2AE5A

Glutaryl 7-aminocephalosporanic acid acylase: mutational study of activation mechanism
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
159
structure length
159
Chain Sequence
PQAPIAAYKPRSNEILWDGYGVPHIYGVDAPSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANLDAFAAGINAYAQQNPDDISPDVRQVLPVSGADVVAHAHRLMNFLYVASPGRTLGEGDPPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaryl 7-Aminocephalosporanic Acid Acylase
publication title Insight into autoproteolytic activation from the structure of cephalosporin acylase: a protein with two proteolytic chemistries.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Hydrolase
total genus 49
structure length 159
sequence length 159
ec nomenclature ec 3.5.1.93: Glutaryl-7-aminocephalosporanic-acid acylase.
pdb deposition date 2005-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 2ae5A00
4YFAA 2ADVA 3L91A 1K7DA 3ML0A 4K2FA 2WYBA 1GK9A 1AJNA 4PELA 3S8RA 1E3AA 1AI5A 1FXHA 1K5QA 1GK1A 1AJPA 3JTRA 3SRAA 4YF9A 1GM8A 1AI7A 3SRCA 1FM2A 4K2GA 1FXVA 1GK0A 4HSRA 1OR0A 4E56A 3JTQA 2WYEA 1GHDA 4WKSA 1AJQA 4BTHA 1JVZA 1KEHA 2AE4A 2AE5A 1GM9A 1AI4A 2WYDA 1CP9A 1PNKA 4WKUA 1JX9A 4E55A 4YFBA 1KECA 1PNLA 4M1JA 1GM7A 1K5SA 1PNMA 1JW0A 3K3WA 3L94A 4HSTA 3SRBA 1H2GA 4WKTA 1GKFA 2AE3A 1AI6A 4E57A 2WYCA 4WKVA 4PEMA
chains in the Genus database with same CATH superfamily
4YFAA 2ADVA 3L91A 1K7DA 3FGTA 3ML0A 4K2FA 2WYBA 1GK9A 1AJNA 4PELA 3S8RA 1E3AA 1AI5A 1FXHA 1K5QA 1GK1A 1AJPA 3JTRA 3SRAA 4YF9A 1GM8A 1AI7A 3SRCA 1FM2A 4K2GA 1FXVA 1GK0A 4HSRA 1OR0A 4E56A 3JTQA 2WYEA 1GHDA 4WKSA 1AJQA 4BTHA 1JVZA 1KEHA 2AE4A 2AE5A 1GM9A 1AI4A 2WYDA 1CP9A 1PNKA 4WKUA 1JX9A 4E55A 4YFBA 1KECA 3FGRA 1PNLA 4M1JA 1GM7A 1K5SA 1PNMA 1JW0A 3K3WA 3L94A 4HSTA 3SRBA 1H2GA 4WKTA 1GKFA 2AE3A 1AI6A 4BWCA 4E57A 2WYCA 4WKVA 4PEMA
chains in the Genus database with same CATH topology
4YFAA 2ADVA 3L91A 1K7DA 3ML0A 4K2FA 2WYBA 1GK9A 1AJNA 4PELA 3S8RA 1E3AA 1AI5A 1FXHA 1K5QA 1GK1A 1AJPA 3JTRA 3SRAA 4YF9A 1GM8A 1AI7A 3SRCA 1FM2A 4K2GA 1FXVA 1GK0A 4HSRA 1OR0A 4E56A 3JTQA 2WYEA 1GHDA 4WKSA 1AJQA 4BTHA 1JVZA 1KEHA 2AE4A 2AE5A 1GM9A 1AI4A 2WYDA 1CP9A 1PNKA 4WKUA 1JX9A 4E55A 4YFBA 1KECA 1PNLA 4M1JA 1GM7A 1K5SA 1PNMA 1JW0A 3K3WA 3L94A 4HSTA 3SRBA 1H2GA 4WKTA 1GKFA 2AE3A 1AI6A 4E57A 2WYCA 4WKVA 4PEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFA A;  2ADV A;  3L91 A;  1K7D A;  3ML0 A;  4K2F A;  2WYB A;  1GK9 A;  1AJN A;  4PEL A;  3S8R A;  1E3A A;  1AI5 A;  1FXH A;  1K5Q A;  1GK1 A;  1AJP A;  3JTR A;  3SRA A;  4YF9 A;  1GM8 A;  1AI7 A;  3SRC A;  1FM2 A;  4K2G A;  1FXV A;  1GK0 A;  4HSR A;  1OR0 A;  4E56 A;  3JTQ A;  2WYE A;  1GHD A;  4WKS A;  1AJQ A;  4BTH A;  1JVZ A;  1KEH A;  2AE4 A;  2AE5 A;  1GM9 A;  1AI4 A;  2WYD A;  1CP9 A;  1PNK A;  4WKU A;  1JX9 A;  4E55 A;  4YFB A;  1KEC A;  1PNL A;  4M1J A;  1GM7 A;  1K5S A;  1PNM A;  1JW0 A;  3K3W A;  3L94 A;  4HST A;  3SRB A;  1H2G A;  4WKT A;  1GKF A;  2AE3 A;  1AI6 A;  4E57 A;  2WYC A;  4WKV A;  4PEM A; 
#chains in the Genus database with same CATH topology
 4YFA A;  2ADV A;  3L91 A;  1K7D A;  3FGT A;  3ML0 A;  4K2F A;  2WYB A;  1GK9 A;  1AJN A;  4PEL A;  3S8R A;  1E3A A;  1AI5 A;  1FXH A;  1K5Q A;  1GK1 A;  1AJP A;  3JTR A;  3SRA A;  4YF9 A;  1GM8 A;  1AI7 A;  3SRC A;  1FM2 A;  4K2G A;  1FXV A;  1GK0 A;  4HSR A;  1OR0 A;  4E56 A;  3JTQ A;  2WYE A;  1GHD A;  4WKS A;  1AJQ A;  4BTH A;  1JVZ A;  1KEH A;  2AE4 A;  2AE5 A;  1GM9 A;  1AI4 A;  2WYD A;  1CP9 A;  1PNK A;  4WKU A;  1JX9 A;  4E55 A;  4YFB A;  1KEC A;  3FGR A;  1PNL A;  4M1J A;  1GM7 A;  1K5S A;  1PNM A;  1JW0 A;  3K3W A;  3L94 A;  4HST A;  3SRB A;  1H2G A;  4WKT A;  1GKF A;  2AE3 A;  1AI6 A;  4BWC A;  4E57 A;  2WYC A;  4WKV A;  4PEM A; 
#chains in the Genus database with same CATH homology
 4YFA A;  2ADV A;  3L91 A;  1K7D A;  3ML0 A;  4K2F A;  2WYB A;  1GK9 A;  1AJN A;  4PEL A;  3S8R A;  1E3A A;  1AI5 A;  1FXH A;  1K5Q A;  1GK1 A;  1AJP A;  3JTR A;  3SRA A;  4YF9 A;  1GM8 A;  1AI7 A;  3SRC A;  1FM2 A;  4K2G A;  1FXV A;  1GK0 A;  4HSR A;  1OR0 A;  4E56 A;  3JTQ A;  2WYE A;  1GHD A;  4WKS A;  1AJQ A;  4BTH A;  1JVZ A;  1KEH A;  2AE4 A;  2AE5 A;  1GM9 A;  1AI4 A;  2WYD A;  1CP9 A;  1PNK A;  4WKU A;  1JX9 A;  4E55 A;  4YFB A;  1KEC A;  1PNL A;  4M1J A;  1GM7 A;  1K5S A;  1PNM A;  1JW0 A;  3K3W A;  3L94 A;  4HST A;  3SRB A;  1H2G A;  4WKT A;  1GKF A;  2AE3 A;  1AI6 A;  4E57 A;  2WYC A;  4WKV A;  4PEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...