2AECA

Crystal structure of human m340h-beta1,4-galactosyltransferase-i (m340h-b4gal-t1) in complex with glcnac-beta1,2-man-alpha1,6-man-beta-or
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
272
structure length
272
Chain Sequence
LPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGTTRHIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,4-galactosyltransferase 1
publication title Oligosaccharide Preferences of beta1,4-Galactosyltransferase-I: Crystal Structures of Met340His Mutant of Human beta1,4-Galactosyltransferase-I with a Pentasaccharide and Trisaccharides of the N-Glycan Moiety
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 272
sequence length 272
chains with identical sequence B, C
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2005-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
A PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2aecA00
1S4PA 5C1LA 1ZIZA 3I0CA 1ZI5A 4B42A 1VM8A 5CMFX 1G0RA 3V90A 3V0MA 1ZJ2A 1G3LA 2VSIA 2GGOA 3CKQA 3NGWA 2Y6PA 3I0IX 4KPXA 4AYJA 4R7PA 1LZIA 2I5KA 4M4KA 1FG5N 3SXAA 3OGZA 2V0HA 2AM3A 4Y7TA 2PGYA 4HO5A 4J18A 3JTJA 5JQQA 3O3PA 3IOIA 1GA8A 1R7TA 1FGXA 1ZCYA 2MZBA 1LL2A 1H5SD 2OEFA 1QG8A 3ZGGA 3D8VA 4EEAA 3I0GA 1VGUA 2I7BA 4AYLA 4D0TA 4DDZA 1PZYB 2E8BA 1H5RB 3OH4A 5CQPA 3U2XA 1MC3A 2VSHA 5IDTA 2ZU9A 4KC1A 1VH1A 3OC9A 5EIYA 1MP5A 1LZJA 1ZJOA 4B4MA 1E5KA 2JCOA 4B4GA 3PKPA 3Q7UA 3Q80A 2X65A 1R7XA 1ZI4A 2Z87A 1H7EA 1GWWA 3RSBA 3CKOA 2Y4KA 2P73A 3DK5A 2X5ZA 3E25A 4Y64A 4AC3A 3POLA 1W55A 3I0JA 1LL0A 2ICXA 1MP4A 2V0KA 4KNRA 4IRQA 3U0XA 1H4DA 4HG6A 3RMVA 3CKJA 1ZJ3A 4KC4A 1R7UA 1JVGA 1R7YA 2WAWA 2RIYA 4G3QA 4B3UA 3I0HA 4P00A 5FTVA 4KT7A 3U2WA 4B2WA 2WGZA 1OMXA 4EVWA 4MNDA 4M2BA 1HJJA 1IINA 3FOQA 3IOHA 1VICA 1H7GA 3V8YA 2FYDB 2AH9A 4G3PA 4Y6NA 4Y9XA 1JVDA 1INIA 1FR9A 2XMHA 4FRHA 1O7OA 5C49A 1R81A 3CKVA 2X5SA 2D7IA 2OI5A 2Z86A 4EE3A 1VH3A 2WVLA 5C8RA 1YP2A 1Z90A 3I0DA 1VZXA 1ZJ0A 4KXOA 1G2VA 3TQDA 1JYKA 3I0EA 1O7QA 4B2XA 2AECA 1XHBA 1FWYA 4FREA 1WVCA 4FRDA 4C2SA 4M28A 4G87A 1FXOA 2YESA 3SXCA 4AAWA 4EEMA 1TW5A 1H7TA 1EYRA 1ZJPA 3SXDA 1NQIB 1TVYA 4M2AA 4HOCA 5C4CA 3SXEA 1ZDFA 2OEGA 3LW6A 1FGGA 5FV9A 5HS2A 2FFVA 3D5NA 4HO9A 1HV9A 4KC2A 2QGIA 1QGQA 2YC3A 1W77A 3ZGFA 2A8UA 2CU2A 5C3DA 2D0JA 1H5SA 1I52A 2YQCA 1NMMB 2OI6A 2RIZA 3DJ4A 3V91A 1INJA 4FRQA 1GX0A 2XWMA 4KNXA 4NAIA 4CJBA 3T7NA 3PKQA 2GGQA 1G97A 1YP4A 1YROB 1G93A 4KQLA 4BMAA 5L6SA 3USRA 1H7HA 2WE9A 1LVWA 1LZ0A 2RITA 3QVBA 3HL3A 4LW3A 1OMZA 3CU0A 4FROA 1H5TB 2UX8A 2W0VA 3ZLLA 2XWLA 2W0WA 5FU0A 2XWNA 2V0JA 2E3DA 2YQHA 5AJNA 1GQ9A 5AJOA 1H4CA 1H7FA 5FUHA 3OH0A 4IRPA 4D48A 4HCQA 4EE5A 4Y7UA 2BO4A 1VZTA 1EZIA 1NF5B 2V0LA 2RJ0A 1V84A 3V0QA 3JUKA 4HO2A 4FRAA 4JISA 1QWJA 3U2VA 1H7QA 2RJ6A 1FRWA 2PGVA 1HM9A 3ST8A 1V83A 5J49A 5CQLX 1LL3A 3F1YA 3Q4SA 2YQSA 1FXJA 5C36A 2A8WA 1G95A 1ZCVA 4D0ZA 3GUEA 1JV3A 1JYLA 2I5EA 2VS5A 4CJ8A 5C38A 3USQA 4ECMA 1NWGB 2JCJA 4KPZA 2XMEA 1R80A 3R2WA 3ZLKA 4E1KA 4D11A 4FCEA 4ASYA 5L6VA 2NXVA 5I1FA 2FY7A 4Y6UA 3OH3A 2O1HA 3EE5A 4NAKA 3V0PA 1TZFA 2AESA 1ZJ1A 2VS3A 1NHEB 4HO0A 3V0LA 1H7LA 1G1LA 1GX4A 4HO6A 1XZ6A 5C4BA 4EEOA 4GBPA 2APCA 1H5RA 2V0IA 2RIXA 4HO3A 4BQHA 1O0RA 4FCUA 1G8OA 1FOAA 1WT3A 3I0FA 4CJCA 3KIAA 2YQJA 2DPWA 2Q4JA 1KWSA 3K8EA 1G9RA 4NALA 4NANA 5CMIA 4Y7FA 2PX7A 5C48A 3BCVA 3F1CA 5IFYA 5CMHA 2RJ1A 3CKNA 3OH2A 1ZDGA 3BRKX 3K8DA 1HM8A 3I0LA 4KRVA 5C4FA 4ASJA 1TW1A 5AJPA 1FR8A 1G23A 2O1FA 2WVKA 5DDVA 4B4BA 3SXGA 2ZU7A 4FRBA 3PNNA 1VGTA 1IIMA 5EJ1A 5FTSA 3DUVA 1WSZA 2WEEA 5DDTA 1H5SC 2AE7A 2D7RA 4Y63A 3SPTA 4CVHA 4XWIA 4DECA 1GWVA 3OH1A 3RMWA 2PA4A 5C4EA 3D98A 2FYBA 1S4OA 2VS4A 4YS8A 2VFZA 5C4DA 5C3AA 4LW6A 3V0OA 1O23B 4HO4A 5C47A 1WT2A 1LZ7A 1S4NA 3SX7A 1W57A 3IOJA 4FRMA 1ZCUA 4L41C 2AM4A 3E26A 5C1HA 2BO7A 4K6RA 2RJ4A 2P6WA 3T7OA 4Y62A 1ZHJA 2WVMA 3SX3A 5CMJA 2Y4MA 4EEGA 4EE4A 3V0NA 1SS9A 2RJ5A 3OKRA 2ZU8A 4FQWA 2RJ7A 5CQNX 2YC5A 3FWWA 3R3IA 3SX8A 1MP3A 1GQCA 2OI7A 1R82A 1NKHB 1WT0A 3JUJA 1VGZA 4Y7GA 1V82A 2FYAA 2Y7AA 4JD0A 1QGSA 1HJLA 3U2TA 1VZUA 1YP3A 3N9WA 1FO9A 2RJ8A 3T7MA 1H5SB 4HO8A 3I0KA 2VD4A 2QKXA 1H3MA 3CGXA 1WT1A 1JV1A 4G3SA 5FYEA 5EJZA 1OQMB 4ARWA 3SXBA 2YCMA 3SX5A 4B5BA 4D11C 3OAMA 2JCKA 2ICYA 1H4EA 2P72A 5IDSA 4MYBA 1R7VA 2AM5A 2VXLA 5CMGX 2X60A 2RJ9A 2O1GA 2Y4JA 2QH5A 4P02A 5C1GA 2FFUA 1VPAA 3U0YA 5FU8A 2BO6A 2AGDA 1H5TA 1ZI1A 4UEGA 5C3BA 1K4VA 5CQMX 4FRLA 1FO8A 2VXMA 2FYCB 3U2UA 4Y7VA 2JCLA 4ZDQA 3ZF8A 4DE7A 1ON6A 1ON8A 3TZTA 1PZTA 1VGWA 1HM0A 2Y4LA 5BXCA 1ZCTA 1FZWA 3V8ZA 5CQOA 4FRPA 1ZI3A 2BO8A
chains in the Genus database with same CATH superfamily
1S4PA 5C1LA 1ZIZA 3I0CA 1ZI5A 4B42A 1VM8A 5CMFX 1G0RA 3V90A 3V0MA 1ZJ2A 1G3LA 2VSIA 2GGOA 3CKQA 3NGWA 2Y6PA 3I0IX 4KPXA 4AYJA 4R7PA 1LZIA 5D91A 2I5KA 4M4KA 1FG5N 3SXAA 3OGZA 2V0HA 2AM3A 4Y7TA 2PGYA 4HO5A 4J18A 3JTJA 5JQQA 3O3PA 3IOIA 1GA8A 1R7TA 1FGXA 1ZCYA 2MZBA 1LL2A 1H5SD 2OEFA 1QG8A 3ZGGA 3D8VA 4EEAA 3I0GA 1VGUA 2I7BA 4AYLA 4D0TA 4DDZA 1PZYB 2E8BA 1H5RB 3OH4A 5CQPA 3U2XA 1MC3A 2VSHA 5IDTA 2ZU9A 4KC1A 1VH1A 3OC9A 5EIYA 1MP5A 1LZJA 1ZJOA 4B4MA 1E5KA 2JCOA 4B4GA 3PKPA 3Q7UA 3Q80A 2X65A 1R7XA 1ZI4A 2Z87A 1H7EA 1GWWA 3RSBA 3CKOA 2Y4KA 2P73A 3DK5A 2X5ZA 3E25A 4Y64A 4AC3A 3POLA 1W55A 3I0JA 1LL0A 2ICXA 1MP4A 2V0KA 4KNRA 4IRQA 3U0XA 1H4DA 4HG6A 3RMVA 3CKJA 1ZJ3A 4KC4A 1R7UA 1JVGA 1R7YA 2WAWA 2RIYA 4G3QA 4B3UA 3I0HA 4P00A 5FTVA 4KT7A 3U2WA 4B2WA 2WGZA 1OMXA 4EVWA 4MNDA 4M2BA 1HJJA 1IINA 3FOQA 3IOHA 1VICA 1H7GA 3V8YA 2FYDB 2AH9A 4G3PA 4Y6NA 4Y9XA 1JVDA 1INIA 1FR9A 2XMHA 4FRHA 1O7OA 5C49A 1R81A 3CKVA 2X5SA 2D7IA 2OI5A 2Z86A 4EE3A 1VH3A 2WVLA 5C8RA 1YP2A 1Z90A 3I0DA 1VZXA 1ZJ0A 4KXOA 1G2VA 3TQDA 1JYKA 3I0EA 1O7QA 4B2XA 4Q7CA 2AECA 1XHBA 1FWYA 4FREA 1WVCA 4FRDA 4C2SA 4M28A 4G87A 1FXOA 2YESA 3SXCA 4AAWA 4EEMA 1TW5A 1H7TA 1EYRA 1ZJPA 3SXDA 1NQIB 1TVYA 4M2AA 4HOCA 5C4CA 3SXEA 1ZDFA 2OEGA 3LW6A 1FGGA 5FV9A 5HS2A 2FFVA 3D5NA 4HO9A 1HV9A 4KC2A 2QGIA 1QGQA 2YC3A 1W77A 5D92A 2A8UA 2CU2A 3ZGFA 5C3DA 2D0JA 1H5SA 1I52A 2YQCA 1NMMB 2OI6A 2RIZA 3DJ4A 3V91A 1INJA 4FRQA 4MIXA 1GX0A 2XWMA 4KNXA 4NAIA 4CJBA 3T7NA 3PKQA 2GGQA 1G97A 1YP4A 1YROB 1G93A 4KQLA 4BMAA 5L6SA 3USRA 1H7HA 2WE9A 1LVWA 1LZ0A 2RITA 3QVBA 4O6MA 3HL3A 4LW3A 1OMZA 3CU0A 4FROA 1H5TB 2UX8A 2W0VA 3ZLLA 2XWLA 2W0WA 5FU0A 2XWNA 2V0JA 2E3DA 2YQHA 5AJNA 1GQ9A 5AJOA 1H4CA 1H7FA 5FUHA 3OH0A 4IRPA 4D48A 4HCQA 4EE5A 4Y7UA 2BO4A 1VZTA 1EZIA 1NF5B 2V0LA 2RJ0A 1V84A 3V0QA 3JUKA 4HO2A 4FRAA 4JISA 1QWJA 3U2VA 1H7QA 2RJ6A 1FRWA 2PGVA 1HM9A 3ST8A 1V83A 5J49A 5CQLX 1LL3A 3F1YA 3Q4SA 2YQSA 1FXJA 5C36A 2A8WA 1G95A 1ZCVA 4D0ZA 3GUEA 1JV3A 1JYLA 2I5EA 2VS5A 4CJ8A 5C38A 3USQA 4ECMA 1NWGB 2JCJA 4KPZA 2XMEA 1R80A 3R2WA 3ZLKA 4E1KA 4D11A 4FCEA 4ASYA 5L6VA 2NXVA 5I1FA 2FY7A 4Y6UA 3OH3A 2O1HA 3EE5A 4NAKA 3V0PA 1TZFA 2AESA 1ZJ1A 2VS3A 1NHEB 4HO0A 3V0LA 1H7LA 1G1LA 1GX4A 4HO6A 1XZ6A 5C4BA 4EEOA 4GBPA 2APCA 1H5RA 2V0IA 2RIXA 4HO3A 4BQHA 1O0RA 4FCUA 1G8OA 1FOAA 1WT3A 3I0FA 4CJCA 3KIAA 2YQJA 2DPWA 2Q4JA 1KWSA 3K8EA 1G9RA 4NALA 4NANA 5CMIA 4Y7FA 2PX7A 5C48A 3BCVA 3F1CA 4FIXA 5IFYA 5CMHA 2RJ1A 3CKNA 3OH2A 1ZDGA 3BRKX 3K8DA 1HM8A 3I0LA 4KRVA 5C4FA 4ASJA 1TW1A 5AJPA 1FR8A 1G23A 2O1FA 2WVKA 5DDVA 4B4BA 3SXGA 2ZU7A 4FRBA 3PNNA 1VGTA 1IIMA 5EJ1A 5FTSA 3DUVA 1WSZA 2WEEA 5DDTA 1H5SC 2AE7A 2D7RA 4Y63A 3SPTA 4CVHA 4XWIA 4DECA 1GWVA 3OH1A 3RMWA 2PA4A 5C4EA 3D98A 2FYBA 1S4OA 2VS4A 4YS8A 2VFZA 5C4DA 5C3AA 4LW6A 3V0OA 1O23B 4HO4A 5C47A 1WT2A 1LZ7A 1S4NA 3SX7A 1W57A 3IOJA 4FRMA 1ZCUA 4L41C 2AM4A 3E26A 5C1HA 2BO7A 4K6RA 2RJ4A 2P6WA 3T7OA 4Y62A 1ZHJA 2WVMA 3SX3A 5CMJA 2Y4MA 4EEGA 4EE4A 3V0NA 1SS9A 2RJ5A 3OKRA 2ZU8A 4FQWA 2RJ7A 5CQNX 2J0BA 2YC5A 3FWWA 3R3IA 3SX8A 1MP3A 1GQCA 2OI7A 2J0AA 1R82A 1NKHB 1WT0A 3JUJA 1VGZA 4Y7GA 1V82A 2FYAA 4FIYA 4O6NA 2Y7AA 4JD0A 2VK9A 1QGSA 1HJLA 3U2TA 1VZUA 1YP3A 3N9WA 1FO9A 2RJ8A 3T7MA 1H5SB 4HO8A 3I0KA 2VD4A 2QKXA 1H3MA 3CGXA 1WT1A 1JV1A 4G3SA 5FYEA 5EJZA 1OQMB 4ARWA 3SXBA 2YCMA 3SX5A 4B5BA 4D11C 3OAMA 2JCKA 2ICYA 1H4EA 2P72A 5IDSA 4MYBA 1R7VA 2AM5A 2VXLA 5CMGX 2X60A 2RJ9A 2O1GA 2Y4JA 2QH5A 4P02A 5C1GA 2FFUA 1VPAA 3U0YA 5FU8A 2BO6A 2AGDA 1H5TA 1ZI1A 4UEGA 5C3BA 1K4VA 5CQMX 4FRLA 1FO8A 2VXMA 2FYCB 3U2UA 4Y7VA 2JCLA 2C0NA 4ZDQA 3ZF8A 4DE7A 1ON6A 1ON8A 3TZTA 1PZTA 1VGWA 1HM0A 2Y4LA 5BXCA 1ZCTA 1FZWA 3V8ZA 5CQOA 4FRPA 1ZI3A 2BO8A
chains in the Genus database with same CATH topology
1S4PA 5C1LA 1ZIZA 3I0CA 1ZI5A 4B42A 1VM8A 5CMFX 1G0RA 3V90A 3V0MA 1ZJ2A 1G3LA 2VSIA 2GGOA 3CKQA 3NGWA 2Y6PA 3I0IX 4KPXA 4AYJA 4R7PA 1LZIA 5D91A 2I5KA 4M4KA 1FG5N 3SXAA 3OGZA 2V0HA 2AM3A 4Y7TA 2PGYA 4HO5A 4J18A 3JTJA 5JQQA 3O3PA 3IOIA 1GA8A 1R7TA 1FGXA 1ZCYA 2MZBA 1LL2A 1H5SD 2OEFA 1QG8A 3ZGGA 3D8VA 4EEAA 3I0GA 1VGUA 2I7BA 4AYLA 4D0TA 4DDZA 1PZYB 2E8BA 1H5RB 3OH4A 5CQPA 3U2XA 1MC3A 2VSHA 5IDTA 2ZU9A 4KC1A 1VH1A 3OC9A 5EIYA 1MP5A 1LZJA 1ZJOA 4B4MA 1E5KA 2JCOA 4B4GA 3PKPA 3Q7UA 3Q80A 2X65A 1R7XA 1ZI4A 2Z87A 1H7EA 1GWWA 3RSBA 3CKOA 2Y4KA 2P73A 3DK5A 2X5ZA 3E25A 4Y64A 4AC3A 3POLA 1W55A 3I0JA 1LL0A 2ICXA 1MP4A 2V0KA 4KNRA 4IRQA 3U0XA 1H4DA 4HG6A 3RMVA 3CKJA 1ZJ3A 4KC4A 1R7UA 1JVGA 1R7YA 2WAWA 2RIYA 4G3QA 4B3UA 3I0HA 4P00A 5FTVA 4KT7A 3U2WA 4B2WA 2WGZA 1OMXA 4EVWA 4MNDA 4M2BA 1HJJA 1IINA 3FOQA 3IOHA 1VICA 1H7GA 3V8YA 2FYDB 2AH9A 4G3PA 4Y6NA 4Y9XA 1JVDA 1INIA 1FR9A 2XMHA 4FRHA 1O7OA 5C49A 1R81A 3CKVA 2X5SA 2D7IA 2OI5A 2Z86A 4EE3A 1VH3A 2WVLA 5C8RA 1YP2A 1Z90A 3I0DA 1VZXA 1ZJ0A 4KXOA 1G2VA 3TQDA 1JYKA 3I0EA 1O7QA 4B2XA 4Q7CA 2AECA 1XHBA 1FWYA 4FREA 1WVCA 4FRDA 4C2SA 4M28A 4G87A 1FXOA 2YESA 3SXCA 4AAWA 4EEMA 1TW5A 1H7TA 1EYRA 1ZJPA 3SXDA 1NQIB 1TVYA 4M2AA 4HOCA 5C4CA 3SXEA 1ZDFA 2OEGA 3LW6A 1FGGA 5FV9A 5HS2A 2FFVA 3D5NA 4HO9A 1HV9A 4KC2A 2QGIA 1QGQA 2YC3A 1W77A 5D92A 2A8UA 2CU2A 3ZGFA 5C3DA 2D0JA 1H5SA 1I52A 2YQCA 1NMMB 2OI6A 2RIZA 3DJ4A 3V91A 1INJA 4FRQA 4MIXA 1GX0A 2XWMA 4KNXA 4NAIA 4CJBA 3T7NA 3PKQA 2GGQA 1G97A 1YP4A 1YROB 1G93A 4KQLA 4BMAA 5L6SA 3USRA 1H7HA 2WE9A 1LVWA 1LZ0A 2RITA 3QVBA 4O6MA 3HL3A 4LW3A 1OMZA 3CU0A 4FROA 1H5TB 2UX8A 2W0VA 3ZLLA 2XWLA 2W0WA 5FU0A 2XWNA 2V0JA 2E3DA 2YQHA 5AJNA 1GQ9A 5AJOA 1H4CA 1H7FA 5FUHA 3OH0A 4IRPA 4D48A 4HCQA 4EE5A 4Y7UA 2BO4A 1VZTA 1EZIA 1NF5B 2V0LA 2RJ0A 1V84A 3V0QA 3JUKA 4HO2A 4FRAA 4JISA 1QWJA 3U2VA 1H7QA 2RJ6A 1FRWA 2PGVA 1HM9A 3ST8A 1V83A 5J49A 5CQLX 1LL3A 3F1YA 3Q4SA 2YQSA 1FXJA 5C36A 2A8WA 1G95A 1ZCVA 4D0ZA 3GUEA 1JV3A 1JYLA 2I5EA 2VS5A 4CJ8A 5C38A 3USQA 4ECMA 1NWGB 2JCJA 4KPZA 2XMEA 1R80A 3R2WA 3ZLKA 4E1KA 4D11A 4FCEA 4ASYA 5L6VA 2NXVA 5I1FA 2FY7A 4Y6UA 3OH3A 2O1HA 3EE5A 4NAKA 3V0PA 1TZFA 2AESA 1ZJ1A 2VS3A 1NHEB 4HO0A 3V0LA 1H7LA 1G1LA 1GX4A 4HO6A 1XZ6A 5C4BA 4EEOA 4GBPA 2APCA 1H5RA 2V0IA 2RIXA 4HO3A 4BQHA 1O0RA 4FCUA 1G8OA 1FOAA 1WT3A 3I0FA 4CJCA 3KIAA 2YQJA 2DPWA 2Q4JA 1KWSA 3K8EA 1G9RA 4NALA 4NANA 5CMIA 4Y7FA 2PX7A 5C48A 3BCVA 3F1CA 4FIXA 5IFYA 5CMHA 2RJ1A 3CKNA 3OH2A 1ZDGA 3BRKX 3K8DA 1HM8A 3I0LA 4KRVA 5C4FA 4ASJA 1TW1A 5AJPA 1FR8A 1G23A 2O1FA 2WVKA 5DDVA 4B4BA 3SXGA 2ZU7A 4FRBA 3PNNA 1VGTA 1IIMA 5EJ1A 5FTSA 3DUVA 1WSZA 2WEEA 5DDTA 1H5SC 2AE7A 2D7RA 4Y63A 3SPTA 4CVHA 4XWIA 4DECA 1GWVA 3OH1A 3RMWA 2PA4A 5C4EA 3D98A 2FYBA 1S4OA 2VS4A 4YS8A 2VFZA 5C4DA 5C3AA 4LW6A 3V0OA 1O23B 4HO4A 5C47A 1WT2A 1LZ7A 1S4NA 3SX7A 1W57A 3IOJA 4FRMA 1ZCUA 4L41C 2AM4A 3E26A 5C1HA 2BO7A 4K6RA 2RJ4A 2P6WA 3T7OA 4Y62A 1ZHJA 2WVMA 3SX3A 5CMJA 2Y4MA 4EEGA 4EE4A 3V0NA 1SS9A 2RJ5A 3OKRA 2ZU8A 4FQWA 2RJ7A 5CQNX 2J0BA 2YC5A 3FWWA 3R3IA 3SX8A 1MP3A 1GQCA 2OI7A 2J0AA 1R82A 1NKHB 1WT0A 3JUJA 1VGZA 4Y7GA 1V82A 2FYAA 4FIYA 4O6NA 2Y7AA 4JD0A 2VK9A 1QGSA 1HJLA 3U2TA 1VZUA 1YP3A 3N9WA 1FO9A 2RJ8A 3T7MA 1H5SB 4HO8A 3I0KA 2VD4A 2QKXA 1H3MA 3CGXA 1WT1A 1JV1A 4G3SA 5FYEA 5EJZA 1OQMB 4ARWA 3SXBA 2YCMA 3SX5A 4B5BA 4D11C 3OAMA 2JCKA 2ICYA 1H4EA 2P72A 5IDSA 4MYBA 1R7VA 2AM5A 2VXLA 5CMGX 2X60A 2RJ9A 2O1GA 2Y4JA 2QH5A 4P02A 5C1GA 2FFUA 1VPAA 3U0YA 5FU8A 2BO6A 2AGDA 1H5TA 1ZI1A 4UEGA 5C3BA 1K4VA 5CQMX 4FRLA 1FO8A 2VXMA 2FYCB 3U2UA 4Y7VA 2JCLA 2C0NA 4ZDQA 3ZF8A 4DE7A 1ON6A 1ON8A 3TZTA 1PZTA 1VGWA 1HM0A 2Y4LA 5BXCA 1ZCTA 1FZWA 3V8ZA 5CQOA 4FRPA 1ZI3A 2BO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4P A;  5C1L A;  1ZIZ A;  3I0C A;  1ZI5 A;  4B42 A;  1VM8 A;  5CMF X;  1G0R A;  3V90 A;  3V0M A;  1ZJ2 A;  1G3L A;  2VSI A;  2GGO A;  3CKQ A;  3NGW A;  2Y6P A;  3I0I X;  4KPX A;  4AYJ A;  4R7P A;  1LZI A;  2I5K A;  4M4K A;  1FG5 N;  3SXA A;  3OGZ A;  2V0H A;  2AM3 A;  4Y7T A;  2PGY A;  4HO5 A;  4J18 A;  3JTJ A;  5JQQ A;  3O3P A;  3IOI A;  1GA8 A;  1R7T A;  1FGX A;  1ZCY A;  2MZB A;  1LL2 A;  1H5S D;  2OEF A;  1QG8 A;  3ZGG A;  3D8V A;  4EEA A;  3I0G A;  1VGU A;  2I7B A;  4AYL A;  4D0T A;  4DDZ A;  1PZY B;  2E8B A;  1H5R B;  3OH4 A;  5CQP A;  3U2X A;  1MC3 A;  2VSH A;  5IDT A;  2ZU9 A;  4KC1 A;  1VH1 A;  3OC9 A;  5EIY A;  1MP5 A;  1LZJ A;  1ZJO A;  4B4M A;  1E5K A;  2JCO A;  4B4G A;  3PKP A;  3Q7U A;  3Q80 A;  2X65 A;  1R7X A;  1ZI4 A;  2Z87 A;  1H7E A;  1GWW A;  3RSB A;  3CKO A;  2Y4K A;  2P73 A;  3DK5 A;  2X5Z A;  3E25 A;  4Y64 A;  4AC3 A;  3POL A;  1W55 A;  3I0J A;  1LL0 A;  2ICX A;  1MP4 A;  2V0K A;  4KNR A;  4IRQ A;  3U0X A;  1H4D A;  4HG6 A;  3RMV A;  3CKJ A;  1ZJ3 A;  4KC4 A;  1R7U A;  1JVG A;  1R7Y A;  2WAW A;  2RIY A;  4G3Q A;  4B3U A;  3I0H A;  4P00 A;  5FTV A;  4KT7 A;  3U2W A;  4B2W A;  2WGZ A;  1OMX A;  4EVW A;  4MND A;  4M2B A;  1HJJ A;  1IIN A;  3FOQ A;  3IOH A;  1VIC A;  1H7G A;  3V8Y A;  2FYD B;  2AH9 A;  4G3P A;  4Y6N A;  4Y9X A;  1JVD A;  1INI A;  1FR9 A;  2XMH A;  4FRH A;  1O7O A;  5C49 A;  1R81 A;  3CKV A;  2X5S A;  2D7I A;  2OI5 A;  2Z86 A;  4EE3 A;  1VH3 A;  2WVL A;  5C8R A;  1YP2 A;  1Z90 A;  3I0D A;  1VZX A;  1ZJ0 A;  4KXO A;  1G2V A;  3TQD A;  1JYK A;  3I0E A;  1O7Q A;  4B2X A;  2AEC A;  1XHB A;  1FWY A;  4FRE A;  1WVC A;  4FRD A;  4C2S A;  4M28 A;  4G87 A;  1FXO A;  2YES A;  3SXC A;  4AAW A;  4EEM A;  1TW5 A;  1H7T A;  1EYR A;  1ZJP A;  3SXD A;  1NQI B;  1TVY A;  4M2A A;  4HOC A;  5C4C A;  3SXE A;  1ZDF A;  2OEG A;  3LW6 A;  1FGG A;  5FV9 A;  5HS2 A;  2FFV A;  3D5N A;  4HO9 A;  1HV9 A;  4KC2 A;  2QGI A;  1QGQ A;  2YC3 A;  1W77 A;  3ZGF A;  2A8U A;  2CU2 A;  5C3D A;  2D0J A;  1H5S A;  1I52 A;  2YQC A;  1NMM B;  2OI6 A;  2RIZ A;  3DJ4 A;  3V91 A;  1INJ A;  4FRQ A;  1GX0 A;  2XWM A;  4KNX A;  4NAI A;  4CJB A;  3T7N A;  3PKQ A;  2GGQ A;  1G97 A;  1YP4 A;  1YRO B;  1G93 A;  4KQL A;  4BMA A;  5L6S A;  3USR A;  1H7H A;  2WE9 A;  1LVW A;  1LZ0 A;  2RIT A;  3QVB A;  3HL3 A;  4LW3 A;  1OMZ A;  3CU0 A;  4FRO A;  1H5T B;  2UX8 A;  2W0V A;  3ZLL A;  2XWL A;  2W0W A;  5FU0 A;  2XWN A;  2V0J A;  2E3D A;  2YQH A;  5AJN A;  1GQ9 A;  5AJO A;  1H4C A;  1H7F A;  5FUH A;  3OH0 A;  4IRP A;  4D48 A;  4HCQ A;  4EE5 A;  4Y7U A;  2BO4 A;  1VZT A;  1EZI A;  1NF5 B;  2V0L A;  2RJ0 A;  1V84 A;  3V0Q A;  3JUK A;  4HO2 A;  4FRA A;  4JIS A;  1QWJ A;  3U2V A;  1H7Q A;  2RJ6 A;  1FRW A;  2PGV A;  1HM9 A;  3ST8 A;  1V83 A;  5J49 A;  5CQL X;  1LL3 A;  3F1Y A;  3Q4S A;  2YQS A;  1FXJ A;  5C36 A;  2A8W A;  1G95 A;  1ZCV A;  4D0Z A;  3GUE A;  1JV3 A;  1JYL A;  2I5E A;  2VS5 A;  4CJ8 A;  5C38 A;  3USQ A;  4ECM A;  1NWG B;  2JCJ A;  4KPZ A;  2XME A;  1R80 A;  3R2W A;  3ZLK A;  4E1K A;  4D11 A;  4FCE A;  4ASY A;  5L6V A;  2NXV A;  5I1F A;  2FY7 A;  4Y6U A;  3OH3 A;  2O1H A;  3EE5 A;  4NAK A;  3V0P A;  1TZF A;  2AES A;  1ZJ1 A;  2VS3 A;  1NHE B;  4HO0 A;  3V0L A;  1H7L A;  1G1L A;  1GX4 A;  4HO6 A;  1XZ6 A;  5C4B A;  4EEO A;  4GBP A;  2APC A;  1H5R A;  2V0I A;  2RIX A;  4HO3 A;  4BQH A;  1O0R A;  4FCU A;  1G8O A;  1FOA A;  1WT3 A;  3I0F A;  4CJC A;  3KIA A;  2YQJ A;  2DPW A;  2Q4J A;  1KWS A;  3K8E A;  1G9R A;  4NAL A;  4NAN A;  5CMI A;  4Y7F A;  2PX7 A;  5C48 A;  3BCV A;  3F1C A;  5IFY A;  5CMH A;  2RJ1 A;  3CKN A;  3OH2 A;  1ZDG A;  3BRK X;  3K8D A;  1HM8 A;  3I0L A;  4KRV A;  5C4F A;  4ASJ A;  1TW1 A;  5AJP A;  1FR8 A;  1G23 A;  2O1F A;  2WVK A;  5DDV A;  4B4B A;  3SXG A;  2ZU7 A;  4FRB A;  3PNN A;  1VGT A;  1IIM A;  5EJ1 A;  5FTS A;  3DUV A;  1WSZ A;  2WEE A;  5DDT A;  1H5S C;  2AE7 A;  2D7R A;  4Y63 A;  3SPT A;  4CVH A;  4XWI A;  4DEC A;  1GWV A;  3OH1 A;  3RMW A;  2PA4 A;  5C4E A;  3D98 A;  2FYB A;  1S4O A;  2VS4 A;  4YS8 A;  2VFZ A;  5C4D A;  5C3A A;  4LW6 A;  3V0O A;  1O23 B;  4HO4 A;  5C47 A;  1WT2 A;  1LZ7 A;  1S4N A;  3SX7 A;  1W57 A;  3IOJ A;  4FRM A;  1ZCU A;  4L41 C;  2AM4 A;  3E26 A;  5C1H A;  2BO7 A;  4K6R A;  2RJ4 A;  2P6W A;  3T7O A;  4Y62 A;  1ZHJ A;  2WVM A;  3SX3 A;  5CMJ A;  2Y4M A;  4EEG A;  4EE4 A;  3V0N A;  1SS9 A;  2RJ5 A;  3OKR A;  2ZU8 A;  4FQW A;  2RJ7 A;  5CQN X;  2YC5 A;  3FWW A;  3R3I A;  3SX8 A;  1MP3 A;  1GQC A;  2OI7 A;  1R82 A;  1NKH B;  1WT0 A;  3JUJ A;  1VGZ A;  4Y7G A;  1V82 A;  2FYA A;  2Y7A A;  4JD0 A;  1QGS A;  1HJL A;  3U2T A;  1VZU A;  1YP3 A;  3N9W A;  1FO9 A;  2RJ8 A;  3T7M A;  1H5S B;  4HO8 A;  3I0K A;  2VD4 A;  2QKX A;  1H3M A;  3CGX A;  1WT1 A;  1JV1 A;  4G3S A;  5FYE A;  5EJZ A;  1OQM B;  4ARW A;  3SXB A;  2YCM A;  3SX5 A;  4B5B A;  4D11 C;  3OAM A;  2JCK A;  2ICY A;  1H4E A;  2P72 A;  5IDS A;  4MYB A;  1R7V A;  2AM5 A;  2VXL A;  5CMG X;  2X60 A;  2RJ9 A;  2O1G A;  2Y4J A;  2QH5 A;  4P02 A;  5C1G A;  2FFU A;  1VPA A;  3U0Y A;  5FU8 A;  2BO6 A;  2AGD A;  1H5T A;  1ZI1 A;  4UEG A;  5C3B A;  1K4V A;  5CQM X;  4FRL A;  1FO8 A;  2VXM A;  2FYC B;  3U2U A;  4Y7V A;  2JCL A;  4ZDQ A;  3ZF8 A;  4DE7 A;  1ON6 A;  1ON8 A;  3TZT A;  1PZT A;  1VGW A;  1HM0 A;  2Y4L A;  5BXC A;  1ZCT A;  1FZW A;  3V8Z A;  5CQO A;  4FRP A;  1ZI3 A;  2BO8 A; 
#chains in the Genus database with same CATH topology
 1S4P A;  5C1L A;  1ZIZ A;  3I0C A;  1ZI5 A;  4B42 A;  1VM8 A;  5CMF X;  1G0R A;  3V90 A;  3V0M A;  1ZJ2 A;  1G3L A;  2VSI A;  2GGO A;  3CKQ A;  3NGW A;  2Y6P A;  3I0I X;  4KPX A;  4AYJ A;  4R7P A;  1LZI A;  5D91 A;  2I5K A;  4M4K A;  1FG5 N;  3SXA A;  3OGZ A;  2V0H A;  2AM3 A;  4Y7T A;  2PGY A;  4HO5 A;  4J18 A;  3JTJ A;  5JQQ A;  3O3P A;  3IOI A;  1GA8 A;  1R7T A;  1FGX A;  1ZCY A;  2MZB A;  1LL2 A;  1H5S D;  2OEF A;  1QG8 A;  3ZGG A;  3D8V A;  4EEA A;  3I0G A;  1VGU A;  2I7B A;  4AYL A;  4D0T A;  4DDZ A;  1PZY B;  2E8B A;  1H5R B;  3OH4 A;  5CQP A;  3U2X A;  1MC3 A;  2VSH A;  5IDT A;  2ZU9 A;  4KC1 A;  1VH1 A;  3OC9 A;  5EIY A;  1MP5 A;  1LZJ A;  1ZJO A;  4B4M A;  1E5K A;  2JCO A;  4B4G A;  3PKP A;  3Q7U A;  3Q80 A;  2X65 A;  1R7X A;  1ZI4 A;  2Z87 A;  1H7E A;  1GWW A;  3RSB A;  3CKO A;  2Y4K A;  2P73 A;  3DK5 A;  2X5Z A;  3E25 A;  4Y64 A;  4AC3 A;  3POL A;  1W55 A;  3I0J A;  1LL0 A;  2ICX A;  1MP4 A;  2V0K A;  4KNR A;  4IRQ A;  3U0X A;  1H4D A;  4HG6 A;  3RMV A;  3CKJ A;  1ZJ3 A;  4KC4 A;  1R7U A;  1JVG A;  1R7Y A;  2WAW A;  2RIY A;  4G3Q A;  4B3U A;  3I0H A;  4P00 A;  5FTV A;  4KT7 A;  3U2W A;  4B2W A;  2WGZ A;  1OMX A;  4EVW A;  4MND A;  4M2B A;  1HJJ A;  1IIN A;  3FOQ A;  3IOH A;  1VIC A;  1H7G A;  3V8Y A;  2FYD B;  2AH9 A;  4G3P A;  4Y6N A;  4Y9X A;  1JVD A;  1INI A;  1FR9 A;  2XMH A;  4FRH A;  1O7O A;  5C49 A;  1R81 A;  3CKV A;  2X5S A;  2D7I A;  2OI5 A;  2Z86 A;  4EE3 A;  1VH3 A;  2WVL A;  5C8R A;  1YP2 A;  1Z90 A;  3I0D A;  1VZX A;  1ZJ0 A;  4KXO A;  1G2V A;  3TQD A;  1JYK A;  3I0E A;  1O7Q A;  4B2X A;  4Q7C A;  2AEC A;  1XHB A;  1FWY A;  4FRE A;  1WVC A;  4FRD A;  4C2S A;  4M28 A;  4G87 A;  1FXO A;  2YES A;  3SXC A;  4AAW A;  4EEM A;  1TW5 A;  1H7T A;  1EYR A;  1ZJP A;  3SXD A;  1NQI B;  1TVY A;  4M2A A;  4HOC A;  5C4C A;  3SXE A;  1ZDF A;  2OEG A;  3LW6 A;  1FGG A;  5FV9 A;  5HS2 A;  2FFV A;  3D5N A;  4HO9 A;  1HV9 A;  4KC2 A;  2QGI A;  1QGQ A;  2YC3 A;  1W77 A;  5D92 A;  2A8U A;  2CU2 A;  3ZGF A;  5C3D A;  2D0J A;  1H5S A;  1I52 A;  2YQC A;  1NMM B;  2OI6 A;  2RIZ A;  3DJ4 A;  3V91 A;  1INJ A;  4FRQ A;  4MIX A;  1GX0 A;  2XWM A;  4KNX A;  4NAI A;  4CJB A;  3T7N A;  3PKQ A;  2GGQ A;  1G97 A;  1YP4 A;  1YRO B;  1G93 A;  4KQL A;  4BMA A;  5L6S A;  3USR A;  1H7H A;  2WE9 A;  1LVW A;  1LZ0 A;  2RIT A;  3QVB A;  4O6M A;  3HL3 A;  4LW3 A;  1OMZ A;  3CU0 A;  4FRO A;  1H5T B;  2UX8 A;  2W0V A;  3ZLL A;  2XWL A;  2W0W A;  5FU0 A;  2XWN A;  2V0J A;  2E3D A;  2YQH A;  5AJN A;  1GQ9 A;  5AJO A;  1H4C A;  1H7F A;  5FUH A;  3OH0 A;  4IRP A;  4D48 A;  4HCQ A;  4EE5 A;  4Y7U A;  2BO4 A;  1VZT A;  1EZI A;  1NF5 B;  2V0L A;  2RJ0 A;  1V84 A;  3V0Q A;  3JUK A;  4HO2 A;  4FRA A;  4JIS A;  1QWJ A;  3U2V A;  1H7Q A;  2RJ6 A;  1FRW A;  2PGV A;  1HM9 A;  3ST8 A;  1V83 A;  5J49 A;  5CQL X;  1LL3 A;  3F1Y A;  3Q4S A;  2YQS A;  1FXJ A;  5C36 A;  2A8W A;  1G95 A;  1ZCV A;  4D0Z A;  3GUE A;  1JV3 A;  1JYL A;  2I5E A;  2VS5 A;  4CJ8 A;  5C38 A;  3USQ A;  4ECM A;  1NWG B;  2JCJ A;  4KPZ A;  2XME A;  1R80 A;  3R2W A;  3ZLK A;  4E1K A;  4D11 A;  4FCE A;  4ASY A;  5L6V A;  2NXV A;  5I1F A;  2FY7 A;  4Y6U A;  3OH3 A;  2O1H A;  3EE5 A;  4NAK A;  3V0P A;  1TZF A;  2AES A;  1ZJ1 A;  2VS3 A;  1NHE B;  4HO0 A;  3V0L A;  1H7L A;  1G1L A;  1GX4 A;  4HO6 A;  1XZ6 A;  5C4B A;  4EEO A;  4GBP A;  2APC A;  1H5R A;  2V0I A;  2RIX A;  4HO3 A;  4BQH A;  1O0R A;  4FCU A;  1G8O A;  1FOA A;  1WT3 A;  3I0F A;  4CJC A;  3KIA A;  2YQJ A;  2DPW A;  2Q4J A;  1KWS A;  3K8E A;  1G9R A;  4NAL A;  4NAN A;  5CMI A;  4Y7F A;  2PX7 A;  5C48 A;  3BCV A;  3F1C A;  4FIX A;  5IFY A;  5CMH A;  2RJ1 A;  3CKN A;  3OH2 A;  1ZDG A;  3BRK X;  3K8D A;  1HM8 A;  3I0L A;  4KRV A;  5C4F A;  4ASJ A;  1TW1 A;  5AJP A;  1FR8 A;  1G23 A;  2O1F A;  2WVK A;  5DDV A;  4B4B A;  3SXG A;  2ZU7 A;  4FRB A;  3PNN A;  1VGT A;  1IIM A;  5EJ1 A;  5FTS A;  3DUV A;  1WSZ A;  2WEE A;  5DDT A;  1H5S C;  2AE7 A;  2D7R A;  4Y63 A;  3SPT A;  4CVH A;  4XWI A;  4DEC A;  1GWV A;  3OH1 A;  3RMW A;  2PA4 A;  5C4E A;  3D98 A;  2FYB A;  1S4O A;  2VS4 A;  4YS8 A;  2VFZ A;  5C4D A;  5C3A A;  4LW6 A;  3V0O A;  1O23 B;  4HO4 A;  5C47 A;  1WT2 A;  1LZ7 A;  1S4N A;  3SX7 A;  1W57 A;  3IOJ A;  4FRM A;  1ZCU A;  4L41 C;  2AM4 A;  3E26 A;  5C1H A;  2BO7 A;  4K6R A;  2RJ4 A;  2P6W A;  3T7O A;  4Y62 A;  1ZHJ A;  2WVM A;  3SX3 A;  5CMJ A;  2Y4M A;  4EEG A;  4EE4 A;  3V0N A;  1SS9 A;  2RJ5 A;  3OKR A;  2ZU8 A;  4FQW A;  2RJ7 A;  5CQN X;  2J0B A;  2YC5 A;  3FWW A;  3R3I A;  3SX8 A;  1MP3 A;  1GQC A;  2OI7 A;  2J0A A;  1R82 A;  1NKH B;  1WT0 A;  3JUJ A;  1VGZ A;  4Y7G A;  1V82 A;  2FYA A;  4FIY A;  4O6N A;  2Y7A A;  4JD0 A;  2VK9 A;  1QGS A;  1HJL A;  3U2T A;  1VZU A;  1YP3 A;  3N9W A;  1FO9 A;  2RJ8 A;  3T7M A;  1H5S B;  4HO8 A;  3I0K A;  2VD4 A;  2QKX A;  1H3M A;  3CGX A;  1WT1 A;  1JV1 A;  4G3S A;  5FYE A;  5EJZ A;  1OQM B;  4ARW A;  3SXB A;  2YCM A;  3SX5 A;  4B5B A;  4D11 C;  3OAM A;  2JCK A;  2ICY A;  1H4E A;  2P72 A;  5IDS A;  4MYB A;  1R7V A;  2AM5 A;  2VXL A;  5CMG X;  2X60 A;  2RJ9 A;  2O1G A;  2Y4J A;  2QH5 A;  4P02 A;  5C1G A;  2FFU A;  1VPA A;  3U0Y A;  5FU8 A;  2BO6 A;  2AGD A;  1H5T A;  1ZI1 A;  4UEG A;  5C3B A;  1K4V A;  5CQM X;  4FRL A;  1FO8 A;  2VXM A;  2FYC B;  3U2U A;  4Y7V A;  2JCL A;  2C0N A;  4ZDQ A;  3ZF8 A;  4DE7 A;  1ON6 A;  1ON8 A;  3TZT A;  1PZT A;  1VGW A;  1HM0 A;  2Y4L A;  5BXC A;  1ZCT A;  1FZW A;  3V8Z A;  5CQO A;  4FRP A;  1ZI3 A;  2BO8 A; 
#chains in the Genus database with same CATH homology
 1S4P A;  5C1L A;  1ZIZ A;  3I0C A;  1ZI5 A;  4B42 A;  1VM8 A;  5CMF X;  1G0R A;  3V90 A;  3V0M A;  1ZJ2 A;  1G3L A;  2VSI A;  2GGO A;  3CKQ A;  3NGW A;  2Y6P A;  3I0I X;  4KPX A;  4AYJ A;  4R7P A;  1LZI A;  5D91 A;  2I5K A;  4M4K A;  1FG5 N;  3SXA A;  3OGZ A;  2V0H A;  2AM3 A;  4Y7T A;  2PGY A;  4HO5 A;  4J18 A;  3JTJ A;  5JQQ A;  3O3P A;  3IOI A;  1GA8 A;  1R7T A;  1FGX A;  1ZCY A;  2MZB A;  1LL2 A;  1H5S D;  2OEF A;  1QG8 A;  3ZGG A;  3D8V A;  4EEA A;  3I0G A;  1VGU A;  2I7B A;  4AYL A;  4D0T A;  4DDZ A;  1PZY B;  2E8B A;  1H5R B;  3OH4 A;  5CQP A;  3U2X A;  1MC3 A;  2VSH A;  5IDT A;  2ZU9 A;  4KC1 A;  1VH1 A;  3OC9 A;  5EIY A;  1MP5 A;  1LZJ A;  1ZJO A;  4B4M A;  1E5K A;  2JCO A;  4B4G A;  3PKP A;  3Q7U A;  3Q80 A;  2X65 A;  1R7X A;  1ZI4 A;  2Z87 A;  1H7E A;  1GWW A;  3RSB A;  3CKO A;  2Y4K A;  2P73 A;  3DK5 A;  2X5Z A;  3E25 A;  4Y64 A;  4AC3 A;  3POL A;  1W55 A;  3I0J A;  1LL0 A;  2ICX A;  1MP4 A;  2V0K A;  4KNR A;  4IRQ A;  3U0X A;  1H4D A;  4HG6 A;  3RMV A;  3CKJ A;  1ZJ3 A;  4KC4 A;  1R7U A;  1JVG A;  1R7Y A;  2WAW A;  2RIY A;  4G3Q A;  4B3U A;  3I0H A;  4P00 A;  5FTV A;  4KT7 A;  3U2W A;  4B2W A;  2WGZ A;  1OMX A;  4EVW A;  4MND A;  4M2B A;  1HJJ A;  1IIN A;  3FOQ A;  3IOH A;  1VIC A;  1H7G A;  3V8Y A;  2FYD B;  2AH9 A;  4G3P A;  4Y6N A;  4Y9X A;  1JVD A;  1INI A;  1FR9 A;  2XMH A;  4FRH A;  1O7O A;  5C49 A;  1R81 A;  3CKV A;  2X5S A;  2D7I A;  2OI5 A;  2Z86 A;  4EE3 A;  1VH3 A;  2WVL A;  5C8R A;  1YP2 A;  1Z90 A;  3I0D A;  1VZX A;  1ZJ0 A;  4KXO A;  1G2V A;  3TQD A;  1JYK A;  3I0E A;  1O7Q A;  4B2X A;  4Q7C A;  2AEC A;  1XHB A;  1FWY A;  4FRE A;  1WVC A;  4FRD A;  4C2S A;  4M28 A;  4G87 A;  1FXO A;  2YES A;  3SXC A;  4AAW A;  4EEM A;  1TW5 A;  1H7T A;  1EYR A;  1ZJP A;  3SXD A;  1NQI B;  1TVY A;  4M2A A;  4HOC A;  5C4C A;  3SXE A;  1ZDF A;  2OEG A;  3LW6 A;  1FGG A;  5FV9 A;  5HS2 A;  2FFV A;  3D5N A;  4HO9 A;  1HV9 A;  4KC2 A;  2QGI A;  1QGQ A;  2YC3 A;  1W77 A;  5D92 A;  2A8U A;  2CU2 A;  3ZGF A;  5C3D A;  2D0J A;  1H5S A;  1I52 A;  2YQC A;  1NMM B;  2OI6 A;  2RIZ A;  3DJ4 A;  3V91 A;  1INJ A;  4FRQ A;  4MIX A;  1GX0 A;  2XWM A;  4KNX A;  4NAI A;  4CJB A;  3T7N A;  3PKQ A;  2GGQ A;  1G97 A;  1YP4 A;  1YRO B;  1G93 A;  4KQL A;  4BMA A;  5L6S A;  3USR A;  1H7H A;  2WE9 A;  1LVW A;  1LZ0 A;  2RIT A;  3QVB A;  4O6M A;  3HL3 A;  4LW3 A;  1OMZ A;  3CU0 A;  4FRO A;  1H5T B;  2UX8 A;  2W0V A;  3ZLL A;  2XWL A;  2W0W A;  5FU0 A;  2XWN A;  2V0J A;  2E3D A;  2YQH A;  5AJN A;  1GQ9 A;  5AJO A;  1H4C A;  1H7F A;  5FUH A;  3OH0 A;  4IRP A;  4D48 A;  4HCQ A;  4EE5 A;  4Y7U A;  2BO4 A;  1VZT A;  1EZI A;  1NF5 B;  2V0L A;  2RJ0 A;  1V84 A;  3V0Q A;  3JUK A;  4HO2 A;  4FRA A;  4JIS A;  1QWJ A;  3U2V A;  1H7Q A;  2RJ6 A;  1FRW A;  2PGV A;  1HM9 A;  3ST8 A;  1V83 A;  5J49 A;  5CQL X;  1LL3 A;  3F1Y A;  3Q4S A;  2YQS A;  1FXJ A;  5C36 A;  2A8W A;  1G95 A;  1ZCV A;  4D0Z A;  3GUE A;  1JV3 A;  1JYL A;  2I5E A;  2VS5 A;  4CJ8 A;  5C38 A;  3USQ A;  4ECM A;  1NWG B;  2JCJ A;  4KPZ A;  2XME A;  1R80 A;  3R2W A;  3ZLK A;  4E1K A;  4D11 A;  4FCE A;  4ASY A;  5L6V A;  2NXV A;  5I1F A;  2FY7 A;  4Y6U A;  3OH3 A;  2O1H A;  3EE5 A;  4NAK A;  3V0P A;  1TZF A;  2AES A;  1ZJ1 A;  2VS3 A;  1NHE B;  4HO0 A;  3V0L A;  1H7L A;  1G1L A;  1GX4 A;  4HO6 A;  1XZ6 A;  5C4B A;  4EEO A;  4GBP A;  2APC A;  1H5R A;  2V0I A;  2RIX A;  4HO3 A;  4BQH A;  1O0R A;  4FCU A;  1G8O A;  1FOA A;  1WT3 A;  3I0F A;  4CJC A;  3KIA A;  2YQJ A;  2DPW A;  2Q4J A;  1KWS A;  3K8E A;  1G9R A;  4NAL A;  4NAN A;  5CMI A;  4Y7F A;  2PX7 A;  5C48 A;  3BCV A;  3F1C A;  4FIX A;  5IFY A;  5CMH A;  2RJ1 A;  3CKN A;  3OH2 A;  1ZDG A;  3BRK X;  3K8D A;  1HM8 A;  3I0L A;  4KRV A;  5C4F A;  4ASJ A;  1TW1 A;  5AJP A;  1FR8 A;  1G23 A;  2O1F A;  2WVK A;  5DDV A;  4B4B A;  3SXG A;  2ZU7 A;  4FRB A;  3PNN A;  1VGT A;  1IIM A;  5EJ1 A;  5FTS A;  3DUV A;  1WSZ A;  2WEE A;  5DDT A;  1H5S C;  2AE7 A;  2D7R A;  4Y63 A;  3SPT A;  4CVH A;  4XWI A;  4DEC A;  1GWV A;  3OH1 A;  3RMW A;  2PA4 A;  5C4E A;  3D98 A;  2FYB A;  1S4O A;  2VS4 A;  4YS8 A;  2VFZ A;  5C4D A;  5C3A A;  4LW6 A;  3V0O A;  1O23 B;  4HO4 A;  5C47 A;  1WT2 A;  1LZ7 A;  1S4N A;  3SX7 A;  1W57 A;  3IOJ A;  4FRM A;  1ZCU A;  4L41 C;  2AM4 A;  3E26 A;  5C1H A;  2BO7 A;  4K6R A;  2RJ4 A;  2P6W A;  3T7O A;  4Y62 A;  1ZHJ A;  2WVM A;  3SX3 A;  5CMJ A;  2Y4M A;  4EEG A;  4EE4 A;  3V0N A;  1SS9 A;  2RJ5 A;  3OKR A;  2ZU8 A;  4FQW A;  2RJ7 A;  5CQN X;  2J0B A;  2YC5 A;  3FWW A;  3R3I A;  3SX8 A;  1MP3 A;  1GQC A;  2OI7 A;  2J0A A;  1R82 A;  1NKH B;  1WT0 A;  3JUJ A;  1VGZ A;  4Y7G A;  1V82 A;  2FYA A;  4FIY A;  4O6N A;  2Y7A A;  4JD0 A;  2VK9 A;  1QGS A;  1HJL A;  3U2T A;  1VZU A;  1YP3 A;  3N9W A;  1FO9 A;  2RJ8 A;  3T7M A;  1H5S B;  4HO8 A;  3I0K A;  2VD4 A;  2QKX A;  1H3M A;  3CGX A;  1WT1 A;  1JV1 A;  4G3S A;  5FYE A;  5EJZ A;  1OQM B;  4ARW A;  3SXB A;  2YCM A;  3SX5 A;  4B5B A;  4D11 C;  3OAM A;  2JCK A;  2ICY A;  1H4E A;  2P72 A;  5IDS A;  4MYB A;  1R7V A;  2AM5 A;  2VXL A;  5CMG X;  2X60 A;  2RJ9 A;  2O1G A;  2Y4J A;  2QH5 A;  4P02 A;  5C1G A;  2FFU A;  1VPA A;  3U0Y A;  5FU8 A;  2BO6 A;  2AGD A;  1H5T A;  1ZI1 A;  4UEG A;  5C3B A;  1K4V A;  5CQM X;  4FRL A;  1FO8 A;  2VXM A;  2FYC B;  3U2U A;  4Y7V A;  2JCL A;  2C0N A;  4ZDQ A;  3ZF8 A;  4DE7 A;  1ON6 A;  1ON8 A;  3TZT A;  1PZT A;  1VGW A;  1HM0 A;  2Y4L A;  5BXC A;  1ZCT A;  1FZW A;  3V8Z A;  5CQO A;  4FRP A;  1ZI3 A;  2BO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...