2AERT

Crystal structure of benzamidine-factor viia/soluble tissue factor complex.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
192
Chain Sequence
b'ATVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coagulation factor VII
publication title High Resolution Structures of p-Aminobenzamidine- and Benzamidine-VIIa/Soluble Tissue Factor: Unpredicted conformation of the 192-193 peptide bond and mapping of Ca2+, Mg2+, Na+ and Zn2+ sites in factor VIIa
pubmed doi rcsb
molecule tags Blood clotting
total genus 42
structure length 192
sequence length 206
ec nomenclature
pdb deposition date 2005-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2aerT01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2aerT02
1FVCA 2OL3L 4XVUC 1K85A 3GSRA 4KJQC 4LRIA 5E1AA 1NEZA 4QOKE 1N26A 1OOAA 1I1FB 4HIIB 1JTOA 1IGYA 1NLDL 4X6CF 4NO0A 4PJFB 4APQA 2Y06L 4JFDE 4BFGA 5DJXB 1FO0H 1AXTL 1LE5B 3ZE1E 3LEXA 3UC0L 4HIHA 1BHGA 1IGML 5FCSH 1YNLL 5DK2A 2EYSA 2YUXA 1OP5K 1CD8A 1NMBH 2FEEL 3O0RL 4MNQD 5FO8A 5CUSL 3TPKA 1YY9D 1P5VA 1U95A 3TBYA 4NQVB 1J0ZA 5KSAD 4JY4A 3O3AA 2IANA 1MSPA 3VXNB 4XCFH 3SY0A 4YDVA 2HJKB 5INDA 5F97E 4MA1C 5D2NA 3G6JE 3QSKB 2BRRH 3QDAA 1NCCL 4ENED 3O6FA 2YWYA 5KBNC 4LSUL 3AB0B 3K2MC 1FJ1B 5DMJB 3WJLC 1K8IA 4UIKL 5IVZA 3BP7B 3UPCA 4OZIF 4U1IB 2VXVL 4JFFD 1OWWA 4QEGA 1G7MA 3NZ8B 3AS2A 3MRQB 4RFOL 32C2A 3HUJB 4QXUL 1P6FA 2HFFA 3IDGA 3T8XB 1QBMH 5F1NA 2C1PB 3CX5J 1ROWA 3EO1B 3UBXG 1IC1A 4OZHB 1JGEB 5FO9A 5IFHH 3REWA 5I6XB 3FQTB 3WFBH 1YC8A 1T2JA 5F7NC 3D2UD 2BDNL 3UYPA 5KVFL 4I77L 5LKNA 3MPCA 4NOBA 5FV2A 2EICA 1PZUB 1EEUA 1RIVL 4GKZA 3QDMD 5GGSA 3B9DA 4JVUA 3ZYZA 5IJVA 3LEYL 1KIRB 1MHCA 3RVWC 4P5TC 1PSKH 4NO2A 5JHLL 5JO5A 4KWUA 4O2CB 4HULB 3B6SA 4QT5B 2ZJSH 4ZUWB 4HPOL 3QQ9C 1PLGH 4JEGB 5LCVH 1I3VA 3G6DL 4LU5H 2ZCLL 2CDGA 2CKBB 3QRGL 4U3HA 4Z7WB 5I2IB 1A4KB 3ETBF 3MO1A 4JY5L 5ESAA 1R3LA 4G8GA 2ADFH 4D0BA 1U58B 5C1MB 1BLNA 2H3NA 4OIBA 4O00A 4X9HA 2UWEE 4K7PH 3IAQA 4N0RA 4L1HA 4GRWB 5CJBA 5D1QA 3QEQA 4M1DL 1HEZA 4M1CC 3AXLA 4PJBF 3UJTL 2EKSB 5HYSA 1QPXA 1J9CT 4P2RA 4RFNC 4IOFC 2I07B 3DHMA 3OXSA 5K9JL 1IAMA 3MLTA 4S1RL 4RA3A 5F1OB 4HDIB 3PJSA 4X80H 1EBPA 4KRPC 2G2RA 5FECB 1CU4H 5FA4A 4AMKL 5KOMC 2AGJL 2H6PA 2QLVB 3E6HA 3ZT6A 2WNGA 1NGQH 4OFDA 1LP9E 4JN1L 1T89C 4MLSA 4S2SA 4XWGL 3P9MA 5EA0H 5D2LA 3S3PA 4M7KH 2XTJB 5GRUH 1DQQA 3S36H 4XXCA 3NCMA 1BZ9B 3PDOB 4OFYD 4QHMB 4XVTH 3RJQB 2V5SA 3R0MA 2EKJA 1D5ZA 1RIHH 2NPLX 2H8PB 3U0WL 4MJID 4HIEB 4YHPB 2FJHB 3ULSB 3VJ6A 1JHLH 4IS6A 7FABL 8FABB 3OQ3B 1X5AA 4HJJL 5IFAH 3V4PH 1X5JA 3IFOA 2D03L 4DW2H 4YEFA 3F12B 4P9HH 3BT2L 1AP2A 2ESVB 1VACA 4JDZA 3E1F1 3QDHA 1NKOA 2F54B 4MAUH 1QSEB 4OCWL 3ARDC 3QQNA 3MCKA 3TO4D 5CBAA 2D2OA 3FB5A 3HHRB 3H7LA 1GZPA 1NCBH 1A6VH 1VB9A 3IU4L 3ZYOA 2OXHA 3VFMA 3BKJH 3L5HA 5JMRA 4N1EA 4POYA 4FRWA 3KPPA 3W9DB 2DWDA 2BY0A 3D0VB 4X6FB 2BVOA 5JOEA 1EAPB 1AR1D 2YSSB 5DZNA 1MUJA 3QUXB 3LD8C 3PP3H 1GGYA 4ZUSA 5IEKA 2NTFA 3WFEH 3DO3A 2JTDA 4XZUB 3IXAB 4Z77A 2LFGA 2Y4SA 2ED9A 1TFHA 3LV3A 5HD8D 4M5ZL 1JNHA 4XP1L 1XF1A 3RWDA 3W82A 4QRPA 4NKOA 4P4KD 4YH6A 3RX8A 3DYOA 3RWFB 2W91A 3QHFL 5EU6E 2QQLH 4MB5A 1IC4L 3RTQC 4M48H 4PJGF 4HXAL 1VFUA 1W72H 4NO3B 2GCYA 5IMOB 1G7IB 4Z76B 2WANA 1W0WB 1XCTB 4DZ8A 3OX8A 3OBAA 3PWJB 3QUYB 4I5BA 1GOHA 3QDJB 5DD1L 3RL2B 1A64A 5J11C 2VAJA 3RVUC 3X11B 3BMVA 3FCTB 4NRXA 3CNKA 2JJWA 3S88L 4C56B 5TH2B 2BNRB 3VXPB 2E6QA 3MLUL 1GGIL 3RZCC 1WLHA 5DD3L 4TSAL 5KSBA 4DVBB 4HJ0C 1OAQH 4DGVL 2DMBA 1EH9A 3T0BA 1E27A 3WSQL 4ZTPH 3BH9A 2DLFH 1GGBH 3MLVL 1NBZA 4OFKA 3S4SB 5DWUL 3HE7B 5SWZA 4TSBH 3L3OB 4EI5B 2F74A 4M93C 1N6VA 3EOBB 4AIZB 4Z7OE 4PRAB 1NEUA 2BNQB 5D7JB 4LLUB 4ZD3H 2QSCL 4M02A 2Q3ZA 3WD5L 1PVHA 4U1MA 1PY9A 4HV8B 1FSKC 4X4ZA 5KVEH 1UXWA 5ILTH 3QNZB 3T1WA 4OF3A 3VRLF 1Z6JT 2AXFA 4H8WC 1B9ZA 1MREH 1WZLA 5D9SB 3WJJA 5EOCL 1XCQB 5HVHC 1B6UA 2NY1C 5ISZA 2VDKH 5HYJB 3KAAA 2BXYA 4Q9BA 2PYFA 2XA3A 3FQRA 3MX0A 3G5YB 2FSEA 4MCZB 2NYYC 3RWIB 4HFWA 3N85H 4BQBA 4D9LL 3INUH 3NCFB 4UT9H 1BWMA 1MFNA 1UA6L 1I9RH 1J0HA 1IQDB 1RZFH 2FYYB 1KT2B 4FTVB 5DVKA 4IMLA 3O3EB 1KCSL 2BRQA 3KR3H 4W6YB 1DDHA 4MNGE 1JHKL 3G5XB 1BZQK 2H32A 1CQKA 5I1AB 4JJ5B 5E4EC 1MJ7L 4LAQH 3SDAA 5TE6L 5C9JA 1FPTH 4WW2F 5D8JH 1YDPA 1ZHKB 4LLYA 5JW3L 5J1TC 2OTUA 3HCVB 3HI1A 4OAWB 2CIKB 1T2XA 3T1FB 3P2TA 5EORH 4WJ5A 3IDMA 1QRNA 3TIDA 5JLZA 2XWTB 1UM4L 3IFPA 4JDTH 4CN6A 4JO3L 5GRVL 4F37K 3OMZA 2Y36H 3O8XB 4P49A 3VI3E 3MBEC 1NC2A 3ZKXB 3VXRE 4M7LL 4PJ8B 2FJGB 1HHGB 3NZHL 3QULA 3RKDC 3VDBA 3HPLA 3L7FB 1KN2H 4YBHA 4WO4A 3RA7H 3RVTD 3FQUB 2XPGA 3QIBB 5GIRB 4N5ED 2APBA 2X4QA 5EC1B 2APVA 3U2SA 1BVLA 4L3AA 3GKWH 3BX7C 3G04A 2CKBH 4DEPB 3GM8A 3IDXL 3VI4E 5IJKA 6CGTA 2XA8H 3DSFH 3TZVB 3F7VB 1BAFL 5D5MA 1KCVL 1DEEA 4NP4L 1EHLL 3MZGB 3VMPA 3FMGH 1LO4H 4ALAL 1MVUA 1PKQE 1A7QH 3N1QC 4YHYB 3MGOA 5KW9H 4GRWH 1L9NA 4X99B 3KJ4B 5GHWL 1UQSB 1F4XL 1Z9SA 4JN2A 4PJFE 4YE4H 1BBJA 3EDJA 2ATPA 1SY6L 4XBEH 4GG6E 4KI5D 2VIRA 1KPRB 4ZAKB 3HG1D 3DUUA 1FIEA 3SGEI 1DLHB 3SKMA 3TA3C 5DQDL 5I17B 1EIBA 3CH1A 2C7UA 4L4TD 1RVFL 3L3DA 1S7WB 4KK8C 4Q6YA 1H9VA 3BJLA 4OM0H 4EQ3A 1FFQA 4MDJA 2CGRH 1WZ1H 4K7PY 1P7QB 4DJMA 12E8H 2VL5B 3TBVB 4JCMA 5L8LB 1ZA6A 4D0CA 1BBDH 1NMBL 4OT1H 3RDTC 1MCEA 3DGGA 3MYZA 4PYHA 3ZHDA 5DQJB 3C5SA 5J6HB 4OZGB 4UOJA 4F2MB 4KJPC 1LK2A 3CFDB 5EOCJ 5ICYB 3B2UD 3LH2H 5H35B 5DEGA 5I18L 1X5ZA 4XPTH 1MVFA 4XCFL 2O5XL 2ORBH 3OR7B 4ZXBB 1SYSB 2NX5B 1RUAH 2ZUWA 4YHLH 2VXSH 1HYRC 3HUJE 1WZMA 3TN0B 1YEJL 1LEGB 2EYRB 3RY6C 3SQBA 5JNYA 4MCYA 3MOAL 4ONHB 2HN7B 3RGVD 2QV2A 1A1MA 3RZWA 4CMHC 2AJZA 5TDPB 3WV0A 3FT4A 5IOPA 4U6HB 4PJ7B 4R4NC 4FQIL 1QBML 5C0BD 1YEIL 3H9SD 3VA2C 1ND0A 5C2BH 3JTSB 1H0DB 1BJ1H 4CMMB 1X5YA 5CJQL 2J8HA 3O2VH 3TH2T 1NJ9B 1ZGLP 3D39E 1ZLUH 4W6XB 3ZYJA 5B4MC 3MUZ1 3SKNB 1JYNA 3IVKA 1TJGH 1G9NH 1UZ6F 2AERT 3CLFH 3MYJA 5C0AB 3V0AC 3EJYC 3N50A 3FFCA 1ZA3B 4X7EC 4Z7WE 3T77B 5H37H 3CFBA 2BY1A 4FQHA 4MWFA 3KPMB 1XF4B 3FO1A 3L6FB 1CBVH 1CIUA 3BE1H 2Z31A 1Z2KA 4YDIH 3RUGA 3IJHA 3WDHA 2C1OB 1J11A 2NY2B 3VXTA 1QR1B 4LU5L 4PJAF 2FL5A 3B43A 5E6IC 3C09B 4PS4H 3ES6B 4ZDHA 3BDYH 4MQXD 3F6IA 1KB5B 2ADFL 3QIUB 5FYJH 3VRIA 2FGWL 4Q9RH 2DM3A 2PW2A 3QI9B 5FV1L 1A02N 3QYCA 4J6RL 1AGEA 4K7PL 4H5SB 5IVXF 1F3JB 1XZ0B 2E7LC 5CZVH 1P84J 2DB8A 4ERSL 5DO2C 5CWSB 1CICD 1HSAA 1S3KH 4DFHA 5DMGC 3B3IB 1B3JA 1JPTH 1U2CA 1OSPL 3C6SA 3D9AH 4YBLB 1UJTA 5I8EA 5JW4Q 4Y4FD 5BZDB 1KLGB 3BJ91 3HS0A 4X80L 3ARFC 2WINB 5TQ2L 5E2JA 3FONB 4P4RA 4YNYA 5HHXL 4Y4HA 4UI2A 1HH9B 4JFPB 1MRDH 3VH8A 5JTWA 2R1WB 1NGQL 1Y0LA 3HMWL 4MD4B 3OGCB 3M1BB 4OUUA 3UZQA 1CE1H 5GRWA 5I1CL 5TGBA 3OAZH 5E0QA 4XVTL 3TM6A 1MFDL 2BSSA 3VG9C 1BVKB 1RIHL 2IPUG 2CDFB 2HT4C 4ODXA 2ZSWA 2E27H 2VABB 2X44D 1R3HB 1Z9OA 5HDOA 4F7CA 2ITDB 4BFBD 2EXWC 5IFAL 4G9FB 3V4PL 3MR9A 1XIWB 4BH8A 2BOCA 5JOFA 3WXWL 3Q6FA 4DW2L 1RHHB 1OAYH 4P9HL 4D8PB 2YXMA 3OXRA 3SCMB 1V7ML 2F19H 3SKOA 4U6XA 3WLWD 4HUNB 1MJJB 1T1YB 4JG0H 4LEXL 3CXDL 1B6DA 2DYPB 4X4XA 1NFDA 2DWEA 4ZQKA 3T2NH 3Q48A 4XNQB 4BQ8A 5IB5B 2H2SD 5C07A 2GK0A 2VISA 3RVVD 3QUKA 2AK1H 1JJUA 2QKIB 1NCBL 1U3HA 2QR0A 1LO3L 3WE6B 3WHXA 5T1DH 1AQDB 2MFNA 3HI5L 2AQ1A 4JDVA 4H26A 3M45A 5D93C 1WT5C 3CFEA 3O3DB 5AWNH 1OD9A 3B9KA 5B3NA 4OGXL 3VWJB 5GGTA 3CLEH 2PTTA 3U30B 1X5XA 4LFHD 2YUWA 5KSUB 1BD2B 3N9GH 1VGKB 3SDYH 4D0DA 1G7JB 3MRGA 2AJUH 4GRLB 3KLHC 5D7IB 3QCTL 3ZDZE 3JTTB 4U1HB 4Z9KB 1R5VA 2QQLL 2J4WH 4HIXL 3HAEA 1FAKT 4ZOAA 5D71L 5ESQB 4LCUB 4G9DA 1MIEL 1H15A 2ZUUA 2YD7A 5EO1A 4F7TB 3G9AB 3S9DB 4FG6C 3JBG7 4ZUTB 3V6FB 3TEUA 3TJHC 4QTHA 1KENL 2OBGA 4YHNB 1EFXD 3WDJA 4NDMB 4RNRB 1RJZB 3HB3D 1JGVH 1RJLB 3IT8D 4Z0XB 4X4ME 1AIFB 2CMRL 1EK3A 3PABB 4OKDA 3O4LA 1MH5B 3H7BB 4WEMB 2P49B 4FHBD 4I0PD 4JY6B 4NBXB 3WNNA 5KSVA 5I1KH 1KYOJ 1ORSB 1OAQL 1QQDA 4OB5H 3KPQA 5DK0A 2AV1B 5ESVA 1INQA 3O45A 4IOSD 5EU3A 1GGBL 1UJ3C 4GW1B 1IEAA 4GW4A 1T66C 1S9VA 3RBGA 4IRSB 1S5IH 2R4RL 1A47A 1G9MC 5DJZA 3LQAH 1EJ6A 3DRQB 3VXSB 1ZVSB 5BRZA 4XPGH 4ZD3L 1CD1B 1ZHBB 5IBUG 1NL0L 1D5IH 4HUWA 4MYWB 2HTLC 1BWWA 1GC1H 3T3PF 4ODTH 2G60H 3MQIA 4LSPL 1WWBX 2APXA 4XCEA 1MREL 4UB0H 4Y88A 2AK4A 3VFGL 2EH8H 1J8HA 1E0OB 3IGAB 4UINH 5AZEH 4IHOB 3DRTB 4PJIA 3KS0J 3ARBD 2VDKL 5C0RH 4Y5VB 1R3IH 4JRYD 3VGAB 3PQYB 1QNZH 4PIRF 4JAMA 3FB8B 3MJ7A 2WSKA 4PRPE 5JXEA 4BYHA 4MMZC 1VADA 1F5WA 3LZFL 3BWAB 1U8LB 1RZFL 1MFCH 2PYEA 1FLRH 5B39A 5EZLB 2OJEA 4FFVC 5KG9B 1S9YB 1FNFA 1K5NB 4LLMA 3UPAA 3VGGA 2BSTB 2VWEE 1AR2A 3U4BH 1AGBB 4Y1AA 5ALBH 1OTTD 3SBWC 4YAQA 4ZFGL 2EIZB 3QQ4B 4JRXE 3VFTB 1FYTB 5D8JL 3TNMA 3UTSE 5IMKA 2Z91A 1YYLL 1BGXH 2Q7YA 5F9JA 4PR5A 3I75A 5EORL 1D9KA 1VKXB 4AEEA 4CDHA 4Y4KA 1IE5A 5I19H 3GRWA 4ODHH 1I85A 1JRHL 1VPOH 1CR9H 3HE6D 1A7OH 2P8LB 4KROD 3TBSA 1IARB 3O41A 5SWSA 5D1ZB 2R2HB 1NBVH 3IKCB 1BFVL 4LLWB 1QA9A 1I9EA 3LS5L 1KN2L 4JFHE 3LN4B 4ZUUA 4WDIB 1JK8A 3VE0A 1CN4A 4S0SD 5EU6D 2EDJA 3MLZH 1OGAE 2QTEA 4R4BA 3KGRA 2AJXL 1EAJA 1U8JA 5ICXA 3GKWL 1A6AA 4LASL 1LNUB 2CSPA 3S96A 2XA8L 1U8IA 3DSFL 3O3BA 1WC7A 1KB5H 4ODSH 1ZOXA 5ID1B 3FQWB 1KBGL 1YEFH 1FIGH 1GZQB 2J8UB 2WQ8A 4PRDA 2VDOH 1ITBB 4BFIA 4ELMB 1DN0A 1WEJL 1A9EB 3V0VA 4KI5F 3H9HA 4M7ZB 3GDBA 5KW9L 2R29H 1HI6B 4FQQA 2APFA 5HDQL 4MLIA 1JWSA 1A22B 1DQDH 1I7RB 3WFZA 4LVHC 3MRBA 3MJ9A 4JANA 5I74B 1FAIH 2PO6A 5JPMA 1TPXC 4K94C 4MVBC 1CT8B 4OV5B 2CRIA 5EH1A 4P2QA 2IPKB 2JCCB 1O7SA 1UYWH 3DVIA 2KBGA 1OT2A 4OM0L 3LMJH 2XWJA 1ZGLB 4HZLB 4K2UH 2CGRL 4KGLA 1QEWB 4JGMA 12E8L 4ODVL 5HHOE 5FOBB 5DVLA 4I13B 1BBDL 1UWGL 4YBQD 5DSCB 1EJOL 4N9GB 2V5RA 3VXUE 1T1WA 2GJ6A 3SE4A 1K2DA 5IUSA 5KS9E 1ORQB 3PL6A 5ITFB 4XPTL 4JO4L 2ORBL 4G42A 1KC5H 4ZOEA 4FQJL 2VXSL 3MV8A 3QR2A 4HMCA 5C09A 1AD9B 3V6OA 2PTVA 4PJ7E 4LRNL 1XGYL 3IDIA 5HGBA 2R0ZH 5EOTA 1C5BH 4GW5B 3EYOA 3TO2B 2EDFA 3PWNA 4P59H 3P0VL 3UEZA 4TUKH 3OHXA 4CADB 1TTFA 2YA1A 4MS8D 5CIPB 5IHZB 1S7VB 3BW9B 1E4XI 1J0IA 4PP2B 4E42B 5C0AE 5ADPH 3EZJB 4X5WB 4MJ2A 3V8CA 2HH0L 3BP6B 4J4PC 1G1CA 5C2BL 3FTGA 1FVEA 3S5LB 1UEMA 2N7BA 2IF7A 1PBYA 3MACH 2FIRT 5E5MA 2R8SL 3GK8H 1FVCB 3GSRB 3HZMA 5E1AB 1NEZB 1TJGL 1TZHA 3WKML 4JZJC 5GJTH 2Z35A 1IGYB 1MPAH 4NO0B 3S3SA 4APQB 2DTSA 3GBMH 4PJDA 3LEXB 1CBVL 1ZLVH 4NOFA 4FN0A 4HIHB 5DK2B 1MLBA 3VXRD 5BQ7A 2EYSB 4YDIL 2B5IC 3U7AA 4PJ9C 5FO8B 3UTTD 4X9IA 1NUNB 5IVNA 1KJ2A 1CE6A 3C8HA 2YZ8A 5KVMC 1KJ3H 1U6AH 1U95B 3TBYB 1P4IH 3TT3H 5L0QC 4N0UE 4I18A 4UZGA 5F6HJ 4JY4B 3O3AB 4ZS6D 2IANB 4AG4L 2V2WA 3FN9A 5IKCA 1U8NA 2NY5L 4RGOL 3SY0B 4YDVB 5INDB 1SEBA 1MAMH 5D2NB 3P4LA 2YKLH 4X98A 3ZE2E 4YZFF 2KQNA 3O6FB 1AXIB 4DGYL 1B88A 1ZT4A 4L5FH 3JVGC 5HHNA 1K8IB 2HTKC 1NBQA 4XWOC 5IVZB 1JZ3A 1TTGA 5K9OA 1YPZF 3IAGC 4XPHL 2XV6B 1G7MB 2GEEA 1HHKA 32C2B 1JMXA 3O6LH 4ZSOE 2HFFB 2Q20A 1MRDL 4LLDA 3IDGB 5F1NB 4EXPX 1KNOA 3BPNB 3QUZC 3S35L 3CMOL 5FO9B 3LDBC 3TH3T 4MNHA 3REWB 3KPRE 2JJVA 4M62H 2NY4B 4B41A 2J12B 4HBQA 4HGKC 2J3SA 1CE1L 4L8DA 3SGEH 2J8OA 4YC2B 2W65A 4GKZB 4X9FA 1RAMA 5GGSB 4FFYH 1VDGA 4F80A 5E2WH 5IJVB 3EYSL 1MHCB 1S7RA 2XKSA 4NO2B 5JO5B 1FBIL 3B6SB 3G6JF 1Q0YL 3QPQD 4XNZB 3GBNL 3SO5A 4LSTL 4NHCH 4E9LA 3EYVA 4I9WE 3VD7A 2W9EL 3CXHK 5LGHH 2F19L 2H2PD 2CDGB 2NXZB 2YUVA 3MO1B 2N7AA 3GO1H 1UB5A 5ESAB 3EBAA 1R3LB 4G8GB 4D0BB 4J3XA 5T3XH 1BLNB 2H3NB 5FIEA 1KIQA 5GGRY 4AEHL 1HXYA 4J12A 1T1XA 2AK1L 3ZDYF 3UJJH 2FH6A 4LLVA 2XZQH 5D1QB 4EDXA 3QEQB 1HEZB 3AXLB 5T1DL 5HYSB 2E5EA 4J23A 4P2RB 5BW7C 4FQ2H 3OXSB 4WFFD 2C4FT 3MLTB 1S8DA 4HK0A 1BJ1J 3B5TA 3EZ8A 3BD5A 3PJSB 5AWNL 1ODAA 3W0WA 2G2RB 2XNAA 1Y6MR 5FA4B 4JKPH 1NC4A 1VSCA 2VTFA 3OKYA 4WUUA 4PGEA 4N90E 4LSRH 2H6PB 3E6HB 4ZOBA 2G9HA 3SDYL 1KCRH 2HFTA 5DGQA 3WIHA 3G9VA 4S2SB 3P9MB 5D2LB 2H45A 2A1WH 2QHLA 1JF5A 3V6BR 1DQQB 5DHVA 2FEDC 4Y16A 5F6IB 4M9PA 4N8CH 1D5ZB 3PGFH 5CLTA 5CP7A 4UBDC 3VJ6B 4XAWH 3VXMA 1R5IA 2G5RA 2EDXA 4IS6B 5I1IL 2UWEF 5HI4D 2VLJE 3EIFA 5EZIH 3U4AA 1YEDA 3IFOB 1JGVL 4HQQH 1LQSR 4K9EH 3TGXA 3SE3C 1AFVH 1AP2B 3VD3A 1VACB 3OKLA 4JDZB 3BN3B 4K23H 5C6TH 1ADQA 3RU8H 3MCKB 3QUMA 5CBAB 3FB5B 2ZUYA 1T0MA 4OB5L 3DI2B 3I3DA 1EMTH 1GZPB 4Y7MA 5IB1A 1Z0NA 1ZS8A 3ARGC 3N1PC 3VFMB 3VD9A 2XTJD 1S5IL 1R6VA 2GSGA 3EUUA 3KPPB 1LP9F 2DWDB 5GS1A 2BVOB 3LQAL 3ARYA 5BVPL 1KB9J 4I3SL 1MUJB 4HC1H 4YGVA 4X7SH 1I9JH 4ZUSB 5IEKB 3PV6A 3FT3A 3TNNA 2NTFB 4X6DF 4AM0A 1UVQA 1J10A 5GGUA 4Z77B 3LV3B 3RWDB 1JNHB 2VDLH 1V05A 1IILE 4NKOB 4QRPB 4Z7UA 4K3JL 2VOTA 1EEYA 4UINL 5HI3D 4DAGH 5JZ7C 2X1WL 4WW2C 3ARUA 4K55A 5A16A 4WCYL 3KYOA 3K4AA 1YQVH 2F54D 5CHNA 3RAJH 4BUGA 1QSED 2YXFA 3FRUA 2D7OA 1UB6A 2GCYB 3IFLL 4DZ8B 5FUCC 1FZOA 2DM2A 3OX8B 4J8RA 3UYOD 1SBBA 3WUZA 4I5BB 5J0BA 1FLRL 3QXDA 3SDDC 4KI1A 4JB9L 4PJEF 1HYSC 4NRXB 1FFNA 1MCOL 4OCLC 3BQUA 5CIPH 3U4BL 5ALBL 2F8OA 4H88H 5J12B 2PXYA 2F8XC 2QQQA 1UJ3A 5KSBB 5L2KE 4NUJA 1BGXL 1Y18A 2FX9H 2VR9A 1H3WM 1E4KC 1MCWW 4MA7H 5I76A 1E27B 2EH7H 9CGTA 3BH9B 4WV1C 3X13A 2E9WA 1NBZB 4NC0B 4TNVF 2Y07H 5SWZB 4WY7L 5I19L 5T5FH 2F74B 3CSPA 1DQLL 1WJ3A 1I4FA 4ONOA 2VXTH 5HYEA 1IGFL 2H41A 5IFJA 4ZS7L 3MRCA 5D70H 3T2QA 2NY7L 1NBVL 2PW1A 5CGTA 1VGEL 5JXAL 4U1MB 1U3YA 1UXWB 2J8UE 5DGRA 1DLFL 3QUYD 4HLZH 2FHBA 3QDJD 2AXFB 4ELME 2KZ1B 2D0HA 5LBSL 3H3PH 1U93A 4QRUA 3FHQA 4R90H 4C56D 4KKBD 2BNRD 5ISZB 5GZND 1OB1A 4P23A 1A5FH 5A43C 4LVOB 2PYFB 5JORA 1KB5L 1IKFL 3QNXA 1FIGL 3FQRB 4M61A 2FSEB 4IRZH 4CBPA 4HFWB 5IIEA 4OFIA 2VDOL 2ARJQ 1MCQA 5J57B 2DQGL 3QG6A 4LVEA 5KSAC 3ZZ1A 4LHQB 4KQ3H 2R29L 1FH5H 4PJXE 3IB4A 4IMLB 1KFAH 3HE7D 4TTDD 4Q9QH 5JQ6H 2HFEA 5FYKU 2VR4A 2ZCKH 4EI5D 1S9XA 1EEQA 1DDHB 5TE4H 4ENEC 5KN5A 2I9TA 2H32B 2W1NA 4EUPH 2BNQD 2E8YA 4KVNL 35C8L 1OW0C 2IQAA 2VLRE 4N0YL 1KN4H 3B5HA 3VU2A 3SDAB 5C9JB 4XP4H 1JP5A 1YDPB 4NN5B 4JHBA 3SDXE 4QHNA 5DRWA 4LLYB 5BS0A 2Q8BL 4P57A 3LMJL 5D7SL 2OTUB 3HI1B 5D7LA 3CX2A 3UTPD 1ZTXH 4WJ5B 1G1YA 1QRNB 3IDMB 3TIDB 5DZLA 5JLZB 4Z8FH 5HYJD 3IFPB 3EDKA 4Y0GA 1RUKH 1NC2B 2FO1A 3WFCH 4XCCH 3L3JA 4KDWA 3QULB 3E8UH 3HPLB 4OZFG 4FTVD 1KC5L 5I73B 4WO4B 2XPGB 4ZYKA 2X4QB 3GFUA 4KK6D 3U2SB 2BCKA 1BVLB 1KXVC 1IAII 5GS0H 2DI7A 3G04B 4PRPD 3U9PH 5EULV 1C5BL 2FX7L 4LSVH 3B4NA 3O2WH 2AXJA 4P59L 5D5MB 1DEEB 2X4SA 3RKPA 1H8OA 2QADC 3GHEH 1MVUB 3MGOB 4MZ3A 2O5YH 5LG1A 4O02H 4JQVA 4JN2B 1BBJB 2LU4A 3O8XD 4QRQA 3NVQA 4M6MH 2ATPB 5DS8A 2VIRB 2AEQH 2ZG1A 5FB8A 3GK8L 1R5WA 4PJ8D 3DUUB 1CK0L 3SKMB 3CH1B 2RHEA 2C7UB 2L7UA 5GJTL 3L3DB 2XTLA 4WWID 1I75A 1JWMA 5HPMA 4JO1L 1MPAL 4OZIA 2C9AA 2IANE 4MDJB 1BVZA 2FBOJ 3CSBA 1ZA6B 4D0CB 5HYFA 5SX4H 3BN9C 3JV6A 4KJQD 2ZOKA 3DGGB 2NW3A 3TZVD 3CX5K 3KPSA 4OBSA 4FP8L 1KJ3L 1U6AL 3TT3L 1JZ2A 3C60A 1LK2B 3VI4F 3MC0A 2OK0L 1OGAD 5DEGB 1DVFA 2MHAA 3QJHA 1ZGLM 2YKLL 3ROLA 3UAJD 3SGJC 1NFKA 2VSDA 1WSST 2MTPA 1S78D 1AJ7L 4ZAKD 4PJFF 1A4JA 2ICWA 3OKDA 1Y6KR 5JNYB 4MCYB 2N1KA 2IAMA 4GG6F 1OP3K 1YN7A 5EZOH 1N8ZA 5C0GA 1A1MB 4W68A 2VLKA 1KGCD 4Q74A 3H3BC 2AJZB 3FT4B 3PIQA 5IOPB 2WK2A 4FMKA 2VKWA 1CWVA 4KZDH 1ND0B 3TO4C 4LP4A 4PLKD 4BSJA 4AIOA 2BMKA 4RGMC 2AKRA 1QZ1A 2FO4A 1U41A 2F5AL 3D85A 3DROA 3IVKB 5LVEA 1G84A 3QFDA 1CLYH 3MYJB 3BP5A 2Q87A 3CC5A 4FFYL 4WHCA 3FFCB 4ZXBD 5F9OL 3MRJA 1ZT1A 4M7JL 5C71A 1AR1C 5HHOD 3CFBB 3JWDC 4FQHB 4MWFB 3OSKA 3FO1B 3TN0D 4DKDC 4BZ2L 4JR9L 4DZBA 1XEDA 2B1HH 2Z31B 1KJMA 2VQ1A 3HUJF 1JPGA 3RUGB 3IJHB 4PJCE 1VHPA 4NHCL 5JW4R 4IDLA 1H5BC 3RY4A 3VXTB 4P4KC 2FL5B 5LGHL 3MOQA 4OZHF 4XTRD 4CU6A 3UTZA 5B38G 4P2RE 4ZDHB 2EDRA 3T0EA 4QXTA 4C58B 1UEYA 1GCFA 5EBLA 3VRIB 2PW2B 2DTMH 1AGEB 1YEKH 4HH8A 1YJDH 1YY8A 3NGBC 3EYQD 3DURA 4OLEA 3K4ZA 2XZQL 3I6KA 1HSAB 2A6JA 1CXLA 2GY5A 3C6SB 5C0AD 1L4IA 4L8BA 5I8EB 2EDQA 5D2LE 3HS0B 4BH7A 2NZIA 5EUOE 5F96L 5HGDA 2NW2A 4CVXA 4KKLD 4E41A 1I1AA 3GSVA 3DNKA 4YNYB 4P4RB 1EDQA 4Y4HB 4EN3C 1FGVL 1WUNT 4RBPH 4KK9D 2NY0B 4Z7WF 1JZ7A 3I50L 4M7LT 3VH8B 4HBCH 4U1GC 1VESA 1Y0LB 2NY2D 4FNLH 1MFAH 2X1QA 2VDMH 4OUUB 3SGDI 2A6KA 1S7TA 3LPWA 1TCMA 3DUSA 5TGBB 3VGEA 2BSSB 3QI9D 5E6YA 3Q2CA 1W8OA 1VA9A 4ODXB 2ZSWB 4XAWL 4U1NA 1UH2A 4LCWE 4F7CB 1RZGA 3GI8L 3NAAH 5EZIL 4BH8B 3MR9B 2BOCB 5JOFB 3Q6FB 4YPGA 3DYMA 4K9EL 3UZVB 4Q6IA 1AFVL 1SVZA 3OXRB 3BEVA 3SKOB 4U6XB 4LCYA 3GHBH 1BQHA 4X83A 4X4XB 4K23L 1NFDB 2DWEB 5C6TL 1U8OA 2AW2A 4TOYH 4ZQKB 2Z8VC 3RU8L 5C07B 2XT1B 4OCRH 2GK0B 2VISB 2W38A 4PJGA 1GGCH 3QUKB 4M1GH 1EMTL 1H3GA 1U3HB 2QR0B 2R69H 2H32H 4YK4B 1I3RA 3WHXB 2MQ3A 2ERJB 3DX8A 1KTRL 3F7YA 4JDVB 4OSUL 3K46A 4H26B 3LKPA 3TFKD 2XQBH 4KMLB 1X4ZA 1PQZA 4HC1L 5IROC 3ARDD 4K8RH 1I9JL 1DBJL 3VFVA 3X3GH 3CFEB 2XRAH 3B9KB 1HDMA 4GO6B 2QJDA 3KPRD 1CXIA 2PTTB 3ECBA 4CJ0A 4XP9L 4G9FD 4D0DB 1XIWD 5F88A 4DAGL 3HNVH 3MRGB 1CDCA 3MRKA 4P0DA 1R5VB 3HAEB 1AO7E 3QXVA 4G9DB 1YQVL 3ESVF 1IGCL 4N8VG 1H15B 1O5DT 4OF8A 3C6LA 1MJUL 3OG4B 4JKKA 1GAFH 5EO1B 1BF2A 4HCRL 1HQ4A 1Q72H 1EGJL 4JLRA 1M6OA 5E8OA 5DUBA 5HTSA 4I9WD 1KEMH 4QTHB 3RVTC 1Z5LA 4FXLA 1N0LA 3LCYA 5TDOA 5K59E 4ODUA 3LKNA 4N5EC 5DXWA 4QY8A 1NMAH 4WI3A 2NMSA 3O4LB 1TQCC 4DQOL 4XI5D 5F7KC 1N7ML 2EDNA 2C4FU 4EBQH 4CN4A 3VWJD 5KSVB 4NQCE 1MCRA 1QQDB 5DK0B 2EIEA 3KPQB 4ZO8A 4WTWA 1BD2D 4MA7L 5ESVB 1INQB 1XFPA 3O45B 4GRLD 5EU3B 1FGNH 3RVXD 4KFZC 1GXEA 4FQLH 1IEAB 1Q0XH 2Y07L 1CXEA 4GW4B 1NGYA 5T5FL 4OD3H 1S9VB 2IBZX 2DDQH 1HSBA 4YWGL 5KVDL 3MOBH 2BP3A 5DJZB 5F1SA 3B5GA 3ZDZF 4EQ2A 2GITA 1G7QA 5D70L 4N90D 4HJ0D 5BRZB 1AXSA 4Y19A 4QWWD 2IPUK 2VH5H 4HUWB 4OCYH 1HKFA 3M8OL 3DSNA 1IBGH 2NZ9D 4LNRA 4XCEB 5E56A 2AK4B 3H3PL 2EEBA 4F3FA 1J8HB 3RWHA 3UBXA 1CG9A 4R90L 4PJIB 1T0NA 1RI8A 2N4IA 2CK0H 2CKNA 1QBLH 1KTDA 2BNUA 2IH3A 4OF6A 4FXGA 4L3EA 5EN2A 4JAMB 3MJ7B 5FUZH 5SX5H 1TTUA 1VADB 5CILL 2VLJD 4TUOA 4S1DD 1P1ZA 3G5VA 3E6FA 5HVGB 4KQ3L 1FH5L 3B2UC 4I2XA 3RPKA 2PYEB 5B39B 2JJTC 4Q9QL 3BOVA 3EOYG 5JQ6L 2OJEB 2J2ZA 2UUDK 2DF3A 4IRSD 1FCCA 4GAYA 4LLMB 1QRNE 2OP4L 3ZKSD 4OCSL 4Y1AB 2L7JA 2RJMA 4YAQB 1E4KA 2A74A 1KN4L 4TRPH 2VSCA 4XP4L 5ERWA 3TNMB 3BRGC 5IMKB 3NFNA 2Z91B 3G6AA 3MFGB 2Q7YB 5F9JB 1DN2A 1II4E 5JIKA 4PJ5E 4PR5B 4GKSA 1ZTXL 3I75B 3TJEL 4K3EH 4LCIH 3CDFA 1D9KB 4AY0A 4Z8FL 4Y4KB 1E4WH 2WQRA 3PQYD 4WUKL 1FSKB 3LIZH 3RI5F 5F7UA 3OKEA 3TBSB 4YLQT 3O41B 3V52H 5SWSB 1FG9C 1IGIH 4WU5A 3SPVA 5L6YH 3E8UL 1QA9B 1T2QH 5D5ME 3MBXH 3WN5C 2NY1B 1T22A 4RAUA 4ZUUB 3VE0B 1JK8B 4IIQA 5T3XD 4R4BB 3W9EA 1U8JB 3WUWA 5ICXB 3BPLC 4PJBE 43CAA 1A6AB 5T1LA 3U9PL 5KJRH 1XF3A 1QTYT 3S96B 3O2WL 3ULVH 1U8IB 4QHLA 1F3RB 1WC7B 3O3BB 4FZEL 1FYTD 4JQIH 5DJ0A 3L3GA 4NQEA 4PRDB 4FQXA 4BFIB 4H25A 2JELH 3GHEL 1DN0B 3DTXA 3V0VB 3H9HB 4MQXC 4FQQB 1O0VA 1J0YA 1BQLH 1OP5H 1JWSB 2GT9A 3KYKL 3MRBB 4BA8A 4RGNB 4JANB 2AEQL 2PO6B 5L2KD 5JPMB 1CICC 3PDGA 5D1ZD 4Z78A 4HWNA 4PB9L 1I8KA 1R3JA 5IM7A 1WGOA 4P2QB 1OAUH 5DD6A 4HG4J 2X4UA 2IWGA 2XWJB 3AREA 4Y4FC 5E6ZA 2P24A 3RPIA 3BGFB 4YX2L 4G6FB 4LVNC 4NN7C 5MERA 3D2UA 4OUOA 1BJ8A 2XG4A 3HZYA 4AEIH 4MXWH 4R0LC 1T1WB 2GJ6B 4YIQA 4CDGC 4WEUD 3Q6GL 2F5BH 4IOIA 1K2DB 3OKOA 4JCLA 3BEWA 5HGGS 1SJXA 2WP3T 2FLBT 3PL6B 5E2UH 1RJYA 4LIQH 3ZMRA 4G42B 3WYRA 2R0KH 1WIPA 4HGWA 3HRZA 3QHTC 3KXFA 4N0FA 1S9KC 3MV8B 5GRVK 2R2BA 5C09B 4RMVA 3IDIB 5HGBB 2ZWLT 5EOTB 2YD9A 2P5WA 2EXYD 4KJPD 5IBLD 3EYOB 3CDYA 3PDDA 3PWNB 1IKNA 2OSLA 3OHXB 4F15B 3C5ZA 3QJFA 3DWTA 2HYMA 3VGFA 1YMME 4UQ3A 4NM4H 3WLWC 3IAPA 3FFCE 4KZDL 1XGTA 2H2SC 3FTGB 1FVEB 3RVVC 1X6LA 4ETQA 5E5MB 3QO1A 1D7FA 1J1OH 3ARPA 3HZMB 3RUGE 4LHUG 3JZ7A 5GGTH 4RX4A 1CLYL 1TZHB 4U2ZA 1LILA 2Z35B 3MRNA 3I2CH 4EI6A 1IZJA 2R4SH 5KS9F 1PKOA 4PJDB 5IESH 2OTWA 3KYNA 1KPVA 2WWKT 5I1HL 3U0PA 4XCNA 4XH2A 1MLBB 5FYKE 2B1HL 3HAEH 5BQ7B 1F97A 1ZANL 4GSDH 3BPOC 1E6OL 2BVYA 2D9QB 4Z18A 1KJ2B 1CE6B 4PJ7F 2DIAA 4OFYA 1QG3A 4I18B 4POZC 3P4MA 3J8F7 2V2WB 5C0CE 5IKCB 1U8NB 2DJSA 3F7QA 1SEBB 4HWUA 5CP3A 1YEKL 4HK3J 5DQ9A 1A2YA 2A38A 2O5ZH 4X98B 4WWKA 3D6GA 3HNSL 5DMIH 4O2EA 5D1XA 4NC1E 1ZT4B 1AY1H 5HHNB 5FF6A 3H8NA 1JI1A 5K9OB 3HB3C 1WITA 1E6JL 4NO0D 2ITCA 4APQD 4G3YH 1HHKB 1E4XL 4U0QB 3VRLE 3E2HB 3UTQA 5DO2D 4I0PC 4LLDB 5MP6H 1YC7A 1KNOB 4HBCL 4OLXL 5I15L 3OR6A 1F58H 4MNHB 1DBMH 4FNLL 4L9LC 4PGBA 1P4LA 2VDML 4L8DB 2RGSA 3I02A 2IAND 2J1KA 2W65B 1HQRA 4L8SC 4PRHA 1RUPL 2B1AH 2YRZA 1S7RB 2VERN 3I3EA 3L3HA 3W2DH 4JPVH 5IP4A 5CAYB 1NBYA 3NAAL 4PG2C 7CGTA 3U36A 4WTZA 3EYVB 4TQEH 1L6ZA 4D9QE 3ARBC 2PN5A 4F7EA 1UB5B 1N4XH 4N9OB 5JUEH 4PTUA 1KIQB 1HXYB 1T1XB 1ZKAA 4M1GL 3X12A 5FUCE 1CZ8H 4YPJA 3ZTNL 4LLVB 5MEOA 3GSNL 4EDXB 4WI2A 5FAAA 4PJHA 2B0SL 2AJSH 4W4OA 4TNVK 2OL3A 1SJHA 1GPOH 4HEPG 1M7XA 1BM3H 1S8DB 4HK0B 4PY8J 2IFFH 2XRAL 4B5EA 1A8JH 1PZ5A 1OTTC 3W0WB 3H2WA 1CF8L 2XNAB 1U2HA 1NC4B 4PGEB 4WUUB 3CUPA 3GRWH 2Q3AA 2G9HB 4IMKC 1RZKH 4PLOB 4AIXA 1JV5A 3KJ6H 2V5TA 5FYLE 4IRJA 1DE4A 5GS0D 4V2BA 5F7EL 5DHVB 1ZT7A 3DJ9A 4ONGH 5CJXC 2DD8H 4Y16B 3SKUD 5JHDA 1A3LH 3A6OA 5IEHA 3HE6C 3O4LE 5BOPA 4KTDL 1X7QA 4KROC 5CP7B 1Q72L 4NN6C 1MHEA 3VXMB 1R5IB 3CZFA 3GSUA 4MQTB 4XGZA 5C6PB 1HE7A 2ICWI 4XCYA 2VZOA 1L0QA 2LVCA 5D1QD 3QEQD 2KL6A 2QSQA 4KKAD 3HNTL 4X6BA 4KZEH 1G7PA 3BIBX 4E0RA 1YEDB 4P2RD 2NQCA 4KXZH 1NMAL 3OKLB 1LGVA 4P46A 2C3VA 1HHJA 3HC4L 1G0DA 4FG6D 5D7IF 3V9FA 4EBQL 1YUHA 1MWAL 4MNQE 2DL2A 5H2BA 4KGJA 3QUMB 5JW4M 3HTLX 1T0MB 2BY3A 4M00A 3LKSA 4R26L 5IB1B 1ZS8B 3MJ9H 1FGNL 4FQLL 3BRDA 2YPLE 1YN6A 5LXGH 3F8UB 2DDQL 1IC7H 5T5NF 2GSGB 1RZ7H 4KTYA 3MOBL 4LF3B 5GS1B 1RHFA 5T33L 4D3CH 3ROOA 2JF1A 1M05A 5AYUH 5FUOH 4R7DA 4YGVB 3CPLA 3SQOH 3MLXH 3PV6B 3FT3B 3TNNB 1C12A 2AEWA 2LV4A 4OCYL 4QRTA 4AM0B 1UVQB 5MENA 2FBJL 5GGUB 3JV5A 4JFFE 4JM4L 3IKKA 3BGMA 4HZAA 4G7YL 4Z7UB 1EEYB 1UWXH 3NH7L 4EUPG 4Z7NE 4ACPA 1A6ZA 1VERA 3MV7A 5A16B 2CK0L 3KYOB 1QBLL 3R06A 5CHNB 4YBQC 3SO3C 5FUZL 5GGVL 1ZSDA 3FRUB 3TESA 5GSRA 1UB6B 2AEPH 4P9HC 5ENWA 4YHKH 2YC1A 1MFBL 1FZOB 4J8RB 2W60A 2NY6B 3QXDB 1DQMH 3BZEA 3QDME 2XN9A 4R2GB 3OAUH 5IGXH 4DGIH 1FFNB 1D3CA 4PFEA 3ULUH 2IJ0C 2X2YA 5E94A 1GIGH 1X9QA 1SBSH 3BQUB 4U0RB 5CKGA 4QRRA 3THML 2PXYB 2MPAH 1UJ3B 1TITA 5HHVL 3LB6D 4NUJB 5K9QI 1Y18B 4U1KA 1QLEH 4MS8C 5ABDE 1FZKA 5I76B 1L7IH 1F4WH 1X5KA 1NCWH 1XR8A 2C3XA 4MZ2A 2F53A 3P4NA 4QRPD 3X13B 3OAYK 1T7WA 1AKJA 3I6LD 1I4FB 3LIZL 4AZ8A 5IFJB 4JE4B 1FC1A 4UTAH 3WNPA 4HKXA 5DJDA 3MRCB 4J3SA 1IAIM 3PV7A 1IGIL 1MF2H 2PW1B 2J6EL 4NKQB 1T2QL 3MBXL 5IVXE 5IWLC 2VL4A 3CVHL 3N1MC 1AO7D 1KJ2H 1U93B 4NJAH 4QRUB 3VFPA 3QP3A 1KUMA 1A7PH 1OB1B 1F4YL 5DRZA 4P23B 4LSQL 4U7KA 5IVOA 1MJ8H 1HINH 5JORB 1KACB 3QNXB 2X1PA 4JQIL 4RGNE 2J88H 4M61B 5DVNA 5IIEB 2JELL 4JGUA 3QG6B 1MEXL 1DFBH 1KLFA 2RB8A 4ZS6C 1S7SA 5SWZD 1BQLL 5JPNA 2HFEB 3MA9H 4JG1L 1GRWA 1S9XB 2QBWA 3MLSH 1MCPH 5KN5B 4P9ML 3IDYB 3QDGA 2I9TB 1RURL 4HW6A 3RGVA 1KTKE 2IQAB 3NCCB 3HFMH 3ZSSA 2IFGA 1OAUL 1MCKA 4QHNB 5DRWB 1C16A 2X41A 4LARL 4P57B 4AYFA 4LBEA 4LEOA 5BS0B 5F9WB 2FD6H 2CO7B 5D7LB 3H9SA 3HI6L 1VFMA 1QOKA 2J8UF 4Z0BL 5L88H 1CVSC 2YA0A 3TYFA 5IT2L 5DJYA 5ISZD 4ELMF 4AEIL 3Q5YA 5C09E 5AUMA 2CJUH 1TVHA 1T20A 2F5BL 4IDJH 3L3JB 4Y8AA 4YDLB 4TSCH 3ULUE 4LIQL 3K0WA 2HP4A 4GXUM 3QFJE 4IBLT 2V2TA 1P7HL 3TCLA 4ZYKB 1RUMH 2BCKB 3FO2A 1EXUA 2V5MA 4RAHA 5MI0C 3AB0C 3QPQC 3SDAD 1A9BA 2DRUA 2YN5A 4LDOB 2X4SB 2E9BA 4ETYA 4K8RD 2H2PC 3SDXF 2DQUH 3I9GL 1CICA 2GKIA 1QRND 3VFRA 1A14H 4Y5XC 4ODBD 2EO9A 4FZ8H 1U8HA 4QRQB 4C57C 4OIAA 3VWKA 3LRGA 5DS8B 3ZKND 5FB8B 1LD9A 1R5WB 4I1NB 5I6XC 3ZO0A 4JFZL 1JNLH 4Z7VE 5GGTL 3HR6A 2OR7A 1JWMB 1HH6A 5HPMB 5C70A 2XZCL 2R4SL 4OZIB 5FM5M 3UBXI 4KAQH 3WIHH 4QOKA 4PREA 1PX3A 2H9GA 4S1SH 4RCAA 4F9LA 1TENA 2HWZH 2NXYB 4M3JA 5DHVH 5GJSL 5JIIA 3JV6B 2ZOKB 3ZE0F 2NW3B 4IM8A 3GMMA 5DUMH 5C92A 4JFDA 3KPSB 5JR1H 5F1IA 1BFSA 4PGJA 1EFQA 1DANU 2IALA 3C60B 3C9NA 2AJVH 5J9PA 3KPTA 4XXDA 4GS7B 1CLZL 4MAYA 5FYLL 3FAWA 1DVFB 1TNMA 2MHAB 3QJHB 4N5UA 3ROLB 3W39A 4DVRH 2O5ZL 3L3KA 1BPVA 2FHCA 4OD1L 5DMIL 3TIEA 1A4JB 1IAIL 2ICWB 3B83A 3OKDB 4DCQA 1WWAX 2OTPA 3DX9A 4QF1A 1I1YA 3TVMA 5HI4C 2IAMB 1J18A 3QUMH 1YN7B 4OGYH 1N8ZB 5C0GB 4GOSA 1EZVX 3GJEA 4UNVA 2IBZY 4KDTC 2VLKB 4ZTOH 1KCUH 3T3PE 1RV6X 1MHPH 3PIQB 1WZKA 1CFTA 2CLRA 4NZJA 4U7SA 4ORGA 4Z6AT 4XWOD 2P43B 1DBML 4AQ1B 5HHME 4GFTB 1N2RA 2BMKB 4P2OD 2AKRB 2FO4B 2BJML 3D85B 3DROB 3O11A 4XHQA 4BSWA 2XTJC 3U1SL 1JPFA 3QFDB 3GJFK 5L8JB 3BP5B 2B1AL 3CC5B 2VQTA 4MQSB 4LCCA 4KV5E 1S5HA 3MRJB 1ZT1B 3TV3L 3QCUH 5J1SC 2X10A 4WU7A 2W92A 4DZBB 5L0QB 3W2DL 4JPVL 5I8OH 3AM8C 1KJMB 2VQ1B 4GQ9H 1I9IL 1JPGB 1A6TA 2ZCHH 3S8WA 4XC1L 1U0QA 4YUEL 2OR9H 4HX1A 3EO0A 3QHZL 1T03H 4J3VA 5HI3C 3MRFA 3F58L 3ZKMD 3UTZB 5DD0L 3T0EB 4QXTB 2FLRT 1A0QL 1N4XL 3NIGF 1NSNL 5EBLB 2HVKA 5JUEL 1J5OH 1G7LA 1RZJH 1EFXA 3W0WE 2M2DA 1YY8B 5GPRA 3DX7A 5DURB 3S7GA 3DURB 1CZ8L 3U7YH 3I6KB 1RPQA 5I8KH 5D96B 2A6JB 1OL0A 3DXAE 1GPOL 1YMMD 3O9WA 5EU4A 4L8BB 1ULVA 1OCWH 2DBLH 2IFFL 3FFCD 4BH7B 4CVXB 3TYGH 5HGDB 2NW2B 4E41B 2B4CH 4X7CC 1I1AB 3GSVB 3O4OB 1A21A 3HA0A 1G9NC 2OZ4A 3H6JA 2Z31D 2EZ0D 3EFDH 3KJ6L 3GIVA 1URLA 2GJZA 2A6KB 1S7TB 2Y25A 4PJCF 2JIXA 4XMLH 4ONGL 2OR8A 3DUSB 2DD8L 4E5XA 4KQ4H 2QSVA 2Y9RT 3PHQA 1QFPA 2LE9A 4PG2A 3ZTJG 3O6KH 3HN3A 1HOCA 1KB9K 5C2UB 3FO9A 2K9UA 3N1GC 4U1NB 4QYOA 2D7PA 4C59B 5KVGL 1RZGB 3LQZA 3QUYC 4L4TE 4DN3H 1D6VL 4KZEL 1F3DH 3MRHA 4YPGB 5C0DA 3T4AA 4Q6IB 2IG2H 2V17L 4QHKJ 3BEVB 1NLBL 4LCYB 5GZNC 4PUBH 1JPST 5ITBH 1BQHB 4UBDD 2D0GA 5C7XH 1U8OB 2W0LA 5D2LF 4XNUH 2NY0D 1OAKH 4PJGB 3DX6A 3IDNA 3ALWA 5EUOF 4DKAA 1J1XH 2HMID 1RZIA 4WEBL 4Y2DD 3SE8H 3SDCD 3MRDA 1I3RB 3B9VA 3HZVA 5KTEH 1MFEL 3DX8B 2OMNA 1IC7L 3GB7A 2VC2H 3F7YB 2FX8H 1RZ7L 3HE7C 4TTDC 3LKPB 4D3CL 4EI5C 1CDBA 2E8ZA 5CZKA 5AYUL 1QYGH 4YGAB 1PQZB 2AABH 2OLDA 3S37X 3SQOL 1CFBA 3VFVB 2F15A 1RU9L 5D7JC 1HDMB 4HF5H 2NY3B 3WO4B 3ECBB 3OPZL 3VFUA 4XVJH 5EU5A 1K9TA 5F88B 5FGBA 3WFDH 5TF0A 1NCDH 1LVEA 1OAXH 3MRKB 3TWCL 4P5MA 2CXKA 5LAXA 3MLRL 4AQOA 3C6LB 3NFSH 1HIML 1GHFL 5C07D 4UTBH 3PHOA 2KQMA 4YEEA 1HQ4B 2CRZA 1Q1JL 5E7FA 5IW3A 5K9KA 4JLRB 1U3HD 2ICEA 4JM2A 1M6OB 5E8OB 5DUBB 2DLIA 1DQML 3GMNA 4XPBL 4EJ1C 5JZ7D 4GAGL 4D9QD 1Z5LB 3VW3H 3ULUL 5TDOB 4ODUB 3LKNB 4KK6C 4QY8B 4BZYA 1SBSL 4ONFH 3T09A 4UV4L 5HGAA 4BUHA 3JWDL 4YR6A 3B9KD 4KKCD 1ITCA 1UZ8A 3FHAA 4OIIL 2OCFD 1ZLSH 4OQTL 3V8OA 3SDDD 2FR4A 1WV7T 5I30L 1PDKA 3KLSA 4NJ9H 3Q3GA 1NGYB 5E00A 2VWEC 3AY4A 1HSBB 1K4DA 3O8XC 1TZIA 2ZUQB 2GITB 1G7QB 3KWWA 5DFTA 4CJ1A 2XWBA 3ZKXC 1AXSB 4Y19B 4PJ8C 5D6DC 5CFHA 1INDL 2XIDA 1N59A 4LNRB 1T5WA 3MROA 3V7AE 3QIBC 1FNEA 1C1EH 3ZYIA 4F3FB 5KSBF 3RWHB 1IGJA 4NJAL 3UBXB 1CG9B 1T0NB 2VR5A 3WXVL 3O4LD 4IEFB 2DKMA 3VGDA 1HINL 1YPZE 5K59F 1KTDB 1Q38A 2BNUB 4DEPC 2IH3B 4FXGB 4L3EB 5EN2B 3TZVC 2UV3A 3V79C 4TUOB 4PYGA 1P1ZB 3G5VB 3E6FB 3IDUA 1DFBL 3T2OA 4Q9CA 4M3KB 4NQDE 4I2XB 3QAZB 3NTCH 3IJYA 3KJ4C 2YOCA 3H42H 3C2AL 3UAJC 1MCPL 4GAYB 3QXAA 2P8MA 4J2XA 1CGXA 1S78C 2A74B 4ZAKC 3MCLH 1MY7A 5ERWB 4NM8H 1FFRA 1NMCC 3NFNB 5EPMA 4MNGA 3STBA 1NGXA 3G6AB 3MNVA 5EIVA 2YPLD 4KUZH 2FD6L 5F9AC 3LQAC 2AK4D 4GKSB 3AS3A 5A40E 3P0YH 4PRIE 1J8HD 2YUZA 5L88L 4H0IA 4ZFZA 4XMKH 4GQPH 2K1MA 3CK0H 4JO2H 4PD4J 2BFVH 2WBJA 3BYYA 4C54A 1GC1C 2A77H 5E8EA 1INEH 1F2XK 3MODH 1WCBA 4PLKC 3OKEB 2D7TL 2FCBA 1WIOA 5L9DH 1P4BL 5JXED 4IDJL 2WBKA 5GGQH 3VD4A 4WU5B 3SPVB 2GUOA 3FFDA 2Z92A 1Z9LA 5EIIA 1T22B 4RAUB 2PYED 3ZDYE 4IIQB 4HK3N 1OHQA 4X6EA 1AGCA 4TUJA 4ZXBC 5EDXA 5H94A 1RUML 2F58H 3W9EB 3WUWB 5CSGA 43CAB 1NKRA 2C26A 5T1LB 3TN0C 5J56B 1N0XH 1MCSA 1XF3B 1Q9KA 4QHLB 2IH1A 3CU1A 4KJYA 1V7NH 2Z9TA 5DJ0B 3L3GB 1G0XA 1YNKL 3NOIA 3ARTA 5HGHA 4NQEB 4QGYA 4R97B 4FQXB 3LKOA 4H25B 4XTRC 2CXGA 3DTXB 4N1HB 3K80A 5E99H 5DT1H 3DVNA 3G5ZA 1D9KD 1HHHA 2PETA 4NCC1 4Y4KD 4FZ8L 2A9NL 2GT9B 3GKZA 1FDLL 3KHOA 1HILA 4Y5YA 1PKQA 4F57L 3EYQC 2WIMA 2QADD 5SWSD 4Z78B 1I8KB 2YD8A 4M8QA 1JNLL 1R3JB 1UWEH 3C8DA 5IM7B 5DD6B 1ZVYA 3WS6A 2X4UB 4GG6A 3TT1L 1OSZA 1JYVA 3AREB 4M6OL 4KAQL 2P24B 3RPIB 2MCPH 5D5MF 4KKLC 1GGTA 5MERB 2DKSA 3D2UB 3HZYB 3RIAF 4WHYH 4M43H 4KK9C 5CINH 5E9DE 5F7MC 4GKOA 3NA9H 5DUML 4YIQB 2DN7A 4ZPTA 2NY2C 4IOIB 3OKOB 3BEWB 2AJVL 2QQNH 3RHWF 3C09C 1RJYB 4WFGE 1RULL 4XT1C 5BXFA 4G5ZH 3QIUC 4HGWB 3HRZB 3E0GA 5TPWH 3QI9C 4DVRL 3KXFB 3BN9D 3U0TA 2R2BB 4OZ4A 4RRPG 2XYCA 3HLAA 5F21B 4RGND 3RX7A 5IB2A 2PO6D 2HLFD 1X4YA 1HWGB 2P5WB 4P2QD 2OSLB 3QUML 4Y5XA 3C5ZB 5KANI 2FHFA 3QJFB 4OGYL 4YBLC 4QNPF 4X6DE 2A83A 4U4BA 1KCUL 2ENYA 4UQ3B 3BD4A 4JRYE 4AEFA 3P77A 4G6FD 3SEPA 2FH8A 4R4FH 5GISL 3T3ME 5EOQH 1XGTB 3A67L 5F7DA 3SN6N 4EZMA 4ETQB 3QO1B 5IK3A 1MELA 5BO1H 3DO7A 1JMZA 3QG7L 1MCDA 3PL6D 3MGAA 5F71A 1QP1A 4JHAL 3TFKC 3MFFA 3MRNB 1WISA 2DIBA 4EI6B 5GS3A 3D39A 3V7MA 4LPCA 3MV8D 1JYXA 2OTWB 3KYNB 5C09D 4ZPVA 4PTTA 1KPVB 1CFSA 1P9MC 3KLAA 3U0PB 3QB7C 4XCNB 1IL1A 4PJEE 4XH2B 4XP5H 5F7HA 5I8OL 1KG0A 1TLKA 3GMRA 1E28A 1FZMA 2ZCHL 2I60H 1XIWC 1DSFH 3ULUD 2GW5A 5DJ2A 2W0FA 2H26A 3SE9H 1S7UA 4JHWH 2ZUVA 3P4MB 3QFJD 4OLVH 2WWKO 3N06B 1MQKH 1ES0A 5B8CA 4NNYA 1J5OL 1QFUL 2ZG2A 4G6JH 5DQ9B 1A2YB 2LAAA 3QIWA 4NQUA 5E8DL 3FAXA 4PLJD 4WWKB 4YDKH 2PF6A 3U7YL 4O2EB 5D1XB 1DL7L 4RWYH 5I8KL 3OV6A 4KDTA 1T6WA 1AE6L 5FF6B 1IVLA 4YFLI 4NGHL 1CGWA 3OF6D 3DGCR 1U42A 3RUGF 3TYGL 2ITCB 2ZKHH 4K71B 4UDTA 4I3RH 4XI5C 1D5BA 4NWTH 1U8PA 3UTQB 1FE8H 4JPWL 3VWJC 3U30C 3OR6B 3EFDL 1T7ZA 4JQXC 4PGBB 4GRLC 3RVXC 1P4LB 1FFOA 5C0FA 2FNBA 4R7NA 3GMOA 1CFQA 3I02B 5FCUL 2DQIH 1PFCA 1HQRB 3B9AA 4PRHB 4EN3D 4LK4A 4HLJA 4Q58C 4DOHB 5TJWK 3S37H 4L8CA 3L3HB 4QWWC 4LQFH 1ACYH 1TQBB 1CGVA 3SGKA 1NBYB 4DN3L 3U36B 1NUFA 1TDQA 2NZ9C 4KHXL 5DEFA 2G5BA 2P47B 2IG2L 3KNBA 3QWOA 2EC9T 1UCBL 1X5GA 1U8KA 3O3UN 3CU7A 4PUBL 3RJDA 5ITBL 4ZNCD 4F7EB 3AS1A 1AI1H 5C7XL 3GJFA 4HT1L 3WIFA 5DR5H 2KUTA 4PTUB 4OZFA 3P73A 1J1XL 3X12B 1EX0A 4FXKA 1QLRA 4WENB 4S1DC 5MEOB 3VG0H 2HAZA 2R39A 2Z0BA 5KTEL 4PJHB 1ZXQA 5LQBH 5ADOH 2FX8L 2OL3B 1SJHB 3C5JA 4FQ1H 3MNWA 4IRSC 2BVEA 4NZRH 1QYGL 3IYLW 2AABL 1LE9A 1QSVA 3E3QE 2DAVA 1PZ5B 4YHMH 3EDEA 5DJ8A 4GUPA 4EIZC 4PGCA 5DHYA 5HHMD 4HF5L 3CUPB 2YEZA 5ANME 4YHZH 5DC4B 3UTOA 5L2JA 1NFDF 1NAMA 2A73A 1MAJA 5F7FA 1JV5B 1OAXL 1I8LC 4IRJB 1TZGH 1DE4B 5AYQA 4GMSH 1JGLH 1ZT7B 4PRNA 5JHDB 2E7MA 2MKWA 3JWOH 5AAMA 5IHBA 3NFSL 3T0DA 5IEHB 3C8KA 4HIJA 1DBKH 4UTBL 1X7QB 1V3JA 3IF1A 2UVFA 2ICCA 3DMMA 1MHEB 3RQ3A 4HS3A 1NFIA 1GL4B 3CZFB 3EJZD 3GSUB 4XGZB 5JQHC 2Y6SC 4XCYB 5EU7C 2RQ8A 3KPNA 4FOMA 5FKAA 4X6BB 1J0KA 2GIYA 4ZO7A 1G7PB 1AC6A 4E0RB 1DUYA 4HWZA 3VW3L 5CJ8A 1YZZA 1EO8H 4XP6L 4GAFB 1LDPL 1FL6A 4ONFL 1VENA 3NCJH 1MRCH 4P46B 2C3VB 1HHJB 3NACH 2HRLA 4H20H 3W0WD 1YUHB 5HY9A 1RK0A 1GSMA 3K3QA 1NC4D 3UTTE 4WUUD 4X4MA 1V3KA 5H2BB 5EO0A 3ISWA 2SEBA 3F5WA 3D1MC 3LKSB 1N64H 4EI5A 3DXAD 4KY1H 1YN6B 2Q8AL 5A2IH 5BV7B 3CMGA 3ILQC 2VLME 1DP0A 4YHOH 4Y16D 2AP2A 5IHLB 3ROOB 3FRPA 5JOPD 1M05B 5DUPH 4R7DB 4X5LA 3CPLB 4M4PA 5D7KE 4GJTB 5D1ZC 1UACH 3ABZA 3VXMD 2HRPH 4O4YH 4WFEE 1WFTA 4QRTB 5HHPA 5MENB 2B39A 2R0WH 2W9DH 3BGMB 1C1EL 3U83A 5F1KC 2D7QA 4GBXA 1A6ZB 3B2VH 3BAEH 5E2VL 3MV7B 4FQCH 3N0PB 1AHWB 3FO0H 1QBAA 1CGSH 3R06B 4Q7DA 2PR4H 3ZL4H 2YPVH 1OTUD 1QRKA 1ZSDB 1F3DJ 5GSRB 5CZXD 4K9EC 4JPKH 4LPTA 1MCIA 5ENWB 2YC1B 3FT2A 1HZHH 2AQ3A 4L4JA 3P30H 5AG9A 4M7ZC 2W60B 1FO0L 5EBWA 3BZEB 2Z8WC 2B2XH 3NTCL 2XN9B 5CGYD 3MLWH 5DRXA 4PRPA 1PW3A 5F44A 3RNQA 3H42L 5IV2A 1KELH 4U49A 3D3VA 5E94B 3MZTA 4XBPA 3OKMA 4DK3A 1LEKA 4QRRB 5I74C 3MCLL 4K7FA 4PJIF 5B38A 2EXYC 5IBLC 1U92A 1I8MA 4U1KB 2CUIA 1FZKB 1C7SA 3P0YL 1XR8B 2F53B 3P4NB 2LTQC 2BRRL 4JRXA 1PGRB 4XMKL 3UTSA 2AI0H 3CK0L 1AKJB 3BXNA 2A77L 4U3CA 1INEL 2EEAA 4OI7A 3MODL 2R0LH 4OZHE 4Z7NF 2QSTA 3GIZH 4XVSH 4HKXB 5DJDB 5IQ7H 3BWUC 5L9DL 1T83C 2L0DA 4FFWD 4DN4H 4NQEE 4QTIH 2NY6D 2EDOA 1JFQH 4WFFE 4HG4K 4R2GD 2OI9B 2F58L 1XF2A 3VFPB 4X8JA 5IFHL 1N0XL 2EDHA 5DRZB 3WFBL 4EOWH 2NLJA 1A6WH 2IPTH 1OTSD 1OF2B 2PXYD 1B2WH 2X7LA 1FVDA 1OGAA 1BEYH 3RWJA 5CP3H 3BSZH 1KXTB 4ZUVA 1TCRA 2EDLA 5F8QC 4LKXA 5E99L 5DT1L 5KZCB 5FO7A 1S7SB 1WVZA 1PSKL 5TQ0H 2K7PA 4NBYB 1CYGA 2A9MH 5JPNB 4C4KT 1UADC 2ZJSL 3QDGB 4F58H 1PLGL 5LCVL 3RGVB 1RMFH 4N8PA 4GRWE 1UWEL 1C7TA 4LRIC 3HMXA 1MCWM 5INCA 5DRNA 1C16B 2X6MA 5GGRA 4LBEB 4LEOB 3V0WH 2IBGA 3A6CH 3H9SB 4QKXB 2MCPL 3WJLA 4APQC 3TYFB 1B0WA 2DQHH 5JW4N 4K3DH 2P5EA 5DJYB 1QKZH 4M43L 2RIKA 2ILLA 3KXFE 5CINL 1N3NA 3NA9L 5AUMB 1CLCA 5CEYA 3LN5A 5ALCH 3L1OH 1TVHB 1T20B 5IB3A 1JGUH 3G08A 2QQNL 5HHOA 2XTJE 3P11H 1BMGA 3VXUA 3IJSA 2DMKA 2WLYA 1CU4L 2V2TB 2K3TA 5D2NC 3TCLB 3TLRA 1DBBH 4Q2ZA 1H8NA 5BMFH 3FO2B 1EXUB 5KS9A 4RQQA 1JUFA 3DOSA 3O6FC 2HKFH 1AGDA 3GEWB 5CD5D 2XZAH 2Y7QA 5EA0L 3ET9F 1A9BB 4M7KL 5GRUL 2ICWJ 4P5TA 3S36L 3A6BH 4NQDD 2E3VA 1NGWA 4N8VA 4F8TA 2ESVE 3MXWH 1DBAH 3DV6A 2FB4H 4P5KA 2F54E 5EOQL 3VFRB 2EEDA 1QSEE 1JHLL 4LLAA 2OL3H 1U8HB 1PX4A 1ZV5A 2HLAA 3BPNC 1T5XA 3VWKB 2UZXB 1LD9B 1BIHA 2D7NA 3MA7A 4X7FC 5BO1L 2NY4C 2C5DC 3U7WH 1NLDH 1XGRA 4PRID 1AXTH 1XF4A 1IM3A 3ARZA 1HH6B 1ED3A 3QCVH 4H1LG 4MAUL 4PBXA 4LL9A 3NIFF 3U6RA 1IGMH 2BOBA 4UMGA 1YNLH 5BCAA 3ULUF 3K1KC 3O0RH 4QOKB 1QUNA 5CUSH 4PREB 2H9GB 5HVWA 1A6VL 2ENSA 2DBJA 2EDBA 4PBVC 5JDSA 3BIAX 1XGPA 3BKJL 2I60L 3GMMB 4XNZC 1DSFL 4JFDB 5FM8A 5F1IB 3VFNA 3C08H 2IALB 1JNJA 3NCYP 3SE9L 1OQOA 3RWGA 3C9NB 5GS0C 5J9PB 4XXDB 4OLVL 5F9DC 1NCCH 4CRPA 4MAYB 1MQKL 5IBUB 1WAAE 1BF8A 3WFEL 1T89A 4G6JL 3KG5A 2FJFA 3M17A 4XRCA 3W39B 4N0UA 3L3KB 2P8PA 4GH7B 1MI5A 1C5CH 3TIEB 2VXVH 3TBWA 4DCQB 5D1QC 5FYJE 3DX9B 3QDJE 4QF1B 4POZD 1I1YB 3MSPA 3TVMB 4KKAC 3WKNA 3T0AA 4RFOH 4QXUH 1C08A 4M48L 3NFPA 3GJEB 4C56E 3W5NA 2BNRE 1U36A 2ZKHL 4Z7VF 3S34H 1NAKH 1W72L 2WUBH 4NWTL 1CFTB 4UDUA 3VMNA 3KPOA 1FE8L 5BV7H 5C3TA 4DOHE 2NXYD 5KVFH 2CLRB 4ORGB 1FCGA 3BZFA 3MRIA 3T65A 3LN9A 3KPSD 3QWRA 1N2RB 1S7QA 1RIVH 4ZSOA 3V7AG 4MMXC 3C60D 3ARDA 3O11B 3LEYH 4BSWB 1JPFB 1P9MA 4XXCC 3KPRA 5F6IC 5A2LH 4LCCB 1DVFD 2WM0A 1S5HB 4KU1A 2BNQE 1J0JA 4U05A 5E9DD 2HG5A 4HPOH 4WU7B 1QR4A 5DJCA 4HEME 4LQFL 1IEBA 4MHHG 3G6DH 4ZTPL 2DLFL 2YMXH 2P44B 4LSSH 3QRGH 1A6TB 2YD1A 1ZLWK 4TSBL 2IAMD 4JY5H 1FNLA 4HX1B 3EO0B 3UTPE 4WFGD 3MRFB 5E24E 3Q5TA 3GM0A 2VLKD 2EIBA 4YDJA 5HYJE 2X89A 1AI1L 2QKIA 5TDNA 3AMKA 2HVKB 1RSFA 3WNOA 1MCLA 4CUCA 5ILTL 4MXQD 5KVEL 1G7LB 4YQXH 3UJTH 1EFXB 4URTB 1UCTA 3GGWA 3DX7B 4HJGA 3RTQA 5K33A 2QHRH 2YS4A 2RCSH 4GXUN 4FTVE 4WI8A 5K9JH 4PLNC 4S1RH 3D85D 3ZLQC 4ZODA 3V5DA 5I8CA 2UVEA 4L4VA 4FQ1L 3ZSTA 1PG7W 3S97C 3O9WB 5EU4B 2LAGB 5ACZA 3FB7A 3TPUA 2D4FA 3EFFA 4K3GA 3N85L 3INUL 3CXHJ 1A7NH 4UT9L 4GRLA 5CEXA 1I9RL 4KV5F 4XWGH 5FGSA 5C86A 3LB6C 2EYTA 1YMHA 3GIVB 3KR3L 3BVNA 3RZCA 4P48A 3F6LA 2H1PH 2P7TA 2GJZB 3CAFA 1JGLL 2JIXB 3T0ED 3U0WH 4E5XB 2YN3A 1WF5A 3PHQB 4LAQL 5I0ZA 2R9HD 1FPTL 1REIA 5MEQA 4LFHG 1HOCB 1FP5A 3UPRA 2OJZH 3FO9B 3Q0HA 5DURD 3EYUH 4QYOB 2D03H 4HWBA 3BT2H 3LQZB 5EIQA 1RIUH 5LWYH 1M71A 5SX4I 3MRHB 5C0DB 2VUOA 1EO8L 3AUVA 4JDTL 3T4AB 1YJDC 2Y36L 4OCWH 3NCJL 4OV6F 1B90A 4E41D 1I1AD 2VLJA 5J12C 3IU4H 4RDQF 5KOVC 3V6ZA 4KH2A 3DX6B 3IDNB 2Y72A 3ZHKA 3RA7L 1RZIB 2VDQH 3BUTA 4PGDA 4G43A 3X3FH 4BSVA 3MRDB 2DM4A 3HZVB 3GB7B 4C83A 2CKBL 3MUY1 3S6CA 4P3CH 4BQCA 1PYWA 4MDIA 1QO3A 4NRYA 1QPPA 4NFCA 3LQMA 3ILPA 2D9CA 4QO1A 3DBXA 4M5ZH 4O4YL 4XP1H 3FMGL 1LO4L 1FNSH 2Z4QA 1A7QL 3VFUB 2UUDH 3JUYA 5EU5B 1S7XA 3QHFH 5F7WC 1IC4H 4FABH 2YZ1A 4PY8I 1KGCE 4YE4L 3WJJC 4P5MB 4KROB 3B2VL 2XN9E 4XBEL 4KTEH 3BKCH 3FO0L 2EC9U 5LAXB 3ZL4L 1MCJA 4LVOC 5GZOD 2WV3A 4LHUA 4QRRE 4JPKL 3PHOB 5EZLA 1GH7A 2GSIA 4OZGE 1Q9OA 4EXKA 5K9KB 2ICEB 4JM2B 2FIKA 4L1DA 3MBEA 3GMNB 3KVQA 3GSOA 5CBEA 1WZ1L 3MLWL 3QA3A 2CO6B 1IAKA 1F6FB 2F53E 2NX5E 3TF7C 1KELL 4OT1L 5DD3H 1QVOA 1LEIA 5CKAA 2VUYA 5F3BA 5HGAB 3QH3A 2RR3A 4Z7UF 4YR6B 4NFDA 4MD5A 1UZ8B 3WSQH 3SDAC 3LH2L 3MLVH 4NN5C 1DQJA 5DWUH 2FR4B 4K8RC 1RUAL 1CL7I 4YHLL 3FB6A 5M95B 3Q3GB 2GFBA 5L2KA 5E00B 3MV11 2R0LL 3RIAK 3U46A 1K4DB 3WD5H 1TZIB 4XVSL 4MJ4A 4GMTH 3KWWB 2ADIA 3ZKNC 2XWBB 5JDJA 4DN4L 2YK1H 2P45B 1F6AA 4UIMA 1KIPA 4QTIL 1JFQL 1FL5A 1N59B 5I73C 1T5WB 2VITA 3MROB 3CFJA 4MSWA 1M7IA 2BHYA 4U1LA 1FNEB 5FM5O 3W11D 1NDGA 1IGJB 1W2KT 3TA3A 3O2VL 4EOWL 3GSQA 3LKRA 2V6HA 1H3XA 1B2WL 4WVRA 1R24A 1BEYL 5IJKC 2AXGA 3QDGE 5IW1A 5K9QG 1G9NL 3CLFL 1R0AH 3BSZL 5AAWA 1KCSH 1XGQA 1HN1A 3RDTA 3GMQA 2APTA 1JHKH 5TQ0L 4WHYG 2A9ML 1R3KA 3AC0A 3IJYB 1T7XA 3BE1L 3SJVA 4MGXA 1MJ7H 4G7VH 4OF5A 3QXAB 4A2MA 5TE6H 4F58L 2P8MB 4PJXA 1RMFL 3NPSB 4Y19D 2AQ2A 3UZEA 3BPCA 4PS4L 3RIFF 5EPMB 3BDYL 4MNGB 1NGXB 2VZ1A 3MNVB 5LGJA 5FYJL 3A6CL 4Q9RL 4CU8A 2VLRA 2VLMD 3RY6A 4S0TD 4P2CG 2R2EA 4K3DL 4ZFZB 3QZWG 3STZA 5CZVL 3SDXA 2WBJB 4M7LH 1S3KL 3H3KA 5E8EB 4Z7QE 1BECA 3NZHH 5D7KD 3LHPH 1JPTL 1WCBB 2VNCA 4WFED 5DLMH 3L1OL 4L3ED 5EC2A 3D9AL 4LP5A 2ZP0T 4P2OC 5E5RB 4NQXA 5A1AA 2GUOB 4HCRA 3DETD 3FFDB 2Z92B 1EGJA 5EIIB 1BREA 4X6EB 3CGTA 1AGCB 4JREB 2E9JA 4TUJB 5H94B 2WW8A 1Q9LA 1DBBL 2YHGA 5BMFL 4TTGA 1UC6A 4NP4H 2XZAL 1Q9KB 2IH1B 4KJYB 2P46B 4G9FE 4ALAH 3FOLA 3QXUA 2EDYA 3A6BL 5HGHB 5HI5D 3LKOB 2A6DA 4U7MA 1H3VA 5GHWH 5EWIH 5AD0A 3ZKMC 4I48A 2FB4L 3DVNB 3G5ZB 5DJAA 1IT9H 1ZHLA 1HHHB 4CKVX 3BP4A 2E27L 1SJVA 4ZNEE 3MRMA 5E6IA 4MB4A 4XBGA 1HILB 4Y5YB 5DQDH 5GS2H 1PKQB 5DFVD 2X5PA 2Q86A 1RVFH 1GYAA 1OAYL 3U7WL 4M8QB 5EO9A 1LMKA 4RMRA 4JJHA 2E7LA 4JG0L 3VMOA 3QCVL 3SOBH 2OZ4H 5DTFA 4GG6B 1OSZB 3T2NL 4NUGH 4PY7A 5T1LD 3OKKA 2Q76A 2Z31C 1BD2E 4BELD 2EZ0C 3ARFA 3NN8A 5I18H 3C08L 4ZPTB 5HPOA 4NQED 2O5XH 5D7IE 4FQXD 2J5LB 1ZAGA 4OI8A 1QFHA 3ULVC 1YEJH 5BXFB 5MI0B 4PGZA 3CLEL 2BZDA 4M4RA 3U0TB 4OZ4B 4YXKH 3HLAB 1C5CL 3N9GL 1SMAA 1RY7B 3MXVH 5IB2B 5J13B 3MOAH 2AJUL 4EUPA 4HWEH 5FEBA 3UXFA 2ATKA 2J4WL 1QLFA 5DYOA 3BDBA 4Y5XB 2FDBP 1EUUA 4FQIH 2ADJA 1YEIH 3S34L 1NAKL 3ARED 4K3HA 2A83B 2WUBL 5CJQH 3P77B 5M94B 1V5JA 4Y4HC 5BV7L 2GK2A 3CFIC 4LDEB 1AQKH 1ZK9A 4NC1C 2NY0C 1T3FA 5F7DB 2HMIC 1SQ2N 5EBMA 5IHUH 3AFLA 3QXWA 4Y2DC 3P4OA 3RL1A 5IK3B 3SDCC 3DO7B 5HJ3A 1NCTA 4HH9A 3MFFB 3D39B 5I1KL 2VAAA 3KXFD 5F3HA 3VXSE 4ZPVB 4PTTB 1CFSB 3KLAB 1IL1B 2D0FA 1KG0B 1WQVT 2YMXL 3GMRB 1E28B 4LSSL 2P5WD 1FZMB 1I8IA 1WT5A 1UFUA 2ZNXA 5EUKA 5DJ2B 2R1XA 2W0FB 2H26B 3C5ZD 2FGWH 1AGFA 1DCLA 1S7UB 1PJ9A 4J6RH 5GRXG 4NKDA 1V3LA 3I6GA 4XPGL 5I9QB 3PQYE 4PJCA 4ERSH 1ES0B 5E2TH 5B8CB 4NNYB 1D5IL 4YQXL 1GC1L 3QIWB 5AZ2H 3WIIH 2WMPA 2YWZA 4ODTL 2G60L 5IF0A 4FQPA 1OSPH 5FGCB 4UB0L 3T3MF 2QHRL 2EH8L 1J7VR 2RCSL 5EU7E 1U3HC 1GOGA 3QRFM 5B3JE 4YK4C 5AZEL 5DHXB 2ESVD 5T3XE 2X05A 1FV1A 1RQ5A 2ERJC 5C0RL 1R3IL 4RX4D 5TQ2H 2BHUA 1QNZL 5HHXH 2XFXA 2JJUA 3WUWG 4UDTB 5SWQA 1D5BB 4LLQA 1U8PB 1A7NL 3B9KC 3HMWH 4N1CA 4KKCC 1FYTE 1XF5A 3M07A 1IFHH 2LABA 5MEPA 4BJLA 1MFCL 4KMTH 1UKTA 1FN4A 2IBBA 5EUOA 5I1CH 1MFDH 2H1PL 4RISH 1FFOB 4D9RD 3KS0H 5C0FB 4Z95H 5BJTA 4R7NB 3GMOB 1CFQB 3QUXD 5HYQA 3RBSA 4NO5A 2OS7A 3O2DA 3C87A 4OGZA 2OJZL 1C8PA 4L8CB 4WWKD 3WXWH 3EYUL 1QSZA 1NCUA 3R1GH 5D1XD 5ELIA 3J7HA 1RIUL 2V2XA 4BK5A 4NIKB 5LWYL 5IR1A 1V7MH 5DEFB 2G5BB 4LEXH 3CXDH 4ODHL 3KNBB 3QWOB 4XPAH 1VPOL 3S35X 1CR9L 4LGPB 1U8KB 4LCWA 1A7OL 3DARA 4GRMA 3GNMH 4HS8H 5I75B 3GJFB 2BK8A 4XNXH 3WIFB 3IU3A 1LO3H 4OZFB 3P73B 5FYJD 2V7NA 4LNVA 2VDQL 3HI5H 4N0CD 3X3FL 1RFDH 1IM9A 4FXKB 1QLRB 3MLZL 1YEHH 4OLWH 3PWPA 4OF7A 4Y89A 5E08H 2G75A 3D48R 3BO8A 3C5JB 2IADA 4P3CL 5C0JA 3MNWB 2IMNA 3FOMA 3T0XA 4PRHD 1K3ZA 4OGXH 1EEZA 1JGDA 2DI8A 1NPUA 3BZ4A 3OKNA 4ODSL 5FXCH 1LE9B 1YEFL 2HA1A 2XZZA 2YR3A 4QRSA 5DJ8B 2A0LD 4GUPB 4JRWA 4PGCB 5DHYB 1FNSL 1FZJA 2YEZB 3QCTH 4JKLA 2JCCE 5L2JB 1NAMB 2A73B 3BHBA 4HIXH 4FABL 5D71H 3SBWA 3GSXA 1MIEH 2ED8A 1X5IA 1DQDL 4B53A 1IC5H 2D3VA 3F65A 2IGFH 4KTEL 1FAIL 2FZ3A 3BKCL 4WIQA 1OARH 4RZCA 4PRNB 4C55A 5D7JD 3W5MA 5GXBB 2M8XA 3C8KB 15C8H 4HIJB 3IF1B 1KENH 1UYWL 3DMMB 5HHQA 3VDAA 1JNNH 5JXEC 1AO7A 1NFIB 4HS3B 5C6WH 3OAYH 4K2UL 1OLLA 2CMRH 3KPNB 1I1RA 5FKAB 2HFGH 1DUYB 4HWZB 4X9GA 5A2KH 4HUXA 3K1DA 1NANI 1FL6B 4BM7A 2VB5A 3MV9A 3ZDXE 1MQ8A 1JZ5A 1O7VA 4OF0A 4NNXA 5CCKH 5HY9B 1RK0B 2XACC 4QCIA 4Z5RA 5EO0B 2P1YA 2SEBB 3L5IA 3F5WB 1CGYA 4QHKI 2FWOA 2R4RH 2WZPD 5A3ID 3ZE0E 4X6CA 4IRJD 1D9KC 4NQCA 4OLYH 4M6AA 4Y4KC 2R0ZL 1NL0H 5JHDD 4DKEH 1I85C 1D6EA 1RZKC 4ESKA 3BIKA 2Q7NA 4OM1H 4GMTL 4X4YA 4TUKL 2RAMA 1GGUA 4LSPH 1YECH 2EE2A 3VFGH 5H37G 2YK1L 5KAQG 1UENA 4G8IA 1KCLA 5HHPB 3LS4H 3Q5OA 2EDDA 3LKQA 4GKNA 1BOGA 5ADPL 1L9MA 2XKUA 1MNUH 2Y5EA 1CIDA 4RMTA 4GBXB 4OCNC 3MACL 4QHUA 4NPYA 4P46D 3WMSA 3LZFH 4PD4K 4UQ2A 2YD5A 3WFHA 4UAOB 1R0AL 4OJFH 3FT2B 3EDDA 4RIRA 3QIBD 1WBZA 1G6RA 3GBML 5EBWB 1UWXK 3EOAA 5DRXB 1F42A 3GSNA 2MMXA 4PRPB 2EE6A 5D2NE 3RNQB 4G7VL 4ZFGH 4P3DA 5IV2B 3U4EA 3D3VB 2VZUA 2D7MA 4NQTA 4XBPB 1ZEAH 3L95A 3OKMB 1LEKB 1YYLH 4RGNC 2EC8A 2PO6C 2HLFC 3C5SB 1G6VK 1P4IL 3BESR 4K7FB 5B38B 2J7LA 5MEND 1U92B 3S4SG 1VEOA 3DYPA 1I8MB 4WTZG 1MAML 4UT6H 4NYLA 2EE9A 3PWLA 1JRHH 4MQ7A 4CW1A 2F8VA 4YXLH 4JRXB 3BGFC 3UTSB 1CTNA 3FL7A 3BXNB 1LO5A 3MV7D 1QSFA 4L5FL 1TVDA 5CSZA 3LHPL 4PJ5A 1BFVH 1BQSA 5DLML 1L0XA 3LS5H 4PP1D 3SE4C 2XKNA 3NIGE 3VFWA 4J4PA 5ICZA 2AJXH 3WHE0 3B8SA 3L7EA 3PL6C 3EAKA 4O2FA 3O6LL 1P2CA 2XN9D 4OGAD 4LASH 4XHJD 1BQUA 1P7QD 1Q94A 1XF2B 1WBYA 3O6MH 4X8JB 1KBGH 3V6OC 4JZJA 2IMMA 4M62L 2NLJB 4QRRD 4F7MA 2X7LB 1FVDB 1OGAB 1WEJH 2UZYB 5D4QA 4NNPH 3RWJB 4PJBA 3ULUC 1MWAA 4AH2A 4F15C 5HDQH 5EWIL 5FHAH 1TCRB 4ZUVB 4LKXB 5E2WL 2F53D 1IT9L 1X5FA 2NX5D 5FKPA 2UZIH 4PJ9A 5FO7B 3WS3A 4JFEA 4KKNA 4YJZL 4G8GE 1AKJD 4XPFH 1HCFX 1NMCB 3MNZA 4KXZI 4PLJC 1Y6NR 1I1CA 1QACA 1X44A 1WFUA 5DI8A 4MA1B 3BGAA 3QEQE 4UU9A 1CFVH 5INCB