2AECA

Crystal structure of human m340h-beta1,4-galactosyltransferase-i (m340h-b4gal-t1) in complex with glcnac-beta1,2-man-alpha1,6-man-beta-or
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
272
structure length
272
Chain Sequence
LPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGTTRHIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oligosaccharide Preferences of beta1,4-Galactosyltransferase-I: Crystal Structures of Met340His Mutant of Human beta1,4-Galactosyltransferase-I with a Pentasaccharide and Trisaccharides of the N-Glycan Moiety
pubmed doi rcsb
molecule keywords Beta-1,4-galactosyltransferase 1
molecule tags Transferase
source organism Homo sapiens
total genus 89
structure length 272
sequence length 272
chains with identical sequence B, C
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2005-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
A PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2aecA00
5IFYA 1VM8A 5IDSA 2Y4LA 3BRKX 4KT7A 1EYRA 3FWWA 3Q7UA 1LL3A 4AAWA 5CQLX 2BO8A 1FO8A 4Y7TA 1VH3A 4KPZA 1IIMA 4HO5A 3ST8A 3U2VA 5AJNA 4M2AA 5L6SA 1ZDGA 2Y4KA 3BCVA 1TVYA 1OQMB 1R80A 4AC3A 5AJPA 4HO9A 3CU0A 5J49A 3ZGGA 3I0GA 2Y7AA 4FRQA 1MP5A 1W77A 3SPTA 3POLA 5IDTA 4HO8A 2Y4MA 1VGTA 3E25A 1JYKA 1FG5N 4KPXA 4G3PA 3I0DA 3ZLKA 2PX7A 3FOQA 1ZI4A 3IOJA 2AGDA 3CKOA 4KNXA 2WEEA 1ZJ1A 5C3DA 5C8RA 4XWIA 5C1HA 2VXMA 4D48A 2JCLA 2RIYA 2X5ZA 2AM3A 1V84A 2WVKA 2VS5A 1HM8A 4B5BA 1XZ6A 1JV3A 3OH2A 1VPAA 5CQNX 4Y6UA 4CJBA 2WVLA 2OI6A 1ZCVA 4KRVA 3SXAA 1ZCTA 2W0VA 2X65A 3USRA 3IOIA 4MYBA 1PZTA 2ZU7A 3SXEA 1H7LA 4DE7A 5FV9A 4B2XA 1WT0A 1LL2A 2D7RA 1V82A 2QKXA 3JUJA 3DJ4A 5C4CA 2BO7A 4LW3A 2BO6A 5CMGX 5C47A 4EE3A 3PKPA 5C3BA 2V0IA 4KC4A 3V0NA 5EJ1A 4G87A 4FREA 3DUVA 2YQCA 1O0RA 1GQCA 2D0JA 3V90A 4EEAA 2RJ8A 3F1YA 5C3AA 4IRQA 4HO2A 3T7NA 3TZTA 4KXOA 4KNRA 1R7TA 4LW6A 1QG8A 1G97A 4Y63A 1YP3A 1GA8A 5EJZA 4G3SA 1GX0A 2NXVA 5DDTA 4FQWA 4M2BA 1ZI5A 1FXOA 2WE9A 4FCUA 4Y7GA 3LW6A 2P6WA 2BO4A 2UX8A 1INIA 2ICYA 1H7FA 4FCEA 3E26A 1TZFA 2RJ9A 2DPWA 3OH4A 4AYLA 1G95A 1XHBA 2X60A 1ZCUA 1LZ7A 4D0ZA 3ZLLA 1ZIZA 1LVWA 1R81A 4FRBA 4DDZA 2OEFA 3SXGA 5C38A 3CGXA 2AECA 3HL3A 4BMAA 1H5RB 4Y7VA 1ZJ3A 3USQA 4JISA 3KIAA 1H7HA 1H4CA 1LZ0A 2VSIA 5I1FA 5L6VA 4B4MA 3EE5A 2VXLA 1YP2A 1NMMB 3QVBA 3V8YA 1H3MA 5EIYA 3Q80A 3U0YA 4HO4A 5C49A 3V0PA 1ZJ2A 1FGGA 1TW1A 1ZI1A 2YQJA 3IOHA 4IRPA 5AJOA 3PKQA 3F1CA 2WVMA 3SX8A 4CJCA 2FYBA 2Y4JA 5HS2A 2E3DA 2GGQA 2XMHA 3OH3A 1NF5B 3SX5A 2MZBA 5JQQA 5FTSA 4NANA 2V0KA 3JUKA 4DECA 4EEMA 1G8OA 2RJ0A 1GX4A 1ON6A 4CJ8A 2GGOA 4BQHA 1WSZA 1S4PA 2FYDB 2RIXA 2YC3A 4Y62A 5CMIA 2VS3A 3PNNA 1VZTA 2O1FA 3SXBA 1YROB 1V83A 2ICXA 1PZYB 1H5SB 1H4EA 4ECMA 4KQLA 3I0EA 4G3QA 3I0IX 4FRPA 4FRDA 2D7IA 1TW5A 4ZDQA 2YQSA 3U2WA 3CKNA 4GBPA 1VGZA 1WT1A 4NAIA 1W57A 3V8ZA 5CMJA 1O7QA 2RJ5A 3Q4SA 3TQDA 1NHEB 5FU0A 3U2TA 3SXCA 3V0LA 1QWJA 4EE5A 2WAWA 3V0QA 1VICA 3OAMA 1W55A 3I0KA 1WT3A 1S4OA 2I5EA 1HM9A 3DK5A 4K6RA 2ZU9A 2RJ7A 1R7XA 1ZJ0A 3O3PA 3U2UA 2JCKA 1LZIA 1FGXA 4EVWA 5FU8A 1R7UA 2WGZA 5C36A 1FRWA 1JVGA 2V0LA 2W0WA 4HO0A 1OMZA 4D11C 1H5SD 5C4BA 4FRAA 2PGVA 2YC5A 2FFUA 1Z90A 1NQIB 4Y9XA 1H7QA 2YCMA 1GWWA 1GQ9A 4J18A 2FYAA 4B4BA 1HJLA 1HJJA 2A8UA 3I0CA 5C1GA 3R2WA 3T7OA 4FRLA 3ZF8A 1EZIA 2P72A 1R82A 1H5TA 1G0RA 2CU2A 1NKHB 1ZHJA 5CMHA 4HO6A 2XWLA 2VSHA 3N9WA 4M4KA 3D8VA 2P73A 4YS8A 4AYJA 4HG6A 4KC1A 2X5SA 4HO3A 4EEOA 2Z86A 4FRHA 2JCOA 1ZDFA 3V0OA 5CQOA 4P00A 1ZJPA 4B3UA 1SS9A 1K4VA 4NALA 2AE7A 1MP4A 3CKJA 1WT2A 3SX7A 1LL0A 1VGUA 2PGYA 4EE4A 3I0JA 3OC9A 1YP4A 2V0JA 3U2XA 4B2WA 1ON8A 3RMVA 2O1GA 5FUHA 4NAKA 3RSBA 1FWYA 3K8DA 1VZUA 2Z87A 3SX3A 4E1KA 3R3IA 4MNDA 3NGWA 4L41C 2RIZA 3ZGFA 4D11A 2QH5A 2Q4JA 1FZWA 4B4GA 1G23A 5C48A 2RJ4A 1MC3A 2I7BA 3CKQA 1E5KA 1O7OA 3D98A 3JTJA 5FYEA 5FTVA 2XWNA 1VZXA 2APCA 3RMWA 4Y64A 1QGSA 3U0XA 1R7YA 4Y7UA 4Y7FA 1H5SA 2AESA 3K8EA 3GUEA 4HCQA 1FR9A 2E8BA 2VS4A 1JV1A 4R7PA 4B42A 2RJ6A 3I0LA 2JCJA 4KC2A 1G9RA 2OI7A 2VD4A 5CQMX 3I0FA 1FR8A 2I5KA 1FXJA 1H4DA 5DDVA 1FOAA 2XWMA 2AM4A 4HOCA 4JD0A 3OKRA 1H7EA 4D0TA 4M28A 1JYLA 1INJA 2OEGA 2PA4A 4P02A 4CVHA 1NWGB 1VH1A 5CMFX 2A8WA 1O23B 2AH9A 5CQPA 1S4NA 3I0HA 1JVDA 1QGQA 4ASJA 3V0MA 2V0HA 4FRMA 1LZJA 4ARWA 4EEGA 2Y6PA 2FY7A 1FO9A 1GWVA 3SXDA 3OH0A 1WVCA 2O1HA 4FROA 2QGIA 1H7GA 2YQHA 3OGZA 2YESA 2VFZA 2AM5A 2RITA 3T7MA 1OMXA 5C1LA 5C4EA 1HV9A 1ZCYA 3OH1A 3V91A 1H5SC 2RJ1A 1KWSA 5BXCA 1H7TA 4UEGA 1G1LA 1I52A 2OI5A 4Y6NA 1HM0A 1VGWA 5C4DA 1ZJOA 2XMEA 1G2VA 1H5TB 3CKVA 4C2SA 2ZU8A 2FFVA 4ASYA 5C4FA 1IINA 1H5RA 1MP3A 2FYCB 1ZI3A 1R7VA 1G93A 3D5NA 1G3LA
chains in the Genus database with same CATH superfamily
5IFYA 1VM8A 5IDSA 2Y4LA 3BRKX 4KT7A 1EYRA 3FWWA 3Q7UA 1LL3A 4AAWA 5CQLX 2BO8A 1FO8A 4Y7TA 1VH3A 4KPZA 1IIMA 4HO5A 3ST8A 3U2VA 5D91A 5AJNA 4M2AA 5L6SA 1ZDGA 2Y4KA 3BCVA 1TVYA 1OQMB 1R80A 4AC3A 5AJPA 4HO9A 3CU0A 5J49A 4O6MA 3I0GA 3ZGGA 2Y7AA 4FRQA 1MP5A 1W77A 3SPTA 3POLA 5IDTA 4HO8A 2Y4MA 1VGTA 3E25A 1JYKA 1FG5N 4KPXA 4G3PA 3I0DA 3ZLKA 2PX7A 3FOQA 1ZI4A 3IOJA 2AGDA 3CKOA 4KNXA 2WEEA 1ZJ1A 5C3DA 5C8RA 4XWIA 5C1HA 2VXMA 4D48A 2JCLA 2RIYA 2X5ZA 2AM3A 1V84A 2WVKA 2VS5A 1HM8A 4B5BA 1XZ6A 1JV3A 3OH2A 1VPAA 5CQNX 4Y6UA 4CJBA 2C0NA 2WVLA 2OI6A 1ZCVA 4KRVA 3SXAA 1ZCTA 2W0VA 2X65A 3USRA 3IOIA 4MYBA 1PZTA 2ZU7A 3SXEA 1H7LA 4DE7A 5FV9A 4B2XA 1WT0A 1LL2A 2D7RA 1V82A 2QKXA 3JUJA 3DJ4A 5C4CA 2BO7A 4LW3A 2BO6A 5CMGX 5C47A 4EE3A 3PKPA 5C3BA 2V0IA 4KC4A 3V0NA 5EJ1A 4G87A 4FREA 3DUVA 2YQCA 1O0RA 1GQCA 2D0JA 3V90A 4EEAA 2RJ8A 3F1YA 5C3AA 4IRQA 4HO2A 3T7NA 3TZTA 4KXOA 4KNRA 1R7TA 4LW6A 1QG8A 1G97A 4Y63A 1YP3A 1GA8A 5EJZA 4G3SA 1GX0A 2NXVA 5DDTA 4FQWA 4M2BA 4Q7CA 1ZI5A 1FXOA 2WE9A 4FCUA 4Y7GA 3LW6A 2P6WA 2BO4A 2UX8A 1INIA 2ICYA 1H7FA 4FCEA 3E26A 1TZFA 2RJ9A 2DPWA 3OH4A 4AYLA 4O6NA 1G95A 1XHBA 2X60A 1ZCUA 1LZ7A 4D0ZA 3ZLLA 1ZIZA 1LVWA 1R81A 4FRBA 4DDZA 2OEFA 3SXGA 5C38A 3CGXA 2AECA 3HL3A 4BMAA 1H5RB 4Y7VA 1ZJ3A 3USQA 4JISA 3KIAA 1H7HA 1H4CA 1LZ0A 2VSIA 5I1FA 5L6VA 4B4MA 3EE5A 2VXLA 1YP2A 1NMMB 3QVBA 3V8YA 1H3MA 5EIYA 3Q80A 3U0YA 4HO4A 5C49A 3V0PA 1ZJ2A 1FGGA 1TW1A 1ZI1A 2YQJA 3IOHA 4IRPA 5AJOA 3PKQA 3F1CA 2WVMA 3SX8A 4CJCA 2FYBA 2Y4JA 5HS2A 2E3DA 2GGQA 2XMHA 3OH3A 1NF5B 3SX5A 2MZBA 5JQQA 5FTSA 4NANA 2V0KA 3JUKA 4DECA 4EEMA 1G8OA 2RJ0A 1GX4A 1ON6A 4CJ8A 2GGOA 4BQHA 1WSZA 1S4PA 2FYDB 2RIXA 2YC3A 4Y62A 5CMIA 2VS3A 3PNNA 1VZTA 2O1FA 3SXBA 1YROB 1V83A 2ICXA 1PZYB 1H5SB 2J0AA 1H4EA 4ECMA 4KQLA 3I0EA 4G3QA 3I0IX 4FRPA 4FRDA 2D7IA 1TW5A 4ZDQA 2YQSA 3U2WA 3CKNA 4GBPA 1VGZA 1WT1A 4NAIA 1W57A 3V8ZA 5CMJA 1O7QA 2RJ5A 3Q4SA 3TQDA 1NHEB 5FU0A 3U2TA 3SXCA 3V0LA 1QWJA 4EE5A 2WAWA 3V0QA 1VICA 3OAMA 1W55A 3I0KA 1WT3A 1S4OA 2I5EA 1HM9A 3DK5A 4K6RA 2ZU9A 2RJ7A 1R7XA 1ZJ0A 3O3PA 3U2UA 2JCKA 1LZIA 1FGXA 4EVWA 5FU8A 1R7UA 2WGZA 5C36A 1FRWA 1JVGA 2V0LA 2W0WA 4HO0A 1OMZA 4FIXA 4D11C 1H5SD 5C4BA 4FRAA 2PGVA 2YC5A 2FFUA 1Z90A 1NQIB 4Y9XA 1H7QA 2YCMA 1GWWA 1GQ9A 4J18A 2FYAA 4B4BA 1HJLA 1HJJA 2A8UA 3I0CA 5C1GA 3R2WA 3T7OA 4FRLA 3ZF8A 1EZIA 2P72A 1R82A 1H5TA 1G0RA 2CU2A 1NKHB 1ZHJA 5CMHA 4HO6A 2XWLA 2VSHA 3N9WA 4M4KA 3D8VA 2P73A 4YS8A 4AYJA 4HG6A 4KC1A 2X5SA 4HO3A 4EEOA 2Z86A 4FRHA 2JCOA 1ZDFA 3V0OA 5CQOA 4P00A 1ZJPA 4B3UA 1SS9A 1K4VA 4NALA 2AE7A 1MP4A 3CKJA 1WT2A 3SX7A 1LL0A 1VGUA 2PGYA 4EE4A 3I0JA 3OC9A 1YP4A 2V0JA 3U2XA 4B2WA 1ON8A 3RMVA 2O1GA 5FUHA 4FIYA 4NAKA 3RSBA 1FWYA 3K8DA 1VZUA 2Z87A 3SX3A 4E1KA 3R3IA 4MNDA 3NGWA 4L41C 2RIZA 3ZGFA 4D11A 2QH5A 2Q4JA 1FZWA 4B4GA 1G23A 5C48A 2RJ4A 1MC3A 2I7BA 3CKQA 1E5KA 1O7OA 3D98A 3JTJA 5FYEA 5FTVA 4MIXA 2XWNA 1VZXA 2APCA 3RMWA 4Y64A 1QGSA 3U0XA 1R7YA 4Y7UA 4Y7FA 1H5SA 2AESA 3K8EA 3GUEA 4HCQA 1FR9A 2E8BA 2VS4A 1JV1A 4R7PA 4B42A 2RJ6A 3I0LA 2JCJA 4KC2A 2VK9A 1G9RA 2OI7A 2VD4A 5CQMX 3I0FA 1FR8A 2J0BA 2I5KA 1FXJA 1H4DA 5DDVA 1FOAA 2XWMA 2AM4A 4HOCA 4JD0A 3OKRA 1H7EA 4D0TA 4M28A 1JYLA 1INJA 2OEGA 2PA4A 4P02A 4CVHA 1NWGB 1VH1A 5CMFX 2A8WA 1O23B 2AH9A 5CQPA 1S4NA 3I0HA 1JVDA 1QGQA 4ASJA 3V0MA 2V0HA 4FRMA 1LZJA 4ARWA 4EEGA 2Y6PA 2FY7A 1FO9A 1GWVA 3SXDA 3OH0A 1WVCA 2O1HA 4FROA 2QGIA 1H7GA 2YQHA 3OGZA 2YESA 2VFZA 2AM5A 2RITA 3T7MA 1OMXA 5C1LA 5C4EA 1HV9A 1ZCYA 3OH1A 3V91A 1H5SC 2RJ1A 1KWSA 5BXCA 1H7TA 4UEGA 1G1LA 1I52A 2OI5A 4Y6NA 1HM0A 1VGWA 5C4DA 1ZJOA 2XMEA 1G2VA 1H5TB 3CKVA 5D92A 2ZU8A 4C2SA 2FFVA 4ASYA 5C4FA 1IINA 1H5RA 1MP3A 2FYCB 1ZI3A 1R7VA 1G93A 3D5NA 1G3LA
chains in the Genus database with same CATH topology
5IFYA 1VM8A 5IDSA 2Y4LA 3BRKX 4KT7A 1EYRA 3FWWA 3Q7UA 1LL3A 4AAWA 5CQLX 2BO8A 1FO8A 4Y7TA 1VH3A 4KPZA 1IIMA 4HO5A 3ST8A 3U2VA 5D91A 5AJNA 4M2AA 5L6SA 1ZDGA 2Y4KA 3BCVA 1TVYA 1OQMB 1R80A 4AC3A 5AJPA 4HO9A 3CU0A 5J49A 4O6MA 3I0GA 3ZGGA 2Y7AA 4FRQA 1MP5A 1W77A 3SPTA 3POLA 5IDTA 4HO8A 2Y4MA 1VGTA 3E25A 1JYKA 1FG5N 4KPXA 4G3PA 3I0DA 3ZLKA 2PX7A 3FOQA 1ZI4A 3IOJA 2AGDA 3CKOA 4KNXA 2WEEA 1ZJ1A 5C3DA 5C8RA 4XWIA 5C1HA 2VXMA 4D48A 2JCLA 2RIYA 2X5ZA 2AM3A 1V84A 2WVKA 2VS5A 1HM8A 4B5BA 1XZ6A 1JV3A 3OH2A 1VPAA 5CQNX 4Y6UA 4CJBA 2C0NA 2WVLA 2OI6A 1ZCVA 4KRVA 3SXAA 1ZCTA 2W0VA 2X65A 3USRA 3IOIA 4MYBA 1PZTA 2ZU7A 3SXEA 1H7LA 4DE7A 5FV9A 4B2XA 1WT0A 1LL2A 2D7RA 1V82A 2QKXA 3JUJA 3DJ4A 5C4CA 2BO7A 4LW3A 2BO6A 5CMGX 5C47A 4EE3A 3PKPA 5C3BA 2V0IA 4KC4A 3V0NA 5EJ1A 4G87A 4FREA 3DUVA 2YQCA 1O0RA 1GQCA 2D0JA 3V90A 4EEAA 2RJ8A 3F1YA 5C3AA 4IRQA 4HO2A 3T7NA 3TZTA 4KXOA 4KNRA 1R7TA 4LW6A 1QG8A 1G97A 4Y63A 1YP3A 1GA8A 5EJZA 4G3SA 1GX0A 2NXVA 5DDTA 4FQWA 4M2BA 4Q7CA 1ZI5A 1FXOA 2WE9A 4FCUA 4Y7GA 3LW6A 2P6WA 2BO4A 2UX8A 1INIA 2ICYA 1H7FA 4FCEA 3E26A 1TZFA 2RJ9A 2DPWA 3OH4A 4AYLA 4O6NA 1G95A 1XHBA 2X60A 1ZCUA 1LZ7A 4D0ZA 3ZLLA 1ZIZA 1LVWA 1R81A 4FRBA 4DDZA 2OEFA 3SXGA 5C38A 3CGXA 2AECA 3HL3A 4BMAA 1H5RB 4Y7VA 1ZJ3A 3USQA 4JISA 3KIAA 1H7HA 1H4CA 1LZ0A 2VSIA 5I1FA 5L6VA 4B4MA 3EE5A 2VXLA 1YP2A 1NMMB 3QVBA 3V8YA 1H3MA 5EIYA 3Q80A 3U0YA 4HO4A 5C49A 3V0PA 1ZJ2A 1FGGA 1TW1A 1ZI1A 2YQJA 3IOHA 4IRPA 5AJOA 3PKQA 3F1CA 2WVMA 3SX8A 4CJCA 2FYBA 2Y4JA 5HS2A 2E3DA 2GGQA 2XMHA 3OH3A 1NF5B 3SX5A 2MZBA 5JQQA 5FTSA 4NANA 2V0KA 3JUKA 4DECA 4EEMA 1G8OA 2RJ0A 1GX4A 1ON6A 4CJ8A 2GGOA 4BQHA 1WSZA 1S4PA 2FYDB 2RIXA 2YC3A 4Y62A 5CMIA 2VS3A 3PNNA 1VZTA 2O1FA 3SXBA 1YROB 1V83A 2ICXA 1PZYB 1H5SB 2J0AA 1H4EA 4ECMA 4KQLA 3I0EA 4G3QA 3I0IX 4FRPA 4FRDA 2D7IA 1TW5A 4ZDQA 2YQSA 3U2WA 3CKNA 4GBPA 1VGZA 1WT1A 4NAIA 1W57A 3V8ZA 5CMJA 1O7QA 2RJ5A 3Q4SA 3TQDA 1NHEB 5FU0A 3U2TA 3SXCA 3V0LA 1QWJA 4EE5A 2WAWA 3V0QA 1VICA 3OAMA 1W55A 3I0KA 1WT3A 1S4OA 2I5EA 1HM9A 3DK5A 4K6RA 2ZU9A 2RJ7A 1R7XA 1ZJ0A 3O3PA 3U2UA 2JCKA 1LZIA 1FGXA 4EVWA 5FU8A 1R7UA 2WGZA 5C36A 1FRWA 1JVGA 2V0LA 2W0WA 4HO0A 1OMZA 4FIXA 4D11C 1H5SD 5C4BA 4FRAA 2PGVA 2YC5A 2FFUA 1Z90A 1NQIB 4Y9XA 1H7QA 2YCMA 1GWWA 1GQ9A 4J18A 2FYAA 4B4BA 1HJLA 1HJJA 2A8UA 3I0CA 5C1GA 3R2WA 3T7OA 4FRLA 3ZF8A 1EZIA 2P72A 1R82A 1H5TA 1G0RA 2CU2A 1NKHB 1ZHJA 5CMHA 4HO6A 2XWLA 2VSHA 3N9WA 4M4KA 3D8VA 2P73A 4YS8A 4AYJA 4HG6A 4KC1A 2X5SA 4HO3A 4EEOA 2Z86A 4FRHA 2JCOA 1ZDFA 3V0OA 5CQOA 4P00A 1ZJPA 4B3UA 1SS9A 1K4VA 4NALA 2AE7A 1MP4A 3CKJA 1WT2A 3SX7A 1LL0A 1VGUA 2PGYA 4EE4A 3I0JA 3OC9A 1YP4A 2V0JA 3U2XA 4B2WA 1ON8A 3RMVA 2O1GA 5FUHA 4FIYA 4NAKA 3RSBA 1FWYA 3K8DA 1VZUA 2Z87A 3SX3A 4E1KA 3R3IA 4MNDA 3NGWA 4L41C 2RIZA 3ZGFA 4D11A 2QH5A 2Q4JA 1FZWA 4B4GA 1G23A 5C48A 2RJ4A 1MC3A 2I7BA 3CKQA 1E5KA 1O7OA 3D98A 3JTJA 5FYEA 5FTVA 4MIXA 2XWNA 1VZXA 2APCA 3RMWA 4Y64A 1QGSA 3U0XA 1R7YA 4Y7UA 4Y7FA 1H5SA 2AESA 3K8EA 3GUEA 4HCQA 1FR9A 2E8BA 2VS4A 1JV1A 4R7PA 4B42A 2RJ6A 3I0LA 2JCJA 4KC2A 2VK9A 1G9RA 2OI7A 2VD4A 5CQMX 3I0FA 1FR8A 2J0BA 2I5KA 1FXJA 1H4DA 5DDVA 1FOAA 2XWMA 2AM4A 4HOCA 4JD0A 3OKRA 1H7EA 4D0TA 4M28A 1JYLA 1INJA 2OEGA 2PA4A 4P02A 4CVHA 1NWGB 1VH1A 5CMFX 2A8WA 1O23B 2AH9A 5CQPA 1S4NA 3I0HA 1JVDA 1QGQA 4ASJA 3V0MA 2V0HA 4FRMA 1LZJA 4ARWA 4EEGA 2Y6PA 2FY7A 1FO9A 1GWVA 3SXDA 3OH0A 1WVCA 2O1HA 4FROA 2QGIA 1H7GA 2YQHA 3OGZA 2YESA 2VFZA 2AM5A 2RITA 3T7MA 1OMXA 5C1LA 5C4EA 1HV9A 1ZCYA 3OH1A 3V91A 1H5SC 2RJ1A 1KWSA 5BXCA 1H7TA 4UEGA 1G1LA 1I52A 2OI5A 4Y6NA 1HM0A 1VGWA 5C4DA 1ZJOA 2XMEA 1G2VA 1H5TB 3CKVA 5D92A 2ZU8A 4C2SA 2FFVA 4ASYA 5C4FA 1IINA 1H5RA 1MP3A 2FYCB 1ZI3A 1R7VA 1G93A 3D5NA 1G3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IFY A;  1VM8 A;  5IDS A;  2Y4L A;  3BRK X;  4KT7 A;  1EYR A;  3FWW A;  3Q7U A;  1LL3 A;  4AAW A;  5CQL X;  2BO8 A;  1FO8 A;  4Y7T A;  1VH3 A;  4KPZ A;  1IIM A;  4HO5 A;  3ST8 A;  3U2V A;  5AJN A;  4M2A A;  5L6S A;  1ZDG A;  2Y4K A;  3BCV A;  1TVY A;  1OQM B;  1R80 A;  4AC3 A;  5AJP A;  4HO9 A;  3CU0 A;  5J49 A;  3ZGG A;  3I0G A;  2Y7A A;  4FRQ A;  1MP5 A;  1W77 A;  3SPT A;  3POL A;  5IDT A;  4HO8 A;  2Y4M A;  1VGT A;  3E25 A;  1JYK A;  1FG5 N;  4KPX A;  4G3P A;  3I0D A;  3ZLK A;  2PX7 A;  3FOQ A;  1ZI4 A;  3IOJ A;  2AGD A;  3CKO A;  4KNX A;  2WEE A;  1ZJ1 A;  5C3D A;  5C8R A;  4XWI A;  5C1H A;  2VXM A;  4D48 A;  2JCL A;  2RIY A;  2X5Z A;  2AM3 A;  1V84 A;  2WVK A;  2VS5 A;  1HM8 A;  4B5B A;  1XZ6 A;  1JV3 A;  3OH2 A;  1VPA A;  5CQN X;  4Y6U A;  4CJB A;  2WVL A;  2OI6 A;  1ZCV A;  4KRV A;  3SXA A;  1ZCT A;  2W0V A;  2X65 A;  3USR A;  3IOI A;  4MYB A;  1PZT A;  2ZU7 A;  3SXE A;  1H7L A;  4DE7 A;  5FV9 A;  4B2X A;  1WT0 A;  1LL2 A;  2D7R A;  1V82 A;  2QKX A;  3JUJ A;  3DJ4 A;  5C4C A;  2BO7 A;  4LW3 A;  2BO6 A;  5CMG X;  5C47 A;  4EE3 A;  3PKP A;  5C3B A;  2V0I A;  4KC4 A;  3V0N A;  5EJ1 A;  4G87 A;  4FRE A;  3DUV A;  2YQC A;  1O0R A;  1GQC A;  2D0J A;  3V90 A;  4EEA A;  2RJ8 A;  3F1Y A;  5C3A A;  4IRQ A;  4HO2 A;  3T7N A;  3TZT A;  4KXO A;  4KNR A;  1R7T A;  4LW6 A;  1QG8 A;  1G97 A;  4Y63 A;  1YP3 A;  1GA8 A;  5EJZ A;  4G3S A;  1GX0 A;  2NXV A;  5DDT A;  4FQW A;  4M2B A;  1ZI5 A;  1FXO A;  2WE9 A;  4FCU A;  4Y7G A;  3LW6 A;  2P6W A;  2BO4 A;  2UX8 A;  1INI A;  2ICY A;  1H7F A;  4FCE A;  3E26 A;  1TZF A;  2RJ9 A;  2DPW A;  3OH4 A;  4AYL A;  1G95 A;  1XHB A;  2X60 A;  1ZCU A;  1LZ7 A;  4D0Z A;  3ZLL A;  1ZIZ A;  1LVW A;  1R81 A;  4FRB A;  4DDZ A;  2OEF A;  3SXG A;  5C38 A;  3CGX A;  2AEC A;  3HL3 A;  4BMA A;  1H5R B;  4Y7V A;  1ZJ3 A;  3USQ A;  4JIS A;  3KIA A;  1H7H A;  1H4C A;  1LZ0 A;  2VSI A;  5I1F A;  5L6V A;  4B4M A;  3EE5 A;  2VXL A;  1YP2 A;  1NMM B;  3QVB A;  3V8Y A;  1H3M A;  5EIY A;  3Q80 A;  3U0Y A;  4HO4 A;  5C49 A;  3V0P A;  1ZJ2 A;  1FGG A;  1TW1 A;  1ZI1 A;  2YQJ A;  3IOH A;  4IRP A;  5AJO A;  3PKQ A;  3F1C A;  2WVM A;  3SX8 A;  4CJC A;  2FYB A;  2Y4J A;  5HS2 A;  2E3D A;  2GGQ A;  2XMH A;  3OH3 A;  1NF5 B;  3SX5 A;  2MZB A;  5JQQ A;  5FTS A;  4NAN A;  2V0K A;  3JUK A;  4DEC A;  4EEM A;  1G8O A;  2RJ0 A;  1GX4 A;  1ON6 A;  4CJ8 A;  2GGO A;  4BQH A;  1WSZ A;  1S4P A;  2FYD B;  2RIX A;  2YC3 A;  4Y62 A;  5CMI A;  2VS3 A;  3PNN A;  1VZT A;  2O1F A;  3SXB A;  1YRO B;  1V83 A;  2ICX A;  1PZY B;  1H5S B;  1H4E A;  4ECM A;  4KQL A;  3I0E A;  4G3Q A;  3I0I X;  4FRP A;  4FRD A;  2D7I A;  1TW5 A;  4ZDQ A;  2YQS A;  3U2W A;  3CKN A;  4GBP A;  1VGZ A;  1WT1 A;  4NAI A;  1W57 A;  3V8Z A;  5CMJ A;  1O7Q A;  2RJ5 A;  3Q4S A;  3TQD A;  1NHE B;  5FU0 A;  3U2T A;  3SXC A;  3V0L A;  1QWJ A;  4EE5 A;  2WAW A;  3V0Q A;  1VIC A;  3OAM A;  1W55 A;  3I0K A;  1WT3 A;  1S4O A;  2I5E A;  1HM9 A;  3DK5 A;  4K6R A;  2ZU9 A;  2RJ7 A;  1R7X A;  1ZJ0 A;  3O3P A;  3U2U A;  2JCK A;  1LZI A;  1FGX A;  4EVW A;  5FU8 A;  1R7U A;  2WGZ A;  5C36 A;  1FRW A;  1JVG A;  2V0L A;  2W0W A;  4HO0 A;  1OMZ A;  4D11 C;  1H5S D;  5C4B A;  4FRA A;  2PGV A;  2YC5 A;  2FFU A;  1Z90 A;  1NQI B;  4Y9X A;  1H7Q A;  2YCM A;  1GWW A;  1GQ9 A;  4J18 A;  2FYA A;  4B4B A;  1HJL A;  1HJJ A;  2A8U A;  3I0C A;  5C1G A;  3R2W A;  3T7O A;  4FRL A;  3ZF8 A;  1EZI A;  2P72 A;  1R82 A;  1H5T A;  1G0R A;  2CU2 A;  1NKH B;  1ZHJ A;  5CMH A;  4HO6 A;  2XWL A;  2VSH A;  3N9W A;  4M4K A;  3D8V A;  2P73 A;  4YS8 A;  4AYJ A;  4HG6 A;  4KC1 A;  2X5S A;  4HO3 A;  4EEO A;  2Z86 A;  4FRH A;  2JCO A;  1ZDF A;  3V0O A;  5CQO A;  4P00 A;  1ZJP A;  4B3U A;  1SS9 A;  1K4V A;  4NAL A;  2AE7 A;  1MP4 A;  3CKJ A;  1WT2 A;  3SX7 A;  1LL0 A;  1VGU A;  2PGY A;  4EE4 A;  3I0J A;  3OC9 A;  1YP4 A;  2V0J A;  3U2X A;  4B2W A;  1ON8 A;  3RMV A;  2O1G A;  5FUH A;  4NAK A;  3RSB A;  1FWY A;  3K8D A;  1VZU A;  2Z87 A;  3SX3 A;  4E1K A;  3R3I A;  4MND A;  3NGW A;  4L41 C;  2RIZ A;  3ZGF A;  4D11 A;  2QH5 A;  2Q4J A;  1FZW A;  4B4G A;  1G23 A;  5C48 A;  2RJ4 A;  1MC3 A;  2I7B A;  3CKQ A;  1E5K A;  1O7O A;  3D98 A;  3JTJ A;  5FYE A;  5FTV A;  2XWN A;  1VZX A;  2APC A;  3RMW A;  4Y64 A;  1QGS A;  3U0X A;  1R7Y A;  4Y7U A;  4Y7F A;  1H5S A;  2AES A;  3K8E A;  3GUE A;  4HCQ A;  1FR9 A;  2E8B A;  2VS4 A;  1JV1 A;  4R7P A;  4B42 A;  2RJ6 A;  3I0L A;  2JCJ A;  4KC2 A;  1G9R A;  2OI7 A;  2VD4 A;  5CQM X;  3I0F A;  1FR8 A;  2I5K A;  1FXJ A;  1H4D A;  5DDV A;  1FOA A;  2XWM A;  2AM4 A;  4HOC A;  4JD0 A;  3OKR A;  1H7E A;  4D0T A;  4M28 A;  1JYL A;  1INJ A;  2OEG A;  2PA4 A;  4P02 A;  4CVH A;  1NWG B;  1VH1 A;  5CMF X;  2A8W A;  1O23 B;  2AH9 A;  5CQP A;  1S4N A;  3I0H A;  1JVD A;  1QGQ A;  4ASJ A;  3V0M A;  2V0H A;  4FRM A;  1LZJ A;  4ARW A;  4EEG A;  2Y6P A;  2FY7 A;  1FO9 A;  1GWV A;  3SXD A;  3OH0 A;  1WVC A;  2O1H A;  4FRO A;  2QGI A;  1H7G A;  2YQH A;  3OGZ A;  2YES A;  2VFZ A;  2AM5 A;  2RIT A;  3T7M A;  1OMX A;  5C1L A;  5C4E A;  1HV9 A;  1ZCY A;  3OH1 A;  3V91 A;  1H5S C;  2RJ1 A;  1KWS A;  5BXC A;  1H7T A;  4UEG A;  1G1L A;  1I52 A;  2OI5 A;  4Y6N A;  1HM0 A;  1VGW A;  5C4D A;  1ZJO A;  2XME A;  1G2V A;  1H5T B;  3CKV A;  4C2S A;  2ZU8 A;  2FFV A;  4ASY A;  5C4F A;  1IIN A;  1H5R A;  1MP3 A;  2FYC B;  1ZI3 A;  1R7V A;  1G93 A;  3D5N A;  1G3L A; 
#chains in the Genus database with same CATH topology
 5IFY A;  1VM8 A;  5IDS A;  2Y4L A;  3BRK X;  4KT7 A;  1EYR A;  3FWW A;  3Q7U A;  1LL3 A;  4AAW A;  5CQL X;  2BO8 A;  1FO8 A;  4Y7T A;  1VH3 A;  4KPZ A;  1IIM A;  4HO5 A;  3ST8 A;  3U2V A;  5D91 A;  5AJN A;  4M2A A;  5L6S A;  1ZDG A;  2Y4K A;  3BCV A;  1TVY A;  1OQM B;  1R80 A;  4AC3 A;  5AJP A;  4HO9 A;  3CU0 A;  5J49 A;  4O6M A;  3I0G A;  3ZGG A;  2Y7A A;  4FRQ A;  1MP5 A;  1W77 A;  3SPT A;  3POL A;  5IDT A;  4HO8 A;  2Y4M A;  1VGT A;  3E25 A;  1JYK A;  1FG5 N;  4KPX A;  4G3P A;  3I0D A;  3ZLK A;  2PX7 A;  3FOQ A;  1ZI4 A;  3IOJ A;  2AGD A;  3CKO A;  4KNX A;  2WEE A;  1ZJ1 A;  5C3D A;  5C8R A;  4XWI A;  5C1H A;  2VXM A;  4D48 A;  2JCL A;  2RIY A;  2X5Z A;  2AM3 A;  1V84 A;  2WVK A;  2VS5 A;  1HM8 A;  4B5B A;  1XZ6 A;  1JV3 A;  3OH2 A;  1VPA A;  5CQN X;  4Y6U A;  4CJB A;  2C0N A;  2WVL A;  2OI6 A;  1ZCV A;  4KRV A;  3SXA A;  1ZCT A;  2W0V A;  2X65 A;  3USR A;  3IOI A;  4MYB A;  1PZT A;  2ZU7 A;  3SXE A;  1H7L A;  4DE7 A;  5FV9 A;  4B2X A;  1WT0 A;  1LL2 A;  2D7R A;  1V82 A;  2QKX A;  3JUJ A;  3DJ4 A;  5C4C A;  2BO7 A;  4LW3 A;  2BO6 A;  5CMG X;  5C47 A;  4EE3 A;  3PKP A;  5C3B A;  2V0I A;  4KC4 A;  3V0N A;  5EJ1 A;  4G87 A;  4FRE A;  3DUV A;  2YQC A;  1O0R A;  1GQC A;  2D0J A;  3V90 A;  4EEA A;  2RJ8 A;  3F1Y A;  5C3A A;  4IRQ A;  4HO2 A;  3T7N A;  3TZT A;  4KXO A;  4KNR A;  1R7T A;  4LW6 A;  1QG8 A;  1G97 A;  4Y63 A;  1YP3 A;  1GA8 A;  5EJZ A;  4G3S A;  1GX0 A;  2NXV A;  5DDT A;  4FQW A;  4M2B A;  4Q7C A;  1ZI5 A;  1FXO A;  2WE9 A;  4FCU A;  4Y7G A;  3LW6 A;  2P6W A;  2BO4 A;  2UX8 A;  1INI A;  2ICY A;  1H7F A;  4FCE A;  3E26 A;  1TZF A;  2RJ9 A;  2DPW A;  3OH4 A;  4AYL A;  4O6N A;  1G95 A;  1XHB A;  2X60 A;  1ZCU A;  1LZ7 A;  4D0Z A;  3ZLL A;  1ZIZ A;  1LVW A;  1R81 A;  4FRB A;  4DDZ A;  2OEF A;  3SXG A;  5C38 A;  3CGX A;  2AEC A;  3HL3 A;  4BMA A;  1H5R B;  4Y7V A;  1ZJ3 A;  3USQ A;  4JIS A;  3KIA A;  1H7H A;  1H4C A;  1LZ0 A;  2VSI A;  5I1F A;  5L6V A;  4B4M A;  3EE5 A;  2VXL A;  1YP2 A;  1NMM B;  3QVB A;  3V8Y A;  1H3M A;  5EIY A;  3Q80 A;  3U0Y A;  4HO4 A;  5C49 A;  3V0P A;  1ZJ2 A;  1FGG A;  1TW1 A;  1ZI1 A;  2YQJ A;  3IOH A;  4IRP A;  5AJO A;  3PKQ A;  3F1C A;  2WVM A;  3SX8 A;  4CJC A;  2FYB A;  2Y4J A;  5HS2 A;  2E3D A;  2GGQ A;  2XMH A;  3OH3 A;  1NF5 B;  3SX5 A;  2MZB A;  5JQQ A;  5FTS A;  4NAN A;  2V0K A;  3JUK A;  4DEC A;  4EEM A;  1G8O A;  2RJ0 A;  1GX4 A;  1ON6 A;  4CJ8 A;  2GGO A;  4BQH A;  1WSZ A;  1S4P A;  2FYD B;  2RIX A;  2YC3 A;  4Y62 A;  5CMI A;  2VS3 A;  3PNN A;  1VZT A;  2O1F A;  3SXB A;  1YRO B;  1V83 A;  2ICX A;  1PZY B;  1H5S B;  2J0A A;  1H4E A;  4ECM A;  4KQL A;  3I0E A;  4G3Q A;  3I0I X;  4FRP A;  4FRD A;  2D7I A;  1TW5 A;  4ZDQ A;  2YQS A;  3U2W A;  3CKN A;  4GBP A;  1VGZ A;  1WT1 A;  4NAI A;  1W57 A;  3V8Z A;  5CMJ A;  1O7Q A;  2RJ5 A;  3Q4S A;  3TQD A;  1NHE B;  5FU0 A;  3U2T A;  3SXC A;  3V0L A;  1QWJ A;  4EE5 A;  2WAW A;  3V0Q A;  1VIC A;  3OAM A;  1W55 A;  3I0K A;  1WT3 A;  1S4O A;  2I5E A;  1HM9 A;  3DK5 A;  4K6R A;  2ZU9 A;  2RJ7 A;  1R7X A;  1ZJ0 A;  3O3P A;  3U2U A;  2JCK A;  1LZI A;  1FGX A;  4EVW A;  5FU8 A;  1R7U A;  2WGZ A;  5C36 A;  1FRW A;  1JVG A;  2V0L A;  2W0W A;  4HO0 A;  1OMZ A;  4FIX A;  4D11 C;  1H5S D;  5C4B A;  4FRA A;  2PGV A;  2YC5 A;  2FFU A;  1Z90 A;  1NQI B;  4Y9X A;  1H7Q A;  2YCM A;  1GWW A;  1GQ9 A;  4J18 A;  2FYA A;  4B4B A;  1HJL A;  1HJJ A;  2A8U A;  3I0C A;  5C1G A;  3R2W A;  3T7O A;  4FRL A;  3ZF8 A;  1EZI A;  2P72 A;  1R82 A;  1H5T A;  1G0R A;  2CU2 A;  1NKH B;  1ZHJ A;  5CMH A;  4HO6 A;  2XWL A;  2VSH A;  3N9W A;  4M4K A;  3D8V A;  2P73 A;  4YS8 A;  4AYJ A;  4HG6 A;  4KC1 A;  2X5S A;  4HO3 A;  4EEO A;  2Z86 A;  4FRH A;  2JCO A;  1ZDF A;  3V0O A;  5CQO A;  4P00 A;  1ZJP A;  4B3U A;  1SS9 A;  1K4V A;  4NAL A;  2AE7 A;  1MP4 A;  3CKJ A;  1WT2 A;  3SX7 A;  1LL0 A;  1VGU A;  2PGY A;  4EE4 A;  3I0J A;  3OC9 A;  1YP4 A;  2V0J A;  3U2X A;  4B2W A;  1ON8 A;  3RMV A;  2O1G A;  5FUH A;  4FIY A;  4NAK A;  3RSB A;  1FWY A;  3K8D A;  1VZU A;  2Z87 A;  3SX3 A;  4E1K A;  3R3I A;  4MND A;  3NGW A;  4L41 C;  2RIZ A;  3ZGF A;  4D11 A;  2QH5 A;  2Q4J A;  1FZW A;  4B4G A;  1G23 A;  5C48 A;  2RJ4 A;  1MC3 A;  2I7B A;  3CKQ A;  1E5K A;  1O7O A;  3D98 A;  3JTJ A;  5FYE A;  5FTV A;  4MIX A;  2XWN A;  1VZX A;  2APC A;  3RMW A;  4Y64 A;  1QGS A;  3U0X A;  1R7Y A;  4Y7U A;  4Y7F A;  1H5S A;  2AES A;  3K8E A;  3GUE A;  4HCQ A;  1FR9 A;  2E8B A;  2VS4 A;  1JV1 A;  4R7P A;  4B42 A;  2RJ6 A;  3I0L A;  2JCJ A;  4KC2 A;  2VK9 A;  1G9R A;  2OI7 A;  2VD4 A;  5CQM X;  3I0F A;  1FR8 A;  2J0B A;  2I5K A;  1FXJ A;  1H4D A;  5DDV A;  1FOA A;  2XWM A;  2AM4 A;  4HOC A;  4JD0 A;  3OKR A;  1H7E A;  4D0T A;  4M28 A;  1JYL A;  1INJ A;  2OEG A;  2PA4 A;  4P02 A;  4CVH A;  1NWG B;  1VH1 A;  5CMF X;  2A8W A;  1O23 B;  2AH9 A;  5CQP A;  1S4N A;  3I0H A;  1JVD A;  1QGQ A;  4ASJ A;  3V0M A;  2V0H A;  4FRM A;  1LZJ A;  4ARW A;  4EEG A;  2Y6P A;  2FY7 A;  1FO9 A;  1GWV A;  3SXD A;  3OH0 A;  1WVC A;  2O1H A;  4FRO A;  2QGI A;  1H7G A;  2YQH A;  3OGZ A;  2YES A;  2VFZ A;  2AM5 A;  2RIT A;  3T7M A;  1OMX A;  5C1L A;  5C4E A;  1HV9 A;  1ZCY A;  3OH1 A;  3V91 A;  1H5S C;  2RJ1 A;  1KWS A;  5BXC A;  1H7T A;  4UEG A;  1G1L A;  1I52 A;  2OI5 A;  4Y6N A;  1HM0 A;  1VGW A;  5C4D A;  1ZJO A;  2XME A;  1G2V A;  1H5T B;  3CKV A;  5D92 A;  2ZU8 A;  4C2S A;  2FFV A;  4ASY A;  5C4F A;  1IIN A;  1H5R A;  1MP3 A;  2FYC B;  1ZI3 A;  1R7V A;  1G93 A;  3D5N A;  1G3L A; 
#chains in the Genus database with same CATH homology
 5IFY A;  1VM8 A;  5IDS A;  2Y4L A;  3BRK X;  4KT7 A;  1EYR A;  3FWW A;  3Q7U A;  1LL3 A;  4AAW A;  5CQL X;  2BO8 A;  1FO8 A;  4Y7T A;  1VH3 A;  4KPZ A;  1IIM A;  4HO5 A;  3ST8 A;  3U2V A;  5D91 A;  5AJN A;  4M2A A;  5L6S A;  1ZDG A;  2Y4K A;  3BCV A;  1TVY A;  1OQM B;  1R80 A;  4AC3 A;  5AJP A;  4HO9 A;  3CU0 A;  5J49 A;  4O6M A;  3I0G A;  3ZGG A;  2Y7A A;  4FRQ A;  1MP5 A;  1W77 A;  3SPT A;  3POL A;  5IDT A;  4HO8 A;  2Y4M A;  1VGT A;  3E25 A;  1JYK A;  1FG5 N;  4KPX A;  4G3P A;  3I0D A;  3ZLK A;  2PX7 A;  3FOQ A;  1ZI4 A;  3IOJ A;  2AGD A;  3CKO A;  4KNX A;  2WEE A;  1ZJ1 A;  5C3D A;  5C8R A;  4XWI A;  5C1H A;  2VXM A;  4D48 A;  2JCL A;  2RIY A;  2X5Z A;  2AM3 A;  1V84 A;  2WVK A;  2VS5 A;  1HM8 A;  4B5B A;  1XZ6 A;  1JV3 A;  3OH2 A;  1VPA A;  5CQN X;  4Y6U A;  4CJB A;  2C0N A;  2WVL A;  2OI6 A;  1ZCV A;  4KRV A;  3SXA A;  1ZCT A;  2W0V A;  2X65 A;  3USR A;  3IOI A;  4MYB A;  1PZT A;  2ZU7 A;  3SXE A;  1H7L A;  4DE7 A;  5FV9 A;  4B2X A;  1WT0 A;  1LL2 A;  2D7R A;  1V82 A;  2QKX A;  3JUJ A;  3DJ4 A;  5C4C A;  2BO7 A;  4LW3 A;  2BO6 A;  5CMG X;  5C47 A;  4EE3 A;  3PKP A;  5C3B A;  2V0I A;  4KC4 A;  3V0N A;  5EJ1 A;  4G87 A;  4FRE A;  3DUV A;  2YQC A;  1O0R A;  1GQC A;  2D0J A;  3V90 A;  4EEA A;  2RJ8 A;  3F1Y A;  5C3A A;  4IRQ A;  4HO2 A;  3T7N A;  3TZT A;  4KXO A;  4KNR A;  1R7T A;  4LW6 A;  1QG8 A;  1G97 A;  4Y63 A;  1YP3 A;  1GA8 A;  5EJZ A;  4G3S A;  1GX0 A;  2NXV A;  5DDT A;  4FQW A;  4M2B A;  4Q7C A;  1ZI5 A;  1FXO A;  2WE9 A;  4FCU A;  4Y7G A;  3LW6 A;  2P6W A;  2BO4 A;  2UX8 A;  1INI A;  2ICY A;  1H7F A;  4FCE A;  3E26 A;  1TZF A;  2RJ9 A;  2DPW A;  3OH4 A;  4AYL A;  4O6N A;  1G95 A;  1XHB A;  2X60 A;  1ZCU A;  1LZ7 A;  4D0Z A;  3ZLL A;  1ZIZ A;  1LVW A;  1R81 A;  4FRB A;  4DDZ A;  2OEF A;  3SXG A;  5C38 A;  3CGX A;  2AEC A;  3HL3 A;  4BMA A;  1H5R B;  4Y7V A;  1ZJ3 A;  3USQ A;  4JIS A;  3KIA A;  1H7H A;  1H4C A;  1LZ0 A;  2VSI A;  5I1F A;  5L6V A;  4B4M A;  3EE5 A;  2VXL A;  1YP2 A;  1NMM B;  3QVB A;  3V8Y A;  1H3M A;  5EIY A;  3Q80 A;  3U0Y A;  4HO4 A;  5C49 A;  3V0P A;  1ZJ2 A;  1FGG A;  1TW1 A;  1ZI1 A;  2YQJ A;  3IOH A;  4IRP A;  5AJO A;  3PKQ A;  3F1C A;  2WVM A;  3SX8 A;  4CJC A;  2FYB A;  2Y4J A;  5HS2 A;  2E3D A;  2GGQ A;  2XMH A;  3OH3 A;  1NF5 B;  3SX5 A;  2MZB A;  5JQQ A;  5FTS A;  4NAN A;  2V0K A;  3JUK A;  4DEC A;  4EEM A;  1G8O A;  2RJ0 A;  1GX4 A;  1ON6 A;  4CJ8 A;  2GGO A;  4BQH A;  1WSZ A;  1S4P A;  2FYD B;  2RIX A;  2YC3 A;  4Y62 A;  5CMI A;  2VS3 A;  3PNN A;  1VZT A;  2O1F A;  3SXB A;  1YRO B;  1V83 A;  2ICX A;  1PZY B;  1H5S B;  2J0A A;  1H4E A;  4ECM A;  4KQL A;  3I0E A;  4G3Q A;  3I0I X;  4FRP A;  4FRD A;  2D7I A;  1TW5 A;  4ZDQ A;  2YQS A;  3U2W A;  3CKN A;  4GBP A;  1VGZ A;  1WT1 A;  4NAI A;  1W57 A;  3V8Z A;  5CMJ A;  1O7Q A;  2RJ5 A;  3Q4S A;  3TQD A;  1NHE B;  5FU0 A;  3U2T A;  3SXC A;  3V0L A;  1QWJ A;  4EE5 A;  2WAW A;  3V0Q A;  1VIC A;  3OAM A;  1W55 A;  3I0K A;  1WT3 A;  1S4O A;  2I5E A;  1HM9 A;  3DK5 A;  4K6R A;  2ZU9 A;  2RJ7 A;  1R7X A;  1ZJ0 A;  3O3P A;  3U2U A;  2JCK A;  1LZI A;  1FGX A;  4EVW A;  5FU8 A;  1R7U A;  2WGZ A;  5C36 A;  1FRW A;  1JVG A;  2V0L A;  2W0W A;  4HO0 A;  1OMZ A;  4FIX A;  4D11 C;  1H5S D;  5C4B A;  4FRA A;  2PGV A;  2YC5 A;  2FFU A;  1Z90 A;  1NQI B;  4Y9X A;  1H7Q A;  2YCM A;  1GWW A;  1GQ9 A;  4J18 A;  2FYA A;  4B4B A;  1HJL A;  1HJJ A;  2A8U A;  3I0C A;  5C1G A;  3R2W A;  3T7O A;  4FRL A;  3ZF8 A;  1EZI A;  2P72 A;  1R82 A;  1H5T A;  1G0R A;  2CU2 A;  1NKH B;  1ZHJ A;  5CMH A;  4HO6 A;  2XWL A;  2VSH A;  3N9W A;  4M4K A;  3D8V A;  2P73 A;  4YS8 A;  4AYJ A;  4HG6 A;  4KC1 A;  2X5S A;  4HO3 A;  4EEO A;  2Z86 A;  4FRH A;  2JCO A;  1ZDF A;  3V0O A;  5CQO A;  4P00 A;  1ZJP A;  4B3U A;  1SS9 A;  1K4V A;  4NAL A;  2AE7 A;  1MP4 A;  3CKJ A;  1WT2 A;  3SX7 A;  1LL0 A;  1VGU A;  2PGY A;  4EE4 A;  3I0J A;  3OC9 A;  1YP4 A;  2V0J A;  3U2X A;  4B2W A;  1ON8 A;  3RMV A;  2O1G A;  5FUH A;  4FIY A;  4NAK A;  3RSB A;  1FWY A;  3K8D A;  1VZU A;  2Z87 A;  3SX3 A;  4E1K A;  3R3I A;  4MND A;  3NGW A;  4L41 C;  2RIZ A;  3ZGF A;  4D11 A;  2QH5 A;  2Q4J A;  1FZW A;  4B4G A;  1G23 A;  5C48 A;  2RJ4 A;  1MC3 A;  2I7B A;  3CKQ A;  1E5K A;  1O7O A;  3D98 A;  3JTJ A;  5FYE A;  5FTV A;  4MIX A;  2XWN A;  1VZX A;  2APC A;  3RMW A;  4Y64 A;  1QGS A;  3U0X A;  1R7Y A;  4Y7U A;  4Y7F A;  1H5S A;  2AES A;  3K8E A;  3GUE A;  4HCQ A;  1FR9 A;  2E8B A;  2VS4 A;  1JV1 A;  4R7P A;  4B42 A;  2RJ6 A;  3I0L A;  2JCJ A;  4KC2 A;  2VK9 A;  1G9R A;  2OI7 A;  2VD4 A;  5CQM X;  3I0F A;  1FR8 A;  2J0B A;  2I5K A;  1FXJ A;  1H4D A;  5DDV A;  1FOA A;  2XWM A;  2AM4 A;  4HOC A;  4JD0 A;  3OKR A;  1H7E A;  4D0T A;  4M28 A;  1JYL A;  1INJ A;  2OEG A;  2PA4 A;  4P02 A;  4CVH A;  1NWG B;  1VH1 A;  5CMF X;  2A8W A;  1O23 B;  2AH9 A;  5CQP A;  1S4N A;  3I0H A;  1JVD A;  1QGQ A;  4ASJ A;  3V0M A;  2V0H A;  4FRM A;  1LZJ A;  4ARW A;  4EEG A;  2Y6P A;  2FY7 A;  1FO9 A;  1GWV A;  3SXD A;  3OH0 A;  1WVC A;  2O1H A;  4FRO A;  2QGI A;  1H7G A;  2YQH A;  3OGZ A;  2YES A;  2VFZ A;  2AM5 A;  2RIT A;  3T7M A;  1OMX A;  5C1L A;  5C4E A;  1HV9 A;  1ZCY A;  3OH1 A;  3V91 A;  1H5S C;  2RJ1 A;  1KWS A;  5BXC A;  1H7T A;  4UEG A;  1G1L A;  1I52 A;  2OI5 A;  4Y6N A;  1HM0 A;  1VGW A;  5C4D A;  1ZJO A;  2XME A;  1G2V A;  1H5T B;  3CKV A;  5D92 A;  2ZU8 A;  4C2S A;  2FFV A;  4ASY A;  5C4F A;  1IIN A;  1H5R A;  1MP3 A;  2FYC B;  1ZI3 A;  1R7V A;  1G93 A;  3D5N A;  1G3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...