AJNA 1AI4A 1K5QA 1AI5A 4PELA 2WYDA 4E56A 3S8RA 4K2FA 1OR0A 1AJQA 3SRCA 2ADVA 1CP9A 1KEHA 1GM8A 4E55A 4YFAA 1PNLA 1AI7A 3L91A 1AJPA 1GM7A 1FXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AE4 A;  1FXH A;  1JX9 A;  1GK0 A;  4YFB A;  3SRB A;  1JVZ A;  1GM9 A;  4PEM A;  1PNM A;  2WYB A;  1GKF A;  1KEC A;  3K3W A;  4YF9 A;  1GK1 A;  4WKT A;  4HSR A;  1K5S A;  1H2G A;  1FM2 A;  2WYC A;  1GHD A;  4WKS A;  4E57 A;  1K7D A;  1AI6 A;  1JW0 A;  4WKV A;  3JTR A;  4WKU A;  3JTQ A;  1E3A A;  4BTH A;  3ML0 A;  1PNK A;  4HST A;  3L94 A;  4K2G A;  1GK9 A;  2AE5 A;  2WYE A;  2AE3 A;  4M1J A;  3SRA A;  1AJN A;  1AI4 A;  1K5Q A;  1AI5 A;  4PEL A;  2WYD A;  4E56 A;  3S8R A;  4K2F A;  1OR0 A;  1AJQ A;  3SRC A;  2ADV A;  1CP9 A;  1KEH A;  1GM8 A;  4E55 A;  4YFA A;  1PNL A;  1AI7 A;  3L91 A;  1AJP A;  1GM7 A;  1FXV A; 
#chains in the Genus database with same CATH topology
 2AE4 A;  1FXH A;  1JX9 A;  1GK0 A;  4YFB A;  3SRB A;  1JVZ A;  1GM9 A;  4PEM A;  1PNM A;  2WYB A;  1GKF A;  1KEC A;  3FGT A;  3K3W A;  4YF9 A;  1GK1 A;  4WKT A;  4HSR A;  1K5S A;  1H2G A;  1FM2 A;  2WYC A;  1GHD A;  4WKS A;  4E57 A;  1K7D A;  1AI6 A;  1JW0 A;  4WKV A;  3JTR A;  4WKU A;  3JTQ A;  1E3A A;  4BTH A;  3ML0 A;  1PNK A;  4HST A;  3L94 A;  4K2G A;  4BWC A;  1GK9 A;  2AE5 A;  2WYE A;  2AE3 A;  4M1J A;  3SRA A;  1AJN A;  1AI4 A;  1K5Q A;  1AI5 A;  4PEL A;  2WYD A;  4E56 A;  3S8R A;  4K2F A;  1OR0 A;  1AJQ A;  3SRC A;  2ADV A;  1CP9 A;  1KEH A;  1GM8 A;  4E55 A;  4YFA A;  1PNL A;  1AI7 A;  3FGR A;  3L91 A;  1AJP A;  1GM7 A;  1FXV A; 
#chains in the Genus database with same CATH homology
 2AE4 A;  1FXH A;  1JX9 A;  1GK0 A;  4YFB A;  3SRB A;  1JVZ A;  1GM9 A;  4PEM A;  1PNM A;  2WYB A;  1GKF A;  1KEC A;  3K3W A;  4YF9 A;  1GK1 A;  4WKT A;  4HSR A;  1K5S A;  1H2G A;  1FM2 A;  2WYC A;  1GHD A;  4WKS A;  4E57 A;  1K7D A;  1AI6 A;  1JW0 A;  4WKV A;  3JTR A;  4WKU A;  3JTQ A;  1E3A A;  4BTH A;  3ML0 A;  1PNK A;  4HST A;  3L94 A;  4K2G A;  1GK9 A;  2AE5 A;  2WYE A;  2AE3 A;  4M1J A;  3SRA A;  1AJN A;  1AI4 A;  1K5Q A;  1AI5 A;  4PEL A;  2WYD A;  4E56 A;  3S8R A;  4K2F A;  1OR0 A;  1AJQ A;  3SRC A;  2ADV A;  1CP9 A;  1KEH A;  1GM8 A;  4E55 A;  4YFA A;  1PNL A;  1AI7 A;  3L91 A;  1AJP A;  1GM7 A;  1FXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...