2AE9A

Solution structure of the theta subunit of dna polymerase iii from e. coli
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
76
structure length
76
Chain Sequence
MLKNLAKLDQTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHRLASVNLSRLPYEPKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase III, theta subunit
publication title Nuclear Magnetic Resonance Solution Structure of the Escherichia coli DNA Polymerase III {theta} Subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 24
structure length 76
sequence length 76
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06440 DNA_pol3_theta DNA polymerase III, theta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.250 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 DNA polymerase III-theta 2ae9A00
2IDOB 2AXDS 1DU2A 2XY8B 1SE7A 2AE9A
chains in the Genus database with same CATH superfamily
4GYSA 5KX5E 4QXHB 5JDFA 2VKJA 5LOVE 2I6HA 5J1GA 4UVCB 2X0LB 4HWDA 2VL8A 3UUMA 4YT0A 5BMVE 2EHOB 2VASA 1UX4A 4UV8B 4QX8B 1O3XA 5FKYA 3X1DA 2QYWA 4PJMA 2CHNA 2V5CA 5EK4A 3AE6A 4LMLA 1SUMB 4WBNE 2JPFA 3SFEA 2BS4A 2LM2A 3WAKA 2E9XC 2X66A 4JI4T 1R8IA 5AQLB 2DCFA 5HAXA 2Q9QB 2LKHA 3ZCJA 4QKNA 3R6NA 3CX6B 4P0AA 5J2TE 2BG9A 1J1JA 2XAJB 3PUQA 4CXWA 2IUBA 3QK6A 1OXZA 2J1DG 2VWAA 4M1PA 3NBXX 2XM2A 3HKDE 4MFRA 3MACA 5HYAA 2IIUA 3E22E 4LF8T 4TN7B 5C2TA 2CE7A 2X9XA 3PU8A 4O2AE 2D5UA 2YEVC 4U72A 2Y48B 3LG7A 2E5LT 4HWIB 2NP9A 3FB2A 1IJ5A 2BDEA 4NIQA 3HA4A 2XAGB 3CIRA 3KVAA 3H3AA 1OWAA 2QVAA 1W9RA 2CXDA 4ILBA 1D0ZA 3AE7A 4C91A 3RH3A 1KNRA 2BBJA 2ODUA 2BKOA 3AA6B 3NRYA 1ZV4X 2WM9A 2UXXB 1OEDE 4I50E 4U2YA 3I0QA 2CMRA 1E1HB 4HFEA 5LA6E 4AKIA 1LVFA 1WRDA 4AXPA 4YTMA 3KV9A 3FHNA 4L5GA 5HEJA 4JEUB 2YU1A 3JAFA 2PTFA 3ANWA 5KXJA 2YK0A 4UVBB 4YSZA 3ZPOA 2UUAT 1U5PA 1I6ZA 2F4VT 5LBMA 4MBQA 4QWNB 2ACZA 5EK2A 4CN6A 2YKSA 3VRAA 2XQYA 4U31A 3JADA 4JI8T 3ZT5A 3AECA 1ZOYA 4DR7T 2CBJA 3ZSTA 1SA0E 4UF0A 2W4XA 2LKGA 3EABA 2WWUA 4CQIA 2P9BA 5CJ5A 3AA0B 3NZPA 4EAHA 2HPLA 4QXCB 2H7VC 4MLKA 4EB6E 4LMJA 4DV5T 4K0UA 1HNXT 4HFIA 2DWGA 3TLSA 2LE8A 2SPCA 3PE0A 1M62A 3UUNA 2N1GA 3H3MA 1D1BA 4A98A 3PUWF 2DHRA 3LFMA 5LBQB 3RIUC 5AQOB 5FY7A 2KLQA 1KNZA 4HWCA 2A72A 2LM9A 3NZQA 4IDQA 4NPPA 5JREA 2W63A 5HCJA 2D2SA 4V1Av 1HF8A 3AAIA 3NVOA 2BS2A 2H3RA 2LSIA 4LF9T 5JH7E 4KP3C 3P4WA 5JTGA 3UUXB 1HS7A 1LKXA 2X0YA 1UCUA 3WI3A 2W61A 1T98A 1FJGT 3MXZA 3O9XA 4Q25A 4MALA 2W67A 3KINB 2RPAA 3UFGA 4YY3T 3C4ZA 2E9XD 5ETWA 4DR1T 3EVYA 2XAQB 3EDUA 4EOZB 2EHOA 1N36T 4AKGA 2X9WA 5KMGP 5HXEA 4QX7B 3LDQB 1AJ3A 4TV8E 5ABFB 5AQFB 3PURA 2B1EA 1ZEEA 3CX7B 3EUHA 3AA7B 1MMAA 2BBHA 4PFPA 4ASKA 1MMGA 3SOLA 2FBWA 2LOSA 3O4XE 4HTEA 2BG9C 5TAOA 3CX8B 2VVNA 3TLUA 1VRBA 3ZN0B 1HX1B 4NUVA 1IAPA 4DMVA 4L9IA 4ZI7E 3BQLA 1SE7A 3A8YC 2NTYA 5ABEA 4UIGA 2D0UA 3TLTA 5HXRA 3EI0A 4IDZA 4GIWA 3K3NA 4Z91A 2V6YB 5L2LA 2OV9A 4DNDA 5LGUB 5LMNT 2FJEA 3N2KE 4YHJA 3T1YT 2ZLYA 4O4LE 5BR8T 4GK0E 2YINA 1ZKEA 2Y6XA 2XAHB 2YU2A 2WAUA 4X1YE 3NWIA 4AI6A 3HKBE 3RGLA 1T7SA 4TZ4C 3AEFA 5A1LA 4K0KT 4H9OC 4L0RA 5AQIB 4H9PC 3CMLA 5HXHA 4X65T 2J62A 3C51A 1QSDA 2V1DB 4Z90A 3KVBA 5E0OA 3N9MA 2J4GA 4DR2T 4U7YA 4X62T 5AQMB 3ZMTB 4DVDA 3RYIE 4B3ST 4EYUA 3CK6A 4P1NA 2CRBA 1WR6A 2K48A 3AB3B 3ZYLA 1HX8A 3Q9DA 4JI1T 5JDGA 1Y64B 1KF6A 2XQ6A 4MHCA 5L3GB 1Z8UA 3UU5A 1GQEA 3KBUA 2CXFA 4DIDB 2OA5A 3AE2A 4CZZB 4AQYT 5FL1A 2W00A 4AKHA 2I0MA 1KNPA 2V7MA 4DR4T 1YKHB 5LXTE 3MZKB 4OK0A 5AQHB 2CCQA 5LG4A 4P09A 5HWXA 4ZI3C 3FZFB 4IE4A 2BKPA 4PAGA 3RI5A 5ABHA 1T8BA 2MTQA 2IC9A 5FNVE 4HKAA 3OBVE 3O1IA 3CQGB 4KI0F 1L0VA 3BK9A 4F6RC 1J5ET 2IAKA 2WS3A 1D0XA 4CN1A 4NUUA 3Q5DA 1D1AA 1B7TA 3ETUA 2VURA 5FVKA 1YQ3A 3FZLB 3ZMSB 3ZN1B 4JBWF 5HEGA 1Y01A 2B76A 5J0ZA 2LSKA 4H63V 1YW0A 3L39A 3OKQA 4IE0A 1US7B 5LHIB 3AAEB 1S94A 2ODVA 2JIWA 3I9YA 3M65A 4UEMA 2M6IA 3CQCB 3JC6D 4EGWA 2XSBA 4PW8A 2DL1A 3ZSSA 1UURA 2QRXA 2GK9A 2V7IA 4COFA 4DBRA 4EEBA 5IHYA 4O2BE 1CUNA 2EHOC 4DUYT 5JDNA 4CI3B 3OTOT 5LHGB 2W66A 1W0AA 2XUEA 4H9NC 2NWBA 4JI6T 5L47A 4ZEYA 4JYAT 1NWMX 2JMHA 4P0BA 3H37A 5ABFA 2WZHA 4IDPA 4IREA 5F8PA 4ISSA 4YSYA 2VKDA 2KT9A 4ZOLE 2Q9QC 4FI5A 3RKOA 5DABA 4QH4A 4BJMA 2DNXA 4JLEA 3PUYF 3A7MA 3RC8A 5HWYA 2NW9A 3MKDA 1WCRA 2XAFB 3SFDA 5C3JA 3RYCE 1UGOA 2VK9A 2XSAA 3KV4A 2WDRA 1S35A 4DO0A 4EZHA 2XQ8A 4O4HE 5HXCA 2XPKA 4AISA 3RIFA 2V7JA 2MBGA 2YDRA 4YTNA 3I9WA 2CLYB 3CVRA 2V6YA 2WCAA 5FY1A 3F31A 4LMKA 2WDVA 4GK5E 4A5XA 2UU9T 5AQVB 3ABVA 4JV5T 1XDPA 2FJAA 2LHRA 3VR9A 2BZBA 3WAJA 2WZIA 1HTJF 3ONJA 5L3FB 2LSGA 1FEWA 5HEHA 4U2ZA 4IE7A 3KBTA 3ZJ2A 1UUSA 2W0GA 1T72A 2ZMAA 4E7ZA 3SWHA 3BQIA 5LGNB 4YFSA 3RHWA 4HN9A 3U3IA 3QNUA 1MMNA 3A5XA 3G06A 1HG2A 2WWVA 3N5LA 3RRWA 3KV5A 3CPZA 5HEOA 2WBLA 3B13A 5LG3A 5J2UE 5L3BB 5JR9B 4PFOA 3OYXA 4YHHT 1D0YA 4BA9A 2LHNA 4KX6A 4EV6A 2A3DA 3FZHB 1J5WA 5FXWA 4NXMT 2PG8A 4YJ3E 4QH1A 2CM0A 4EEDA 5F5WA 4IL9A 1G73A 1UX5A 3C50A 4PK4A 2DWKA 2DLRA 2PBIA 5DQVA 2VKHA 2XQAA 4ISTA 3U78A 1OEDB 2CWOA 2CBIA 2LJLA 2J47A 2BVLA 2AXDS 3AA1B 5CGMA 1D1CA 1YXRA 2M6BA 2D9DA 3DTOA 2LLYA 3P4SA 2K3WA 2MPKA 3VKHA 4IE5A 4ZS2A 5FY0A 4EYYR 3BQKA 4QXBB 3T8OA 3TKLB 3PUGA 5L4HA 2OLTA 3N2OA 3AAAB 2N9DA 5HEUA 1QUUA 3N9PA 4CN4A 4ILUA 3EHZA 2BKNA 2C5KT 4YSXA 1YKEB 5IYZE 5AFUL 4ADZA 3VU7H 5AQSB 1V9DA 3PTRB 4TWHA 4HFHA 5AQPB 2G0UA 2E2AA 5JQGE 1MIVA 5HXSA 1KFYA 4X1KE 3IA3A 3AEAA 4IIJE 1IJ6A 5AQNB 1XNRT 2JQ9A 2XQ9A 5AQRB 4GOUA 4AKRB 2HN2A 2Q9QD 2XQ7A 5AQJB 3ZMVB 3V5SA 5AQGB 3KV6A 2LRKA 3AEGA 4O4IE 4DV7T 1KEYA 4DV1T 4EZ4A 2PJQA 3GN5B 3PUVF 2NOXA 2FUPA 5CA0E 4I4TE 2VQFT 1IZNB 3IBPA 3O1JA 1N32T 3AEBA 3AE1A 3PJAJ 3P4RA 4AQGA 3EDVA 2HPJA 3QOFA 5FXVA 2BS3A 2X9YA 3PUXF 3L09A 4O8SA 4ANJA 4XZCA 1NENA 5LYJE 5JRCB 1LRZA 3UU3A 4UXNB 3SRZA 1FMWA 2LOPA 5AQKB 3ZCIA 3AE5A 3KFWX 4TX5A 4HWFA 5AQTB 5DQWA 3RX6A 4LFCT 2RP4A 1ZP0A 3OPCA 2NW7A 1MNDA 4PK6A 2V7KA 4QH5A 3P50A 3J9X1 1VCTA 1BR1A 2KINB 2L9QA 2WU5A 4JI2T 4OFZA 4UR9A 4U7IA 5FMNA 3UULA 2H7OA 4ZI2C 3ONXA 2L8KA 1XDOA 3PV0F 3RPUA 3AEEA 4PJLA 4IT4A 3N2GE 3PUAA 1VCSA 3ZLIA 3PUZF 3E0ZA 4HFVA 1MIYA 2UXBT 4G63A 4KMCA 3JCFA 3QC9A 4ZZBA 2YN6A 1NAFA 2UXNB 2X68A 5LMUT 4WNKA 1H7CA 2LSJA 3RLFF 1WR0A 2LEHA 1KK7A 4AQFA 3UQ4A 4YTPA 3LJCA 3QUJA 3L8RA 4LFBT 4PK5A 4HGAA 4JI3T 3FXDB 4OYKA 2E9XB 3QB5K 4KHPT 5LGTB 3VHLA 3VR8A 5JR9A 3T1HT 5F3JA 4H9QC 4G2AA 3I1AA 4IDOA 2KWHA 3P8CD 4IGUA 4NXNT 2E8IA 2NR4A 3LBXB 3R84B 5LJNA 5IUXA 2XASB 4ILCA 2W2UA 2ZM0A 4IDNA 3OYZA 1X9BA 3PUSA 3VKGA 2V5DA 4IE6A 3N9LA 3Q2MA 4JI7T 2E5VA 2FJBA 3HL6A 1XWMA 4H9RC 4U3CA 4DBQA 3RYFE 3VRBA 1WYBA 2KWIB 3Q5XA 4HEAA 1OEDA 2WP9A 5H6RB 3K8PC 5JDHA 2VKOA 5LNKA 3NKZA 3N9NA 3ZEFB 3S4UA 2RA1A 5FXZA 3ZMUB 3ZT6A 2XTLA 1XNQT 2ZM8A 2X0HA 2M67A 1JNRA 3P7IA 2X51A 4TWFA 5CB4E 4B3RT 4H9SE 1CHUA 5L4EA 1FIOA 4LF7T 4KBMB 3MK7C 3Q5WA 1HNZT 4X66T 1HFAA 3LK3B 3IHRA 2VB6A 3K1SA 3C4XA 5LHHB 4AIUA 3SS1A 1HNWT 3ZKRA 2W62A 1WFDA 4WBOA 4CXXA 4YJ2E 4TWDA 2XZEA 3M3ZB 3RKGA 3L3PA 2LT3A 4I43B 2QGSA 3F57A 2YDQA 2CEAA 3UQ7A 3PJAA 4IHJE 4WW0A 3CWZB 4XAXB 3ESLA 4UV9B 3EAMA 4GKKT 3V5UA 2A2FX 1W0BA 3C64A 4TNWA 4LF6T 2JQQA 3RYHE 3RIAA 2FJDA 2IC6A 3O1HA 2BG9E 4LF4T 5FP3A 2XQ3A 5DJQC 2R6GF 2KSRA 4BAYB 2QA7A 2IDOB 2X9HA 3IF8B 1WYCA 4KUMB 2JRKA 4DR3T 4DR6T 4A97A 2LSYA 2JQKA 1I94T 3AEDA 3GN5A 4N78D 4U33A 4ZXLA 4DV4T 2UUCT 4X1IE 4B3TT 1HR0T 4LF5T 3ONLC 1HG5A 3AXJB 5JVDE 2IHR1 2MOZA 4U74A 4LFAT 5C8YE 3W15B 1UK5A 4GYRA 3GWHA 1EZ3A 3C98B 4DV2T 5JRCA 3RRCA 1JNZA 4ZI2D 4KHZF 2CLYC 4IL4A 5EZYE 3ZJ1A 3FZMB 3UU4A 5LJMA 2UUBT 1BR0A 3IEEA 4YXDA 4JI0T 3AE9A 3ZMZB 4BJNA 4XBFB 2Z6EA 4ZI3D 1N33T 3JAEA 2AE9A 3N9OA 3F2EA 3ZC0A 5H6QB 5KDMC 2CPTA 1MIWA 4OHFA 3AE3A 3GA8A 5FVLA 1Z0PA 2NTXA 3RF1A 5JDQA 3AE4A 1XMQT 4F8HA 3HR0A 2YOEA 2N2NA 4HFDA 4JI5T 2WB5A 3NRXA 4HWHA 2PFVA 3PDYA 5JDMA 3KDSE 4AQFC 5LB7B 3CKDA 4DMWA 5AQQB 4I55E 3OVUA 2KNDA 4DR5T 3FZKB 3DP7A 2K24A 3K3OA 2WQYA 5JR9C 3QB5A 4C90A 4GKJT 1IBLT 2WY2A 2V26A 3HKCE 2IW5B 1IBMT 4HE8A 4DV3T 5FXXA 2K9AA 2BG9B 2E9XA 3RQUA 3OJAA 2K5BB 2V7LA 3ETVA 2HHHT 2A9UA 3ZC1A 1BR2A 3MJXA 2V8SV 4ZS3A 1MNEA 2XQ5A 3LBXA 2C0SA 3AVRA 2UXDT 2EHOD 4HFCA 3UTKA 4E7SA 2KMFA 3FBLA 3J7Yq 3JC6C 2DI4A 2I59A 3ZYKA 3HKEE 2LRLA 2BVMA 1OEDC 4PNIA 3RQWA 3LK2B 3TLWA 4TNVA 1G8XA 3UT5E 3CQXC 3ZT7A 4JUYA 3LK42 4FJOA 5ADXL 4ZHQE 4Z8XA 2V6XA 2XM1A 5L3DB 2UXCT 1XZYA 4B6XA 2H89A 4EXTA 5CFBA 1MMDA 2CWYA 4UELA 2JJ9A 2YDSA 2CHOA 3ZYMA 2Q9QA 4EIWA 2MYSA 3UU6A 1ZHCA 4DV6T 2VQET 2HH7A 4X64T 2ZM2A 4X5TA 4ILAA 1LVKA 3ANWB 4CXYA 2XJ7A 1U4QA 2H88A 1E7PA 3P4QA 4I0UA 4OYJA 2Y8DA 3UUBA 1SHZC 2X67A 3MA9A 1YQ4A 4TV9E 2ZM6T 1NEKA 5LP6E 3UU8A 2C5JA 2L3LA 4AKLA 1YD8G 2HN1A 2WSSV 1WLXA 4QHOA 5IWAT 4CI2B 4DV0T 5JDLA 2ACXA 3AVSA 3I0OA 4UF0B 2JMKA 2KXPB 4B3MT 3B57A 1X79A 5GONE 3K3QC 3HI2A 5LCYA 5M4YA 1HCIA 2WMNA 3RC3A 1W09A 4PJJA 4OX9T 2XHEB 5EK3A 5AQUB 2D0TA 5ABGA 1FMVA 4HFBA 3FXEB 3UFEA 3D0TA 4ERRA 4DUZT 5L3EB 4PJNA 4J2CA 1DU2A 2XY8B 2KZ7B 3FBZA 5CA1E 4JEHB 4H63H 2CXLA 3B5MA 3PU3A 3AXJA 2MAWA 4A56A 1QLBA 4WZXA 3P4PA 3TLVA 5FYMA 4CI1B 3RIUA 4ZZCA 4X20E 3N9QA 2JQHA 5L3CB 1M7KA 4YLHA 1IBKT 4TUYE 3E08A 3C4WA 3LSVA 3Q5EA 2CA5A 3DJBA 2VVSA 1N34T 2C5IT 2XQ4A 4WYVA 1VOMA 2VL0A 4O4JE 2NW8A 1XMOT 5HCMA 2WMOA 2ES0A 2IMLA 5FL0A 3AE8A 1BR4A 2WDQA 1E2AA 2WU2A 4UVAB 3GMIA
chains in the Genus database with same CATH topology
2IDOB 2AXDS 1DU2A 2XY8B 1SE7A 2AE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IDO B;  2AXD S;  1DU2 A;  2XY8 B;  1SE7 A;  2AE9 A; 
#chains in the Genus database with same CATH topology
 4GYS A;  5KX5 E;  4QXH B;  5JDF A;  2VKJ A;  5LOV E;  2I6H A;  5J1G A;  4UVC B;  2X0L B;  4HWD A;  2VL8 A;  3UUM A;  4YT0 A;  5BMV E;  2EHO B;  2VAS A;  1UX4 A;  4UV8 B;  4QX8 B;  1O3X A;  5FKY A;  3X1D A;  2QYW A;  4PJM A;  2CHN A;  2V5C A;  5EK4 A;  3AE6 A;  4LML A;  1SUM B;  4WBN E;  2JPF A;  3SFE A;  2BS4 A;  2LM2 A;  3WAK A;  2E9X C;  2X66 A;  4JI4 T;  1R8I A;  5AQL B;  2DCF A;  5HAX A;  2Q9Q B;  2LKH A;  3ZCJ A;  4QKN A;  3R6N A;  3CX6 B;  4P0A A;  5J2T E;  2BG9 A;  1J1J A;  2XAJ B;  3PUQ A;  4CXW A;  2IUB A;  3QK6 A;  1OXZ A;  2J1D G;  2VWA A;  4M1P A;  3NBX X;  2XM2 A;  3HKD E;  4MFR A;  3MAC A;  5HYA A;  2IIU A;  3E22 E;  4LF8 T;  4TN7 B;  5C2T A;  2CE7 A;  2X9X A;  3PU8 A;  4O2A E;  2D5U A;  2YEV C;  4U72 A;  2Y48 B;  3LG7 A;  2E5L T;  4HWI B;  2NP9 A;  3FB2 A;  1IJ5 A;  2BDE A;  4NIQ A;  3HA4 A;  2XAG B;  3CIR A;  3KVA A;  3H3A A;  1OWA A;  2QVA A;  1W9R A;  2CXD A;  4ILB A;  1D0Z A;  3AE7 A;  4C91 A;  3RH3 A;  1KNR A;  2BBJ A;  2ODU A;  2BKO A;  3AA6 B;  3NRY A;  1ZV4 X;  2WM9 A;  2UXX B;  1OED E;  4I50 E;  4U2Y A;  3I0Q A;  2CMR A;  1E1H B;  4HFE A;  5LA6 E;  4AKI A;  1LVF A;  1WRD A;  4AXP A;  4YTM A;  3KV9 A;  3FHN A;  4L5G A;  5HEJ A;  4JEU B;  2YU1 A;  3JAF A;  2PTF A;  3ANW A;  5KXJ A;  2YK0 A;  4UVB B;  4YSZ A;  3ZPO A;  2UUA T;  1U5P A;  1I6Z A;  2F4V T;  5LBM A;  4MBQ A;  4QWN B;  2ACZ A;  5EK2 A;  4CN6 A;  2YKS A;  3VRA A;  2XQY A;  4U31 A;  3JAD A;  4JI8 T;  3ZT5 A;  3AEC A;  1ZOY A;  4DR7 T;  2CBJ A;  3ZST A;  1SA0 E;  4UF0 A;  2W4X A;  2LKG A;  3EAB A;  2WWU A;  4CQI A;  2P9B A;  5CJ5 A;  3AA0 B;  3NZP A;  4EAH A;  2HPL A;  4QXC B;  2H7V C;  4MLK A;  4EB6 E;  4LMJ A;  4DV5 T;  4K0U A;  1HNX T;  4HFI A;  2DWG A;  3TLS A;  2LE8 A;  2SPC A;  3PE0 A;  1M62 A;  3UUN A;  2N1G A;  3H3M A;  1D1B A;  4A98 A;  3PUW F;  2DHR A;  3LFM A;  5LBQ B;  3RIU C;  5AQO B;  5FY7 A;  2KLQ A;  1KNZ A;  4HWC A;  2A72 A;  2LM9 A;  3NZQ A;  4IDQ A;  4NPP A;  5JRE A;  2W63 A;  5HCJ A;  2D2S A;  4V1A v;  1HF8 A;  3AAI A;  3NVO A;  2BS2 A;  2H3R A;  2LSI A;  4LF9 T;  5JH7 E;  4KP3 C;  3P4W A;  5JTG A;  3UUX B;  1HS7 A;  1LKX A;  2X0Y A;  1UCU A;  3WI3 A;  2W61 A;  1T98 A;  1FJG T;  3MXZ A;  3O9X A;  4Q25 A;  4MAL A;  2W67 A;  3KIN B;  2RPA A;  3UFG A;  4YY3 T;  3C4Z A;  2E9X D;  5ETW A;  4DR1 T;  3EVY A;  2XAQ B;  3EDU A;  4EOZ B;  2EHO A;  1N36 T;  4AKG A;  2X9W A;  5KMG P;  5HXE A;  4QX7 B;  3LDQ B;  1AJ3 A;  4TV8 E;  5ABF B;  5AQF B;  3PUR A;  2B1E A;  1ZEE A;  3CX7 B;  3EUH A;  3AA7 B;  1MMA A;  2BBH A;  4PFP A;  4ASK A;  1MMG A;  3SOL A;  2FBW A;  2LOS A;  3O4X E;  4HTE A;  2BG9 C;  5TAO A;  3CX8 B;  2VVN A;  3TLU A;  1VRB A;  3ZN0 B;  1HX1 B;  4NUV A;  1IAP A;  4DMV A;  4L9I A;  4ZI7 E;  3BQL A;  1SE7 A;  3A8Y C;  2NTY A;  5ABE A;  4UIG A;  2D0U A;  3TLT A;  5HXR A;  3EI0 A;  4IDZ A;  4GIW A;  3K3N A;  4Z91 A;  2V6Y B;  5L2L A;  2OV9 A;  4DND A;  5LGU B;  5LMN T;  2FJE A;  3N2K E;  4YHJ A;  3T1Y T;  2ZLY A;  4O4L E;  5BR8 T;  4GK0 E;  2YIN A;  1ZKE A;  2Y6X A;  2XAH B;  2YU2 A;  2WAU A;  4X1Y E;  3NWI A;  4AI6 A;  3HKB E;  3RGL A;  1T7S A;  4TZ4 C;  3AEF A;  5A1L A;  4K0K T;  4H9O C;  4L0R A;  5AQI B;  4H9P C;  3CML A;  5HXH A;  4X65 T;  2J62 A;  3C51 A;  1QSD A;  2V1D B;  4Z90 A;  3KVB A;  5E0O A;  3N9M A;  2J4G A;  4DR2 T;  4U7Y A;  4X62 T;  5AQM B;  3ZMT B;  4DVD A;  3RYI E;  4B3S T;  4EYU A;  3CK6 A;  4P1N A;  2CRB A;  1WR6 A;  2K48 A;  3AB3 B;  3ZYL A;  1HX8 A;  3Q9D A;  4JI1 T;  5JDG A;  1Y64 B;  1KF6 A;  2XQ6 A;  4MHC A;  5L3G B;  1Z8U A;  3UU5 A;  1GQE A;  3KBU A;  2CXF A;  4DID B;  2OA5 A;  3AE2 A;  4CZZ B;  4AQY T;  5FL1 A;  2W00 A;  4AKH A;  2I0M A;  1KNP A;  2V7M A;  4DR4 T;  1YKH B;  5LXT E;  3MZK B;  4OK0 A;  5AQH B;  2CCQ A;  5LG4 A;  4P09 A;  5HWX A;  4ZI3 C;  3FZF B;  4IE4 A;  2BKP A;  4PAG A;  3RI5 A;  5ABH A;  1T8B A;  2MTQ A;  2IC9 A;  5FNV E;  4HKA A;  3OBV E;  3O1I A;  3CQG B;  4KI0 F;  1L0V A;  3BK9 A;  4F6R C;  1J5E T;  2IAK A;  2WS3 A;  1D0X A;  4CN1 A;  4NUU A;  3Q5D A;  1D1A A;  1B7T A;  3ETU A;  2VUR A;  5FVK A;  1YQ3 A;  3FZL B;  3ZMS B;  3ZN1 B;  4JBW F;  5HEG A;  1Y01 A;  2B76 A;  5J0Z A;  2LSK A;  4H63 V;  1YW0 A;  3L39 A;  3OKQ A;  4IE0 A;  1US7 B;  5LHI B;  3AAE B;  1S94 A;  2ODV A;  2JIW A;  3I9Y A;  3M65 A;  4UEM A;  2M6I A;  3CQC B;  3JC6 D;  4EGW A;  2XSB A;  4PW8 A;  2DL1 A;  3ZSS A;  1UUR A;  2QRX A;  2GK9 A;  2V7I A;  4COF A;  4DBR A;  4EEB A;  5IHY A;  4O2B E;  1CUN A;  2EHO C;  4DUY T;  5JDN A;  4CI3 B;  3OTO T;  5LHG B;  2W66 A;  1W0A A;  2XUE A;  4H9N C;  2NWB A;  4JI6 T;  5L47 A;  4ZEY A;  4JYA T;  1NWM X;  2JMH A;  4P0B A;  3H37 A;  5ABF A;  2WZH A;  4IDP A;  4IRE A;  5F8P A;  4ISS A;  4YSY A;  2VKD A;  2KT9 A;  4ZOL E;  2Q9Q C;  4FI5 A;  3RKO A;  5DAB A;  4QH4 A;  4BJM A;  2DNX A;  4JLE A;  3PUY F;  3A7M A;  3RC8 A;  5HWY A;  2NW9 A;  3MKD A;  1WCR A;  2XAF B;  3SFD A;  5C3J A;  3RYC E;  1UGO A;  2VK9 A;  2XSA A;  3KV4 A;  2WDR A;  1S35 A;  4DO0 A;  4EZH A;  2XQ8 A;  4O4H E;  5HXC A;  2XPK A;  4AIS A;  3RIF A;  2V7J A;  2MBG A;  2YDR A;  4YTN A;  3I9W A;  2CLY B;  3CVR A;  2V6Y A;  2WCA A;  5FY1 A;  3F31 A;  4LMK A;  2WDV A;  4GK5 E;  4A5X A;  2UU9 T;  5AQV B;  3ABV A;  4JV5 T;  1XDP A;  2FJA A;  2LHR A;  3VR9 A;  2BZB A;  3WAJ A;  2WZI A;  1HTJ F;  3ONJ A;  5L3F B;  2LSG A;  1FEW A;  5HEH A;  4U2Z A;  4IE7 A;  3KBT A;  3ZJ2 A;  1UUS A;  2W0G A;  1T72 A;  2ZMA A;  4E7Z A;  3SWH A;  3BQI A;  5LGN B;  4YFS A;  3RHW A;  4HN9 A;  3U3I A;  3QNU A;  1MMN A;  3A5X A;  3G06 A;  1HG2 A;  2WWV A;  3N5L A;  3RRW A;  3KV5 A;  3CPZ A;  5HEO A;  2WBL A;  3B13 A;  5LG3 A;  5J2U E;  5L3B B;  5JR9 B;  4PFO A;  3OYX A;  4YHH T;  1D0Y A;  4BA9 A;  2LHN A;  4KX6 A;  4EV6 A;  2A3D A;  3FZH B;  1J5W A;  5FXW A;  4NXM T;  2PG8 A;  4YJ3 E;  4QH1 A;  2CM0 A;  4EED A;  5F5W A;  4IL9 A;  1G73 A;  1UX5 A;  3C50 A;  4PK4 A;  2DWK A;  2DLR A;  2PBI A;  5DQV A;  2VKH A;  2XQA A;  4IST A;  3U78 A;  1OED B;  2CWO A;  2CBI A;  2LJL A;  2J47 A;  2BVL A;  2AXD S;  3AA1 B;  5CGM A;  1D1C A;  1YXR A;  2M6B A;  2D9D A;  3DTO A;  2LLY A;  3P4S A;  2K3W A;  2MPK A;  3VKH A;  4IE5 A;  4ZS2 A;  5FY0 A;  4EYY R;  3BQK A;  4QXB B;  3T8O A;  3TKL B;  3PUG A;  5L4H A;  2OLT A;  3N2O A;  3AAA B;  2N9D A;  5HEU A;  1QUU A;  3N9P A;  4CN4 A;  4ILU A;  3EHZ A;  2BKN A;  2C5K T;  4YSX A;  1YKE B;  5IYZ E;  5AFU L;  4ADZ A;  3VU7 H;  5AQS B;  1V9D A;  3PTR B;  4TWH A;  4HFH A;  5AQP B;  2G0U A;  2E2A A;  5JQG E;  1MIV A;  5HXS A;  1KFY A;  4X1K E;  3IA3 A;  3AEA A;  4IIJ E;  1IJ6 A;  5AQN B;  1XNR T;  2JQ9 A;  2XQ9 A;  5AQR B;  4GOU A;  4AKR B;  2HN2 A;  2Q9Q D;  2XQ7 A;  5AQJ B;  3ZMV B;  3V5S A;  5AQG B;  3KV6 A;  2LRK A;  3AEG A;  4O4I E;  4DV7 T;  1KEY A;  4DV1 T;  4EZ4 A;  2PJQ A;  3GN5 B;  3PUV F;  2NOX A;  2FUP A;  5CA0 E;  4I4T E;  2VQF T;  1IZN B;  3IBP A;  3O1J A;  1N32 T;  3AEB A;  3AE1 A;  3PJA J;  3P4R A;  4AQG A;  3EDV A;  2HPJ A;  3QOF A;  5FXV A;  2BS3 A;  2X9Y A;  3PUX F;  3L09 A;  4O8S A;  4ANJ A;  4XZC A;  1NEN A;  5LYJ E;  5JRC B;  1LRZ A;  3UU3 A;  4UXN B;  3SRZ A;  1FMW A;  2LOP A;  5AQK B;  3ZCI A;  3AE5 A;  3KFW X;  4TX5 A;  4HWF A;  5AQT B;  5DQW A;  3RX6 A;  4LFC T;  2RP4 A;  1ZP0 A;  3OPC A;  2NW7 A;  1MND A;  4PK6 A;  2V7K A;  4QH5 A;  3P50 A;  3J9X 1;  1VCT A;  1BR1 A;  2KIN B;  2L9Q A;  2WU5 A;  4JI2 T;  4OFZ A;  4UR9 A;  4U7I A;  5FMN A;  3UUL A;  2H7O A;  4ZI2 C;  3ONX A;  2L8K A;  1XDO A;  3PV0 F;  3RPU A;  3AEE A;  4PJL A;  4IT4 A;  3N2G E;  3PUA A;  1VCS A;  3ZLI A;  3PUZ F;  3E0Z A;  4HFV A;  1MIY A;  2UXB T;  4G63 A;  4KMC A;  3JCF A;  3QC9 A;  4ZZB A;  2YN6 A;  1NAF A;  2UXN B;  2X68 A;  5LMU T;  4WNK A;  1H7C A;  2LSJ A;  3RLF F;  1WR0 A;  2LEH A;  1KK7 A;  4AQF A;  3UQ4 A;  4YTP A;  3LJC A;  3QUJ A;  3L8R A;  4LFB T;  4PK5 A;  4HGA A;  4JI3 T;  3FXD B;  4OYK A;  2E9X B;  3QB5 K;  4KHP T;  5LGT B;  3VHL A;  3VR8 A;  5JR9 A;  3T1H T;  5F3J A;  4H9Q C;  4G2A A;  3I1A A;  4IDO A;  2KWH A;  3P8C D;  4IGU A;  4NXN T;  2E8I A;  2NR4 A;  3LBX B;  3R84 B;  5LJN A;  5IUX A;  2XAS B;  4ILC A;  2W2U A;  2ZM0 A;  4IDN A;  3OYZ A;  1X9B A;  3PUS A;  3VKG A;  2V5D A;  4IE6 A;  3N9L A;  3Q2M A;  4JI7 T;  2E5V A;  2FJB A;  3HL6 A;  1XWM A;  4H9R C;  4U3C A;  4DBQ A;  3RYF E;  3VRB A;  1WYB A;  2KWI B;  3Q5X A;  4HEA A;  1OED A;  2WP9 A;  5H6R B;  3K8P C;  5JDH A;  2VKO A;  5LNK A;  3NKZ A;  3N9N A;  3ZEF B;  3S4U A;  2RA1 A;  5FXZ A;  3ZMU B;  3ZT6 A;  2XTL A;  1XNQ T;  2ZM8 A;  2X0H A;  2M67 A;  1JNR A;  3P7I A;  2X51 A;  4TWF A;  5CB4 E;  4B3R T;  4H9S E;  1CHU A;  5L4E A;  1FIO A;  4LF7 T;  4KBM B;  3MK7 C;  3Q5W A;  1HNZ T;  4X66 T;  1HFA A;  3LK3 B;  3IHR A;  2VB6 A;  3K1S A;  3C4X A;  5LHH B;  4AIU A;  3SS1 A;  1HNW T;  3ZKR A;  2W62 A;  1WFD A;  4WBO A;  4CXX A;  4YJ2 E;  4TWD A;  2XZE A;  3M3Z B;  3RKG A;  3L3P A;  2LT3 A;  4I43 B;  2QGS A;  3F57 A;  2YDQ A;  2CEA A;  3UQ7 A;  3PJA A;  4IHJ E;  4WW0 A;  3CWZ B;  4XAX B;  3ESL A;  4UV9 B;  3EAM A;  4GKK T;  3V5U A;  2A2F X;  1W0B A;  3C64 A;  4TNW A;  4LF6 T;  2JQQ A;  3RYH E;  3RIA A;  2FJD A;  2IC6 A;  3O1H A;  2BG9 E;  4LF4 T;  5FP3 A;  2XQ3 A;  5DJQ C;  2R6G F;  2KSR A;  4BAY B;  2QA7 A;  2IDO B;  2X9H A;  3IF8 B;  1WYC A;  4KUM B;  2JRK A;  4DR3 T;  4DR6 T;  4A97 A;  2LSY A;  2JQK A;  1I94 T;  3AED A;  3GN5 A;  4N78 D;  4U33 A;  4ZXL A;  4DV4 T;  2UUC T;  4X1I E;  4B3T T;  1HR0 T;  4LF5 T;  3ONL C;  1HG5 A;  3AXJ B;  5JVD E;  2IHR 1;  2MOZ A;  4U74 A;  4LFA T;  5C8Y E;  3W15 B;  1UK5 A;  4GYR A;  3GWH A;  1EZ3 A;  3C98 B;  4DV2 T;  5JRC A;  3RRC A;  1JNZ A;  4ZI2 D;  4KHZ F;  2CLY C;  4IL4 A;  5EZY E;  3ZJ1 A;  3FZM B;  3UU4 A;  5LJM A;  2UUB T;  1BR0 A;  3IEE A;  4YXD A;  4JI0 T;  3AE9 A;  3ZMZ B;  4BJN A;  4XBF B;  2Z6E A;  4ZI3 D;  1N33 T;  3JAE A;  2AE9 A;  3N9O A;  3F2E A;  3ZC0 A;  5H6Q B;  5KDM C;  2CPT A;  1MIW A;  4OHF A;  3AE3 A;  3GA8 A;  5FVL A;  1Z0P A;  2NTX A;  3RF1 A;  5JDQ A;  3AE4 A;  1XMQ T;  4F8H A;  3HR0 A;  2YOE A;  2N2N A;  4HFD A;  4JI5 T;  2WB5 A;  3NRX A;  4HWH A;  2PFV A;  3PDY A;  5JDM A;  3KDS E;  4AQF C;  5LB7 B;  3CKD A;  4DMW A;  5AQQ B;  4I55 E;  3OVU A;  2KND A;  4DR5 T;  3FZK B;  3DP7 A;  2K24 A;  3K3O A;  2WQY A;  5JR9 C;  3QB5 A;  4C90 A;  4GKJ T;  1IBL T;  2WY2 A;  2V26 A;  3HKC E;  2IW5 B;  1IBM T;  4HE8 A;  4DV3 T;  5FXX A;  2K9A A;  2BG9 B;  2E9X A;  3RQU A;  3OJA A;  2K5B B;  2V7L A;  3ETV A;  2HHH T;  2A9U A;  3ZC1 A;  1BR2 A;  3MJX A;  2V8S V;  4ZS3 A;  1MNE A;  2XQ5 A;  3LBX A;  2C0S A;  3AVR A;  2UXD T;  2EHO D;  4HFC A;  3UTK A;  4E7S A;  2KMF A;  3FBL A;  3J7Y q;  3JC6 C;  2DI4 A;  2I59 A;  3ZYK A;  3HKE E;  2LRL A;  2BVM A;  1OED C;  4PNI A;  3RQW A;  3LK2 B;  3TLW A;  4TNV A;  1G8X A;  3UT5 E;  3CQX C;  3ZT7 A;  4JUY A;  3LK4 2;  4FJO A;  5ADX L;  4ZHQ E;  4Z8X A;  2V6X A;  2XM1 A;  5L3D B;  2UXC T;  1XZY A;  4B6X A;  2H89 A;  4EXT A;  5CFB A;  1MMD A;  2CWY A;  4UEL A;  2JJ9 A;  2YDS A;  2CHO A;  3ZYM A;  2Q9Q A;  4EIW A;  2MYS A;  3UU6 A;  1ZHC A;  4DV6 T;  2VQE T;  2HH7 A;  4X64 T;  2ZM2 A;  4X5T A;  4ILA A;  1LVK A;  3ANW B;  4CXY A;  2XJ7 A;  1U4Q A;  2H88 A;  1E7P A;  3P4Q A;  4I0U A;  4OYJ A;  2Y8D A;  3UUB A;  1SHZ C;  2X67 A;  3MA9 A;  1YQ4 A;  4TV9 E;  2ZM6 T;  1NEK A;  5LP6 E;  3UU8 A;  2C5J A;  2L3L A;  4AKL A;  1YD8 G;  2HN1 A;  2WSS V;  1WLX A;  4QHO A;  5IWA T;  4CI2 B;  4DV0 T;  5JDL A;  2ACX A;  3AVS A;  3I0O A;  4UF0 B;  2JMK A;  2KXP B;  4B3M T;  3B57 A;  1X79 A;  5GON E;  3K3Q C;  3HI2 A;  5LCY A;  5M4Y A;  1HCI A;  2WMN A;  3RC3 A;  1W09 A;  4PJJ A;  4OX9 T;  2XHE B;  5EK3 A;  5AQU B;  2D0T A;  5ABG A;  1FMV A;  4HFB A;  3FXE B;  3UFE A;  3D0T A;  4ERR A;  4DUZ T;  5L3E B;  4PJN A;  4J2C A;  1DU2 A;  2XY8 B;  2KZ7 B;  3FBZ A;  5CA1 E;  4JEH B;  4H63 H;  2CXL A;  3B5M A;  3PU3 A;  3AXJ A;  2MAW A;  4A56 A;  1QLB A;  4WZX A;  3P4P A;  3TLV A;  5FYM A;  4CI1 B;  3RIU A;  4ZZC A;  4X20 E;  3N9Q A;  2JQH A;  5L3C B;  1M7K A;  4YLH A;  1IBK T;  4TUY E;  3E08 A;  3C4W A;  3LSV A;  3Q5E A;  2CA5 A;  3DJB A;  2VVS A;  1N34 T;  2C5I T;  2XQ4 A;  4WYV A;  1VOM A;  2VL0 A;  4O4J E;  2NW8 A;  1XMO T;  5HCM A;  2WMO A;  2ES0 A;  2IML A;  5FL0 A;  3AE8 A;  1BR4 A;  2WDQ A;  1E2A A;  2WU2 A;  4UVA B;  3GMI A; 
#chains in the Genus database with same CATH homology
 2IDO B;  2AXD S;  1DU2 A;  2XY8 B;  1SE7 A;  2AE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...