2AE9A

Solution structure of the theta subunit of dna polymerase iii from e. coli
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
76
structure length
76
Chain Sequence
b'MLKNLAKLDQTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHRLASVNLSRLPYEPKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase III, theta subunit
publication title Nuclear Magnetic Resonance Solution Structure of the Escherichia coli DNA Polymerase III {theta} Subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 24
structure length 76
sequence length 76
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06440 DNA_pol3_theta DNA polymerase III, theta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.250 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 DNA polymerase III-theta 2ae9A00
2AE9A 2XY8B 1DU2A 1SE7A 2AXDS 2IDOB
chains in the Genus database with same CATH superfamily
2BG9C 3KVBA 4UV9B 4HFDA 2X0LB 4U74A 5HXCA 3QB5A 4Z91A 1I6ZA 3IF8B 3LK3B 3ETVA 3CK6A 4DR6T 2X9HA 3N9LA 2E2AA 2XZEA 4TWFA 2X66A 2BBHA 3GWHA 5HYAA 1X9BA 4O2BE 4HTEA 2C5JA 2J4GA 4ZXLA 4YY3T 2VWAA 5FVLA 4CI1B 4DV7T 3AXJA 2BS2A 3CX6B 3SOLA 5HXSA 4K0KT 2IIUA 2I0MA 4HFHA 4DUZT 3BK9A 3H3AA 1N34T 4X1IE 2Q9QC 2XQAA 2KT9A 4DV4T 1W09A 3NRYA 2QA7A 3BQIA 4YSZA 3RC8A 5AQVB 4CI2B 4HKAA 5AQFB 3SFDA 4O4IE 3LDQB 4UEMA 2CRBA 1SUMB 3AEEA 2H88A 2ACZA 4O4JE 4EXTA 2XQ3A 3CWZB 3AE4A 2CLYB 5AQHB 1OXZA 1ZHCA 3OKQA 5LBQB 5HEGA 4TX5A 4GYRA 2CMRA 2BKOA 3AVSA 2PJQA 2C5IT 5LNKA 2UXDT 2EHOA 5J1GA 2IC6A 2SPCA 5M4YA 3L3PA 3MK7C 4P0BA 4X20E 3GA8A 1HTJF 4ADZA 5EK2A 4CXYA 4FJOA 3LFMA 2DNXA 2YINA 4I50E 1YKEB 2XSAA 4DUYT 4AQFC 4YTMA 4EYUA 2XY8B 2QYWA 2PBIA 4AISA 4ILAA 4UR9A 2UXXB 3MXZA 1MIYA 4E7SA 2CEAA 4H9QC 2XQ8A 2RPAA 3CQGB 1YKHB 4DV3T 2PFVA 4MHCA 2BS3A 2A72A 2UU9T 2UUCT 3PUZF 2XM2A 4ZS3A 2BG9A 2WWVA 3NRXA 1SE7A 2CM0A 4YHHT 4H9PC 3FBZA 1UUSA 2LSKA 4GK5E 5IUXA 3OYZA 3W15B 4U7YA 3EDVA 1UCUA 3UQ7A 2BKPA 3C4XA 2OLTA 5C3JA 1Z8UA 2KMFA 1Z0PA 3G06A 3RQUA 1WCRA 1J5ET 2CHNA 3UQ4A 2Q9QA 4JI1T 2PTFA 5LG4A 5LYJE 3VKGA 5JQGE 3CX7B 5TAOA 2X0YA 3AEAA 2KXPB 3U78A 1FJGT 5BMVE 4IL9A 1OEDE 1AJ3A 4X1YE 5FY1A 2LLYA 2BVLA 3ZT6A 3ZC0A 4H9NC 2X68A 2VVSA 2V8SV 4PK6A 4YTPA 4YFSA 2H7VC 2IMLA 2LJLA 3EHZA 2ZM2A 1DU2A 3RRCA 2ODVA 4I4TE 2LT3A 2H7OA 2C0SA 2YEVC 4ZHQE 3EABA 2CWYA 4HEAA 5LCYA 1UX4A 4LF5T 3JAEA 3CMLA 4AQFA 4WBNE 3I0OA 3QNUA 1ZKEA 4DV1T 3SWHA 3JADA 2ZM8A 4KBMB 2FUPA 5JVDE 3AXJB 4Q25A 5LMNT 1BR0A 3CQXC 2WMOA 4GIWA 1XDOA 3Q2MA 2W63A 5HWXA 3AE5A 2LHRA 1YQ4A 2CXFA 5JDQA 3SRZA 4ZEYA 4U72A 2LM9A 5L3CB 5AQMB 1ZV4X 1J1JA 4H9RC 2WCAA 3UU3A 1T8BA 4QX8B 2P9BA 2YU1A 3RH3A 3K3QC 1OEDC 4V1Av 2LOPA 3UFGA 1ZOYA 4GYSA 3AE2A 2L8KA 4AKIA 3K1SA 3FXDB 4CN1A 2WY2A 3RPUA 4PJLA 3EI0A 2FJEA 4KHPT 3CVRA 2HH7A 5BR8T 2C5KT 5L4EA 5L3GB 3I9YA 3MA9A 2B76A 3UU6A 3KBUA 3AEBA 5AQGB 4DR2T 3Q9DA 3AVRA 2YN6A 1IJ5A 2LKGA 4OYKA 4PJMA 3NVOA 3OJAA 3F31A 4X1KE 3ONXA 1BR1A 2VKJA 2WU2A 3ZEFB 3P4RA 1LVKA 2ZMAA 2CHOA 2VKOA 1HX8A 1VRBA 2BS4A 5JDGA 3BQKA 4UV8B 2BG9B 1QLBA 4P0AA 4O8SA 2HHHT 2BG9E 4WBOA 1IJ6A 5L3BB 5A1LA 1QUUA 2UXBT 2W0GA 2VK9A 4Z8XA 2CBIA 3TLWA 5L2LA 4QH4A 4YTNA 3K8PC 1U4QA 2WP9A 5AQKB 3CKDA 3O1HA 3RRWA 1KK7A 4BJMA 5AQNB 2X9XA 4HWFA 2HN1A 5IYZE 5JREA 3BQLA 3LSVA 4LFBT 2JQKA 1IBMT 1N36T 3PU3A 5HEOA 2Q9QB 2L3LA 5C2TA 4PJJA 2MYSA 2IUBA 3RLFF 2D9DA 5CJ5A 2EHOC 3HI2A 2V7LA 2A9UA 5HXHA 3TLSA 3EDUA 4AKRB 1FIOA 3EUHA 4YJ2E 3AA7B 2V1DB 4X66T 1OEDA 3HL6A 3AEFA 4TV8E 4U33A 2E9XD 3AA0B 4AXPA 3FZFB 2X51A 4X5TA 4E7ZA 2X9YA 4ZI3D 4DVDA 1LKXA 2WS3A 3KINB 4K0UA 3WI3A 3CIRA 5JH7E 3DTOA 1J5WA 4PFOA 4X65T 4IDOA 2VURA 4DR5T 1KF6A 2RA1A 3HA4A 4EEDA 1WRDA 3ZJ2A 2K3WA 4LF4T 4OK0A 2A3DA 2KNDA 3TLTA 4EOZB 2ODUA 5AQTB 2LSGA 1HFAA 3ANWA 2FBWA 1W0BA 3PUAA 5LMUT 4KUMB 4AKGA 4YXDA 3ZKRA 5CA0E 4ISSA 3KVAA 5LJNA 4DO0A 4CN4A 4ZI2C 3AB3B 3ZYKA 4IGUA 4HFCA 2NTXA 1M62A 4H9SE 3K3NA 1VOMA 4CN6A 5ABEA 4ILUA 4QHOA 1XNQT 3KV5A 4TNWA 4EEBA 4EZ4A 4NUUA 4J2CA 2H3RA 3MKDA 4LF9T 5C8YE 2L9QA 1HNXT 4AI6A 2CPTA 3F2EA 1JNZA 1R8IA 2NW8A 3RC3A 5LGTB 3ZYLA 5L4HA 5GONE 2DWKA 3TKLB 2NR4A 2BZBA 2MOZA 3QUJA 4LMLA 2F4VT 3CX8B 3PUWF 2V6YB 1HG2A 3EAMA 1XZYA 2YDQA 5F8PA 2E8IA 4ZOLE 2LSIA 4NPPA 3UUXB 2XQ7A 3T1YT 4IREA 2DI4A 4AQYT 4JI5T 4X64T 3H3MA 4TZ4C 4QH5A 1IBKT 5FL0A 4EGWA 4EAHA 3ZCJA 2LRLA 2LKHA 3ZSTA 4GKKT 1QSDA 5LA6E 1G8XA 3O4XE 4AKLA 4YJ3E 4U2ZA 3JC6D 4WNKA 4YSXA 2NP9A 3P4PA 3HR0A 2XSBA 1LVFA 2KZ7B 4HWIB 3FZMB 2JMKA 2DHRA 1OWAA 4ERRA 2IDOB 2QVAA 3N9NA 4ZS2A 5HCMA 5FL1A 3M65A 2WDQA 4HWHA 4TN7B 1KEYA 3VRBA 3E0ZA 3ONLC 5KDMC 2XUEA 2XQ5A 1FMWA 5AQUB 3AA6B 3M3ZB 2WAUA 1UX5A 4JEHB 5JRCA 2LEHA 2WU5A 3F57A 1FEWA 4HE8A 2DLRA 3ETUA 2XQ4A 5L47A 5L3DB 1G73A 3LG7A 4UXNB 4H63H 5FP3A 5FXWA 2JQQA 2K24A 4IE4A 1OEDB 2MBGA 1FMVA 4TUYE 2WDRA 5HXRA 3KV6A 3PUVF 5LBMA 2FJBA 4KHZF 4ZI7E 2AE9A 4G2AA 5LGUB 3ZN0B 5HCJA 4U31A 1JNRA 2E9XA 5AQJB 2V7KA 3AE3A 5JDMA 4AIUA 3VKHA 5JR9C 4JI8T 4JYAT 3IHRA 2I59A 3ZMVB 4BJNA 5F5WA 4QXCB 2D2SA 4CI3B 4XAXB 2ES0A 4L0RA 3PURA 1KNPA 3AAEB 5DQVA 3ZCIA 1T72A 2XQ6A 2E5VA 4UF0A 1D1AA 1GQEA 4EB6E 3C98B 1X79A 4HWCA 4NIQA 5LOVE 2LRKA 5AFUL 3VR8A 2V5CA 3O1JA 1WR0A 1E7PA 4BA9A 4MBQA 3L8RA 1VCSA 3A8YC 2VL0A 2VASA 2R6GF 2GK9A 3C51A 4AQGA 4DV6T 3MJXA 2Y8DA 2PG8A 3K3OA 3S4UA 4LMJA 2Y48B 4IT4A 5DQWA 1T98A 3O9XA 3QK6A 2V7MA 2EHOB 3ZT7A 3IBPA 5DJQC 4NXMT 5LB7B 2LE8A 3FZLB 4TWHA 3P8CD 3RX6A 5LJMA 1HS7A 4JI0T 2J47A 3RI5A 1HX1B 4I0UA 3AAIA 4LF6T 4MALA 3AE1A 3OBVE 1N32T 4Z90A 4M1PA 3EVYA 3FB2A 2Y6XA 5EK3A 3KV4A 3P4SA 4QX7B 2UUAT 2FJAA 3AE7A 3UFEA 3OTOT 3NWIA 1WLXA 5ABGA 2I6HA 3FBLA 3NKZA 2HN2A 4X62T 4JI4T 3U3IA 3SS1A 5L3EB 3B13A 5F3JA 3RKGA 5CA1E 5JR9A 2VB6A 3N9PA 5J2UE 1D1BA 3PV0F 3A5XA 5ABFA 3I0QA 4CQIA 3TLUA 4DV2T 4XBFB 5FY7A 1UGOA 4DR3T 4PFPA 4CXWA 4C91A 3R84B 2XPKA 1V9DA 1YD8G 5LHHB 2CBJA 2RP4A 3J9X1 2N2NA 1MMGA 1L0VA 2XAJB 4IDQA 4YLHA 2NWBA 4QKNA 4ILBA 3O1IA 5H6QB 3L09A 3RIFA 3Q5EA 3DJBA 2NW9A 2JMHA 1MIWA 3RHWA 2WZHA 3ZPOA 5LHIB 3AEGA 4A5XA 4OFZA 4JI3T 3HKCE 1NENA 4U2YA 3N5LA 2DWGA 3VRAA 2Q9QD 4P1NA 3PUXF 2W62A 4QXBB 2KLQA 2W00A 4WZXA 2XQ9A 5IHYA 1IZNB 1UURA 3L39A 2CE7A 4BAYB 4NUVA 4UVAB 1U5PA 3PDYA 1CHUA 3UU4A 4A97A 2D0TA 4DMWA 4HN9A 3ZMTB 3MACA 1US7B 4DR1T 4JV5T 3V5SA 4COFA 2W61A 3NBXX 2JQHA 3P4WA 3UU5A 2NOXA 4PK4A 4CXXA 2VQET 5HEJA 5J2TE 4UF0B 1D1CA 2BBJA 3UUNA 1HR0T 1HCIA 5FXVA 1BR4A 4O4LE 4C90A 1CUNA 2V26A 3ZYMA 4H9OC 3GMIA 1N33T 4A56A 4QH1A 5HEUA 2VKDA 3WAKA 3RKOA 2JIWA 2JPFA 4DBRA 5AQLB 3VU7H 1MMNA 4KX6A 5HAXA 3ZJ1A 2X67A 4ASKA 3E08A 4JBWF 3ZMZB 3ZSSA 4TWDA 4F6RC 2XQYA 2XM1A 4UIGA 3T1HT 2BDEA 4L5GA 4N78D 1KNZA 3T8OA 3ABVA 4EV6A 2V7JA 1YW0A 3RQWA 4JI6T 1WFDA 3ZC1A 2IAKA 4UVCB 3DP7A 5AQOB 2B1EA 2BVMA 2HPJA 4DMVA 3N2GE 1YQ3A 3GN5A 5LHGB 3ZT5A 5CFBA 1SHZC 2E9XC 2YOEA 3AEDA 3ZN1B 3QC9A 5JDHA 2IW5B 3N9QA 4ZZBA 3N9OA 4OHFA 4ISTA 4HFIA 3PJAA 3SFEA 2W66A 4TNVA 3HKEE 4ZI3C 2A2FX 2UXCT 2YKSA 1IBLT 2UUBT 4L9IA 4U3CA 2VKHA 3IA3A 2HPLA 2W4XA 1HF8A 1T7SA 3PUQA 3B57A 4QXHB 2XAQB 4IHJE 4O2AE 4ANJA 1ZP0A 2OV9A 4B3MT 2WSSV 5FMNA 2QRXA 3PUGA 5LXTE 5JR9B 1D0ZA 3VR9A 2VQFT 5FVKA 2AXDS 3MZKB 3C4WA 5LP6E 5ABFB 4GK0E 3VHLA 4IE5A 3KV9A 2XTLA 1E1HB 3AAAB 1MMAA 4PW8A 3PE0A 2QGSA 3RYFE 4PK5A 4HFEA 3PTRB 2MAWA 5J0ZA 2VL8A 3B5MA 1XDPA 3AE8A 1XMQT 2M67A 3CQCB 4DBQA 5DABA 3CPZA 4DR4T 5HEHA 2K9AA 5JDFA 1HNZT 2JJ9A 5FY0A 3LJCA 2DL1A 2KSRA 4YHJA 4JUYA 2M6BA 1VCTA 2WBLA 4IDPA 4H63V 5KMGP 3Q5DA 3OPCA 1WYCA 3Q5XA 5IWAT 4LF7T 2CLYC 3ZMUB 2WWUA 4PNIA 2LM2A 4FI5A 4AKHA 5JDLA 1NWMX 4KI0F 4YT0A 1W9RA 3Q5WA 2WB5A 4QWNB 2D0UA 2J62A 1HG5A 3RIUC 5JDNA 1D0YA 1UK5A 3R6NA 3D0TA 1WR6A 3FXEB 5FKYA 2NW7A 3NZPA 3RF1A 1ZEEA 3FHNA 3JC6C 2YDRA 1MNDA 5L3FB 3C64A 2YU2A 5AQQB 2YK0A 5ADXL 3UUMA 1HNWT 1YXRA 4DV0T 1Y01A 2CWOA 2UXNB 3HKDE 3P7IA 4MLKA 4CZZB 3ZLIA 3OVUA 3PU8A 5AQRB 3ANWB 3LBXA 3I1AA 2XAFB 1IAPA 2WM9A 4IE0A 1S94A 4F8HA 2Z6EA 4TV9E 3RIAA 1W0AA 4LFCT 3RYIE 4PJNA 3JCFA 3JAFA 3HKBE 2ACXA 4A98A 3A7MA 4LMKA 3ESLA 1KFYA 4WYVA 4UVBB 3LK2B 2XAHB 2ZM6T 1LRZA 3AE9A 3NZQA 4O4HE 4HGAA 3RYCE 2J1DG 5ABHA 2V6XA 5CGMA 3TLVA 2W2UA 3PUSA 3GN5B 3UULA 2NTYA 2X0HA 3LK42 3UT5E 1M7KA 5E0OA 2V7IA 2CA5A 2WDVA 4JI7T 4DR7T 5EZYE 1B7TA 1H7CA 2JRKA 3C4ZA 5H6RB 2YDSA 2K48A 1D0XA 2LOSA 1BR2A 5AQIB 5ETWA 4IDZA 2ZM0A 2EHOD 4MFRA 2XAGB 4B3ST 3V5UA 3H37A 2WZIA 1E2AA 5CB4E 3PUYF 3QB5K 4HWDA 2FJDA 4GKJT 2WMNA 3P4QA 4GOUA 2KWHA 3J7Yq 4IE6A 2VVNA 4NXNT 5FYMA 4UELA 5AQSB 2V6YA 3N9MA 4JLEA 3RIUA 4EZHA 2XASB 3ZMSB 3AA1B 2MTQA 3N2OA 1MMDA 2LHNA 4OYJA 5FXZA 4JEUB 3I9WA 3C50A 3N2KE 3UU8A 3X1DA 4P09A 2MPKA 5HXEA 4EIWA 2N1GA 1NEKA 1KNRA 2IC9A 4PAGA 3E22E 4I43B 2WQYA 2KINB 1NAFA 5KXJA 4B3RT 5HWYA 5JRCB 4XZCA 2XHEB 2D5UA 3AE6A 1XWMA 4G63A 5LG3A 2G0UA 3KDSE 2CXLA 4DV5T 1WYBA 4DNDA 1O3XA 3WAJA 4HFVA 3AECA 3P50A 4U7IA 3UUBA 5KX5E 3QOFA 4IIJE 2X9WA 3OYXA 2LSYA 2IHR1 1SA0E 1MNEA 3RGLA 5FXXA 3FZKB 4JI2T 4ZI2D 3RYHE 2DCFA 2M6IA 1MIVA 4WW0A 2XJ7A 3ONJA 2ZLYA 2H89A 2KWIB 4DIDB 2CXDA 2W67A 2BKNA 2E9XB 2N9DA 4HFBA 4EYYR 3FZHB 1XMOT 4IDNA 4KP3C 3UTKA 2E5LT 4OX9T 3IEEA 3KFWX 4ZZCA 4IE7A 1XNRT 1S35A 4ILCA 4KMCA 4LF8T 5LGNB 1I94T 4B3TT 3KBTA 1EZ3A 4I55E 2V5DA 4B6XA 4LFAT 2LSJA 1Y64B 3PJAJ 4YSYA 5AQPB 5JTGA 2OA5A 4IL4A 2CCQA 2K5BB 5EK4A 2JQ9A 3LBXB 5FNVE
chains in the Genus database with same CATH topology
2AE9A 2XY8B 1DU2A 1SE7A 2AXDS 2IDOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AE9 A;  2XY8 B;  1DU2 A;  1SE7 A;  2AXD S;  2IDO B; 
#chains in the Genus database with same CATH topology
 2BG9 C;  3KVB A;  4UV9 B;  4HFD A;  2X0L B;  4U74 A;  5HXC A;  3QB5 A;  4Z91 A;  1I6Z A;  3IF8 B;  3LK3 B;  3ETV A;  3CK6 A;  4DR6 T;  2X9H A;  3N9L A;  2E2A A;  2XZE A;  4TWF A;  2X66 A;  2BBH A;  3GWH A;  5HYA A;  1X9B A;  4O2B E;  4HTE A;  2C5J A;  2J4G A;  4ZXL A;  4YY3 T;  2VWA A;  5FVL A;  4CI1 B;  4DV7 T;  3AXJ A;  2BS2 A;  3CX6 B;  3SOL A;  5HXS A;  4K0K T;  2IIU A;  2I0M A;  4HFH A;  4DUZ T;  3BK9 A;  3H3A A;  1N34 T;  4X1I E;  2Q9Q C;  2XQA A;  2KT9 A;  4DV4 T;  1W09 A;  3NRY A;  2QA7 A;  3BQI A;  4YSZ A;  3RC8 A;  5AQV B;  4CI2 B;  4HKA A;  5AQF B;  3SFD A;  4O4I E;  3LDQ B;  4UEM A;  2CRB A;  1SUM B;  3AEE A;  2H88 A;  2ACZ A;  4O4J E;  4EXT A;  2XQ3 A;  3CWZ B;  3AE4 A;  2CLY B;  5AQH B;  1OXZ A;  1ZHC A;  3OKQ A;  5LBQ B;  5HEG A;  4TX5 A;  4GYR A;  2CMR A;  2BKO A;  3AVS A;  2PJQ A;  2C5I T;  5LNK A;  2UXD T;  2EHO A;  5J1G A;  2IC6 A;  2SPC A;  5M4Y A;  3L3P A;  3MK7 C;  4P0B A;  4X20 E;  3GA8 A;  1HTJ F;  4ADZ A;  5EK2 A;  4CXY A;  4FJO A;  3LFM A;  2DNX A;  2YIN A;  4I50 E;  1YKE B;  2XSA A;  4DUY T;  4AQF C;  4YTM A;  4EYU A;  2XY8 B;  2QYW A;  2PBI A;  4AIS A;  4ILA A;  4UR9 A;  2UXX B;  3MXZ A;  1MIY A;  4E7S A;  2CEA A;  4H9Q C;  2XQ8 A;  2RPA A;  3CQG B;  1YKH B;  4DV3 T;  2PFV A;  4MHC A;  2BS3 A;  2A72 A;  2UU9 T;  2UUC T;  3PUZ F;  2XM2 A;  4ZS3 A;  2BG9 A;  2WWV A;  3NRX A;  1SE7 A;  2CM0 A;  4YHH T;  4H9P C;  3FBZ A;  1UUS A;  2LSK A;  4GK5 E;  5IUX A;  3OYZ A;  3W15 B;  4U7Y A;  3EDV A;  1UCU A;  3UQ7 A;  2BKP A;  3C4X A;  2OLT A;  5C3J A;  1Z8U A;  2KMF A;  1Z0P A;  3G06 A;  3RQU A;  1WCR A;  1J5E T;  2CHN A;  3UQ4 A;  2Q9Q A;  4JI1 T;  2PTF A;  5LG4 A;  5LYJ E;  3VKG A;  5JQG E;  3CX7 B;  5TAO A;  2X0Y A;  3AEA A;  2KXP B;  3U78 A;  1FJG T;  5BMV E;  4IL9 A;  1OED E;  1AJ3 A;  4X1Y E;  5FY1 A;  2LLY A;  2BVL A;  3ZT6 A;  3ZC0 A;  4H9N C;  2X68 A;  2VVS A;  2V8S V;  4PK6 A;  4YTP A;  4YFS A;  2H7V C;  2IML A;  2LJL A;  3EHZ A;  2ZM2 A;  1DU2 A;  3RRC A;  2ODV A;  4I4T E;  2LT3 A;  2H7O A;  2C0S A;  2YEV C;  4ZHQ E;  3EAB A;  2CWY A;  4HEA A;  5LCY A;  1UX4 A;  4LF5 T;  3JAE A;  3CML A;  4AQF A;  4WBN E;  3I0O A;  3QNU A;  1ZKE A;  4DV1 T;  3SWH A;  3JAD A;  2ZM8 A;  4KBM B;  2FUP A;  5JVD E;  3AXJ B;  4Q25 A;  5LMN T;  1BR0 A;  3CQX C;  2WMO A;  4GIW A;  1XDO A;  3Q2M A;  2W63 A;  5HWX A;  3AE5 A;  2LHR A;  1YQ4 A;  2CXF A;  5JDQ A;  3SRZ A;  4ZEY A;  4U72 A;  2LM9 A;  5L3C B;  5AQM B;  1ZV4 X;  1J1J A;  4H9R C;  2WCA A;  3UU3 A;  1T8B A;  4QX8 B;  2P9B A;  2YU1 A;  3RH3 A;  3K3Q C;  1OED C;  4V1A v;  2LOP A;  3UFG A;  1ZOY A;  4GYS A;  3AE2 A;  2L8K A;  4AKI A;  3K1S A;  3FXD B;  4CN1 A;  2WY2 A;  3RPU A;  4PJL A;  3EI0 A;  2FJE A;  4KHP T;  3CVR A;  2HH7 A;  5BR8 T;  2C5K T;  5L4E A;  5L3G B;  3I9Y A;  3MA9 A;  2B76 A;  3UU6 A;  3KBU A;  3AEB A;  5AQG B;  4DR2 T;  3Q9D A;  3AVR A;  2YN6 A;  1IJ5 A;  2LKG A;  4OYK A;  4PJM A;  3NVO A;  3OJA A;  3F31 A;  4X1K E;  3ONX A;  1BR1 A;  2VKJ A;  2WU2 A;  3ZEF B;  3P4R A;  1LVK A;  2ZMA A;  2CHO A;  2VKO A;  1HX8 A;  1VRB A;  2BS4 A;  5JDG A;  3BQK A;  4UV8 B;  2BG9 B;  1QLB A;  4P0A A;  4O8S A;  2HHH T;  2BG9 E;  4WBO A;  1IJ6 A;  5L3B B;  5A1L A;  1QUU A;  2UXB T;  2W0G A;  2VK9 A;  4Z8X A;  2CBI A;  3TLW A;  5L2L A;  4QH4 A;  4YTN A;  3K8P C;  1U4Q A;  2WP9 A;  5AQK B;  3CKD A;  3O1H A;  3RRW A;  1KK7 A;  4BJM A;  5AQN B;  2X9X A;  4HWF A;  2HN1 A;  5IYZ E;  5JRE A;  3BQL A;  3LSV A;  4LFB T;  2JQK A;  1IBM T;  1N36 T;  3PU3 A;  5HEO A;  2Q9Q B;  2L3L A;  5C2T A;  4PJJ A;  2MYS A;  2IUB A;  3RLF F;  2D9D A;  5CJ5 A;  2EHO C;  3HI2 A;  2V7L A;  2A9U A;  5HXH A;  3TLS A;  3EDU A;  4AKR B;  1FIO A;  3EUH A;  4YJ2 E;  3AA7 B;  2V1D B;  4X66 T;  1OED A;  3HL6 A;  3AEF A;  4TV8 E;  4U33 A;  2E9X D;  3AA0 B;  4AXP A;  3FZF B;  2X51 A;  4X5T A;  4E7Z A;  2X9Y A;  4ZI3 D;  4DVD A;  1LKX A;  2WS3 A;  3KIN B;  4K0U A;  3WI3 A;  3CIR A;  5JH7 E;  3DTO A;  1J5W A;  4PFO A;  4X65 T;  4IDO A;  2VUR A;  4DR5 T;  1KF6 A;  2RA1 A;  3HA4 A;  4EED A;  1WRD A;  3ZJ2 A;  2K3W A;  4LF4 T;  4OK0 A;  2A3D A;  2KND A;  3TLT A;  4EOZ B;  2ODU A;  5AQT B;  2LSG A;  1HFA A;  3ANW A;  2FBW A;  1W0B A;  3PUA A;  5LMU T;  4KUM B;  4AKG A;  4YXD A;  3ZKR A;  5CA0 E;  4ISS A;  3KVA A;  5LJN A;  4DO0 A;  4CN4 A;  4ZI2 C;  3AB3 B;  3ZYK A;  4IGU A;  4HFC A;  2NTX A;  1M62 A;  4H9S E;  3K3N A;  1VOM A;  4CN6 A;  5ABE A;  4ILU A;  4QHO A;  1XNQ T;  3KV5 A;  4TNW A;  4EEB A;  4EZ4 A;  4NUU A;  4J2C A;  2H3R A;  3MKD A;  4LF9 T;  5C8Y E;  2L9Q A;  1HNX T;  4AI6 A;  2CPT A;  3F2E A;  1JNZ A;  1R8I A;  2NW8 A;  3RC3 A;  5LGT B;  3ZYL A;  5L4H A;  5GON E;  2DWK A;  3TKL B;  2NR4 A;  2BZB A;  2MOZ A;  3QUJ A;  4LML A;  2F4V T;  3CX8 B;  3PUW F;  2V6Y B;  1HG2 A;  3EAM A;  1XZY A;  2YDQ A;  5F8P A;  2E8I A;  4ZOL E;  2LSI A;  4NPP A;  3UUX B;  2XQ7 A;  3T1Y T;  4IRE A;  2DI4 A;  4AQY T;  4JI5 T;  4X64 T;  3H3M A;  4TZ4 C;  4QH5 A;  1IBK T;  5FL0 A;  4EGW A;  4EAH A;  3ZCJ A;  2LRL A;  2LKH A;  3ZST A;  4GKK T;  1QSD A;  5LA6 E;  1G8X A;  3O4X E;  4AKL A;  4YJ3 E;  4U2Z A;  3JC6 D;  4WNK A;  4YSX A;  2NP9 A;  3P4P A;  3HR0 A;  2XSB A;  1LVF A;  2KZ7 B;  4HWI B;  3FZM B;  2JMK A;  2DHR A;  1OWA A;  4ERR A;  2IDO B;  2QVA A;  3N9N A;  4ZS2 A;  5HCM A;  5FL1 A;  3M65 A;  2WDQ A;  4HWH A;  4TN7 B;  1KEY A;  3VRB A;  3E0Z A;  3ONL C;  5KDM C;  2XUE A;  2XQ5 A;  1FMW A;  5AQU B;  3AA6 B;  3M3Z B;  2WAU A;  1UX5 A;  4JEH B;  5JRC A;  2LEH A;  2WU5 A;  3F57 A;  1FEW A;  4HE8 A;  2DLR A;  3ETU A;  2XQ4 A;  5L47 A;  5L3D B;  1G73 A;  3LG7 A;  4UXN B;  4H63 H;  5FP3 A;  5FXW A;  2JQQ A;  2K24 A;  4IE4 A;  1OED B;  2MBG A;  1FMV A;  4TUY E;  2WDR A;  5HXR A;  3KV6 A;  3PUV F;  5LBM A;  2FJB A;  4KHZ F;  4ZI7 E;  2AE9 A;  4G2A A;  5LGU B;  3ZN0 B;  5HCJ A;  4U31 A;  1JNR A;  2E9X A;  5AQJ B;  2V7K A;  3AE3 A;  5JDM A;  4AIU A;  3VKH A;  5JR9 C;  4JI8 T;  4JYA T;  3IHR A;  2I59 A;  3ZMV B;  4BJN A;  5F5W A;  4QXC B;  2D2S A;  4CI3 B;  4XAX B;  2ES0 A;  4L0R A;  3PUR A;  1KNP A;  3AAE B;  5DQV A;  3ZCI A;  1T72 A;  2XQ6 A;  2E5V A;  4UF0 A;  1D1A A;  1GQE A;  4EB6 E;  3C98 B;  1X79 A;  4HWC A;  4NIQ A;  5LOV E;  2LRK A;  5AFU L;  3VR8 A;  2V5C A;  3O1J A;  1WR0 A;  1E7P A;  4BA9 A;  4MBQ A;  3L8R A;  1VCS A;  3A8Y C;  2VL0 A;  2VAS A;  2R6G F;  2GK9 A;  3C51 A;  4AQG A;  4DV6 T;  3MJX A;  2Y8D A;  2PG8 A;  3K3O A;  3S4U A;  4LMJ A;  2Y48 B;  4IT4 A;  5DQW A;  1T98 A;  3O9X A;  3QK6 A;  2V7M A;  2EHO B;  3ZT7 A;  3IBP A;  5DJQ C;  4NXM T;  5LB7 B;  2LE8 A;  3FZL B;  4TWH A;  3P8C D;  3RX6 A;  5LJM A;  1HS7 A;  4JI0 T;  2J47 A;  3RI5 A;  1HX1 B;  4I0U A;  3AAI A;  4LF6 T;  4MAL A;  3AE1 A;  3OBV E;  1N32 T;  4Z90 A;  4M1P A;  3EVY A;  3FB2 A;  2Y6X A;  5EK3 A;  3KV4 A;  3P4S A;  4QX7 B;  2UUA T;  2FJA A;  3AE7 A;  3UFE A;  3OTO T;  3NWI A;  1WLX A;  5ABG A;  2I6H A;  3FBL A;  3NKZ A;  2HN2 A;  4X62 T;  4JI4 T;  3U3I A;  3SS1 A;  5L3E B;  3B13 A;  5F3J A;  3RKG A;  5CA1 E;  5JR9 A;  2VB6 A;  3N9P A;  5J2U E;  1D1B A;  3PV0 F;  3A5X A;  5ABF A;  3I0Q A;  4CQI A;  3TLU A;  4DV2 T;  4XBF B;  5FY7 A;  1UGO A;  4DR3 T;  4PFP A;  4CXW A;  4C91 A;  3R84 B;  2XPK A;  1V9D A;  1YD8 G;  5LHH B;  2CBJ A;  2RP4 A;  3J9X 1;  2N2N A;  1MMG A;  1L0V A;  2XAJ B;  4IDQ A;  4YLH A;  2NWB A;  4QKN A;  4ILB A;  3O1I A;  5H6Q B;  3L09 A;  3RIF A;  3Q5E A;  3DJB A;  2NW9 A;  2JMH A;  1MIW A;  3RHW A;  2WZH A;  3ZPO A;  5LHI B;  3AEG A;  4A5X A;  4OFZ A;  4JI3 T;  3HKC E;  1NEN A;  4U2Y A;  3N5L A;  2DWG A;  3VRA A;  2Q9Q D;  4P1N A;  3PUX F;  2W62 A;  4QXB B;  2KLQ A;  2W00 A;  4WZX A;  2XQ9 A;  5IHY A;  1IZN B;  1UUR A;  3L39 A;  2CE7 A;  4BAY B;  4NUV A;  4UVA B;  1U5P A;  3PDY A;  1CHU A;  3UU4 A;  4A97 A;  2D0T A;  4DMW A;  4HN9 A;  3ZMT B;  3MAC A;  1US7 B;  4DR1 T;  4JV5 T;  3V5S A;  4COF A;  2W61 A;  3NBX X;  2JQH A;  3P4W A;  3UU5 A;  2NOX A;  4PK4 A;  4CXX A;  2VQE T;  5HEJ A;  5J2T E;  4UF0 B;  1D1C A;  2BBJ A;  3UUN A;  1HR0 T;  1HCI A;  5FXV A;  1BR4 A;  4O4L E;  4C90 A;  1CUN A;  2V26 A;  3ZYM A;  4H9O C;  3GMI A;  1N33 T;  4A56 A;  4QH1 A;  5HEU A;  2VKD A;  3WAK A;  3RKO A;  2JIW A;  2JPF A;  4DBR A;  5AQL B;  3VU7 H;  1MMN A;  4KX6 A;  5HAX A;  3ZJ1 A;  2X67 A;  4ASK A;  3E08 A;  4JBW F;  3ZMZ B;  3ZSS A;  4TWD A;  4F6R C;  2XQY A;  2XM1 A;  4UIG A;  3T1H T;  2BDE A;  4L5G A;  4N78 D;  1KNZ A;  3T8O A;  3ABV A;  4EV6 A;  2V7J A;  1YW0 A;  3RQW A;  4JI6 T;  1WFD A;  3ZC1 A;  2IAK A;  4UVC B;  3DP7 A;  5AQO B;  2B1E A;  2BVM A;  2HPJ A;  4DMV A;  3N2G E;  1YQ3 A;  3GN5 A;  5LHG B;  3ZT5 A;  5CFB A;  1SHZ C;  2E9X C;  2YOE A;  3AED A;  3ZN1 B;  3QC9 A;  5JDH A;  2IW5 B;  3N9Q A;  4ZZB A;  3N9O A;  4OHF A;  4IST A;  4HFI A;  3PJA A;  3SFE A;  2W66 A;  4TNV A;  3HKE E;  4ZI3 C;  2A2F X;  2UXC T;  2YKS A;  1IBL T;  2UUB T;  4L9I A;  4U3C A;  2VKH A;  3IA3 A;  2HPL A;  2W4X A;  1HF8 A;  1T7S A;  3PUQ A;  3B57 A;  4QXH B;  2XAQ B;  4IHJ E;  4O2A E;  4ANJ A;  1ZP0 A;  2OV9 A;  4B3M T;  2WSS V;  5FMN A;  2QRX A;  3PUG A;  5LXT E;  5JR9 B;  1D0Z A;  3VR9 A;  2VQF T;  5FVK A;  2AXD S;  3MZK B;  3C4W A;  5LP6 E;  5ABF B;  4GK0 E;  3VHL A;  4IE5 A;  3KV9 A;  2XTL A;  1E1H B;  3AAA B;  1MMA A;  4PW8 A;  3PE0 A;  2QGS A;  3RYF E;  4PK5 A;  4HFE A;  3PTR B;  2MAW A;  5J0Z A;  2VL8 A;  3B5M A;  1XDP A;  3AE8 A;  1XMQ T;  2M67 A;  3CQC B;  4DBQ A;  5DAB A;  3CPZ A;  4DR4 T;  5HEH A;  2K9A A;  5JDF A;  1HNZ T;  2JJ9 A;  5FY0 A;  3LJC A;  2DL1 A;  2KSR A;  4YHJ A;  4JUY A;  2M6B A;  1VCT A;  2WBL A;  4IDP A;  4H63 V;  5KMG P;  3Q5D A;  3OPC A;  1WYC A;  3Q5X A;  5IWA T;  4LF7 T;  2CLY C;  3ZMU B;  2WWU A;  4PNI A;  2LM2 A;  4FI5 A;  4AKH A;  5JDL A;  1NWM X;  4KI0 F;  4YT0 A;  1W9R A;  3Q5W A;  2WB5 A;  4QWN B;  2D0U A;  2J62 A;  1HG5 A;  3RIU C;  5JDN A;  1D0Y A;  1UK5 A;  3R6N A;  3D0T A;  1WR6 A;  3FXE B;  5FKY A;  2NW7 A;  3NZP A;  3RF1 A;  1ZEE A;  3FHN A;  3JC6 C;  2YDR A;  1MND A;  5L3F B;  3C64 A;  2YU2 A;  5AQQ B;  2YK0 A;  5ADX L;  3UUM A;  1HNW T;  1YXR A;  4DV0 T;  1Y01 A;  2CWO A;  2UXN B;  3HKD E;  3P7I A;  4MLK A;  4CZZ B;  3ZLI A;  3OVU A;  3PU8 A;  5AQR B;  3ANW B;  3LBX A;  3I1A A;  2XAF B;  1IAP A;  2WM9 A;  4IE0 A;  1S94 A;  4F8H A;  2Z6E A;  4TV9 E;  3RIA A;  1W0A A;  4LFC T;  3RYI E;  4PJN A;  3JCF A;  3JAF A;  3HKB E;  2ACX A;  4A98 A;  3A7M A;  4LMK A;  3ESL A;  1KFY A;  4WYV A;  4UVB B;  3LK2 B;  2XAH B;  2ZM6 T;  1LRZ A;  3AE9 A;  3NZQ A;  4O4H E;  4HGA A;  3RYC E;  2J1D G;  5ABH A;  2V6X A;  5CGM A;  3TLV A;  2W2U A;  3PUS A;  3GN5 B;  3UUL A;  2NTY A;  2X0H A;  3LK4 2;  3UT5 E;  1M7K A;  5E0O A;  2V7I A;  2CA5 A;  2WDV A;  4JI7 T;  4DR7 T;  5EZY E;  1B7T A;  1H7C A;  2JRK A;  3C4Z A;  5H6R B;  2YDS A;  2K48 A;  1D0X A;  2LOS A;  1BR2 A;  5AQI B;  5ETW A;  4IDZ A;  2ZM0 A;  2EHO D;  4MFR A;  2XAG B;  4B3S T;  3V5U A;  3H37 A;  2WZI A;  1E2A A;  5CB4 E;  3PUY F;  3QB5 K;  4HWD A;  2FJD A;  4GKJ T;  2WMN A;  3P4Q A;  4GOU A;  2KWH A;  3J7Y q;  4IE6 A;  2VVN A;  4NXN T;  5FYM A;  4UEL A;  5AQS B;  2V6Y A;  3N9M A;  4JLE A;  3RIU A;  4EZH A;  2XAS B;  3ZMS B;  3AA1 B;  2MTQ A;  3N2O A;  1MMD A;  2LHN A;  4OYJ A;  5FXZ A;  4JEU B;  3I9W A;  3C50 A;  3N2K E;  3UU8 A;  3X1D A;  4P09 A;  2MPK A;  5HXE A;  4EIW A;  2N1G A;  1NEK A;  1KNR A;  2IC9 A;  4PAG A;  3E22 E;  4I43 B;  2WQY A;  2KIN B;  1NAF A;  5KXJ A;  4B3R T;  5HWY A;  5JRC B;  4XZC A;  2XHE B;  2D5U A;  3AE6 A;  1XWM A;  4G63 A;  5LG3 A;  2G0U A;  3KDS E;  2CXL A;  4DV5 T;  1WYB A;  4DND A;  1O3X A;  3WAJ A;  4HFV A;  3AEC A;  3P50 A;  4U7I A;  3UUB A;  5KX5 E;  3QOF A;  4IIJ E;  2X9W A;  3OYX A;  2LSY A;  2IHR 1;  1SA0 E;  1MNE A;  3RGL A;  5FXX A;  3FZK B;  4JI2 T;  4ZI2 D;  3RYH E;  2DCF A;  2M6I A;  1MIV A;  4WW0 A;  2XJ7 A;  3ONJ A;  2ZLY A;  2H89 A;  2KWI B;  4DID B;  2CXD A;  2W67 A;  2BKN A;  2E9X B;  2N9D A;  4HFB A;  4EYY R;  3FZH B;  1XMO T;  4IDN A;  4KP3 C;  3UTK A;  2E5L T;  4OX9 T;  3IEE A;  3KFW X;  4ZZC A;  4IE7 A;  1XNR T;  1S35 A;  4ILC A;  4KMC A;  4LF8 T;  5LGN B;  1I94 T;  4B3T T;  3KBT A;  1EZ3 A;  4I55 E;  2V5D A;  4B6X A;  4LFA T;  2LSJ A;  1Y64 B;  3PJA J;  4YSY A;  5AQP B;  5JTG A;  2OA5 A;  4IL4 A;  2CCQ A;  2K5B B;  5EK4 A;  2JQ9 A;  3LBX B;  5FNV E; 
#chains in the Genus database with same CATH homology
 2AE9 A;  2XY8 B;  1DU2 A;  1SE7 A;  2AXD S;  2IDO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...