2AF2A

Solution structure of disulfide reduced and copper depleted human superoxide dismutase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
153
Chain Sequence
b'ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human SOD1 before harboring the catalytic metal: solution structure of copper-depleted, disulfide-reduced form
pubmed doi rcsb
molecule keywords Superoxide dismutase [Cu-Zn]
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 37
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2af2A00
1SXZA 3GQFA 1AZVA 2GBVA 2V0AA 3K91A 1IBFA 3QQDA 3ECWA 1IBHA 4BCYA 1EJ8A 4A7SA 2WWNA 2AEOA 2K4WA 3HOGA 3ECUA 1HL4A 4BD4A 1B4LA 3LTVA 5KBKA 1RK7A 1CBJA 1N19A 5KBMA 5CU9A 4A7UA 1IBDA 2AF2A 2ZOWA 3F7LA 1F1GA 1EQWA 3GZOA 1SXBA 2E46A 1Z9NA 2ZKXA 4L05A 1PU0A 2XJLA 1SOSA 2WYTA 1COBA 2JLPA 1E9QA 1OAJA 2WZ5A 2WZ6A 2Z7YA 2AQRA 1SXCA 1S4IA 4MCMA 3ECVA 1U3NA 3GTVA 3RE0A 3T5WA 1XSOA 1P1VA 2LU5A 2WWOA 4N3UA 1TO5A 4A7QA 2WYZA 1CB4A 2AQSA 1KMGA 4A7GA 3KM2A 3SODB 1E9OB 1PZSA 2APSA 4A7TA 1E9PB 1E9QB 2NNXA 2Q2LA 3GZQA 1E9OA 4OJAA 1OEZW 3H2QA 3KH3A 3PU7A 1YSOA 1E9PA 1TO4A 3L9YA 2C9VA 3HFFA 1SPDA 1SXAA 2GBTA 2VR7A 3F7KA 2C9UA 2WKOF 3MNDA 4FF9A 2SODB 2Z7ZA 3CE1A 1IB5A 3GZPA 1XTLA 1ESOA 3KBFA 1HL5A 3CQPA 1L3NA 1DSWA 2ZKWA 1PTZA 4U4IA 2AQPA 2AQQA 1OALA 3KH4A 4N3TA 1UXLA 1SRDA 2VR6A 4OH2A 2GBUA 3MKGA 1UXMA 2JCWA 2Z7UA 1F1AA 4BCZA 1B4TA 2R27A 2Z7WA 1F18A 1XTMA 4A7VA 4B3EA 1IBBA 1DO5A 2VR8A 2AQTA 2XJKA 1MFMA 1FUNA 3S0PA 5KBLA 1SXSA 1N18A 1OZTG 1JCVA 2C9SA 1YAIA 2ZKYA 1OZUA 3KM1A 1F1DA 1YAZA 1BZOA 1JK9B 4MCNA 1Q0EA 2WZ0A 1SDYA 1Z9PA 3GTTA 3H2PA 2AQNA 1JK9A 3HW7A 1BA9A 3QQDB 3L9EA 1SXNA 3KBEA 2WKOA 1SDAB 1QUPA 2E47A 4A7GF 3CQQA
chains in the Genus database with same CATH superfamily
5CLXA 4XR8C 2J5LB 5C8JB 4EO5A 4RFEA 1BG9A 3ASWA 3WU1A 1OT4A 1N6UA 2G5BB 1DUZB 1NBZA 3VVVA 3BIKA 3EG9A 4EDWL 3S34L 1JZEA 1Q9LB 3ILQC 2Z8RA 3WNJA 2C3WA 2HTLD 3KYKL 4O5LH 5DHYB 1FFPA 3O6FC 5FK9B 4KXDA 3VCLA 3ZT6A 2BW5A 5I8OL 2LW3A 4N2CA 3V0HA 3O9WB 1KDIA 1MZYA 2HX9A 3BQUA 2VIRA 4J8RA 4KFMA 4PJCA 3OC5A 3RTLA 3UBXB 3D0VA 4L1HA 3RWCB 1I1YA 1JTTA 1JFHA 3ULSB 5J1AB 3LH2L 4MMYB 4Y8DC 1A6TB 5TDNB 4HKBA 1A6WH 5C0JA 2N1TE 1JV2A 4Y16A 1F42A 3RWIA 2NY7L 2WYZA 4IBYA 5CEXB 5GS1A 3CV5A 3BPCB 1I9IL 1C1EL 1R3LB 3DO7B 1JF1A 3ZHFA 3PUUA 3WXWL 3D25B 1U8IA 3EJYC 3FZUC 3P4MB 4M7LT 4BFBD 2GK0B 5L4MA 4G7QB 5EBMB 1F0LA 3ARRA 1DDHA 3MJWA 4J3OD 1AZNA 1TO4A 3HS0B 4RRPM 4XCNB 5GISH 4S10A 4HW6A 4GRLA 3U46B 5C70A 3WN5A 4KNQA 4NQCE 1NAML 4MXVF 1OLLA 5DZNA 1ZKAA 3DVNA 4JQVA 4FQXB 4O58L 3SGJC 4AWJC 5HVWA 1WZAA 1OCZB 1RXLA 2AJVH 4TRPL 2I5YL 3G6JA 5I1KL 3CDGA 4U1HA 2NY6D 3B9KC 3EYSH 1U91B 1C8QA 5B7MA 1PG7L 1JXJA 2CHDA 3ARWA 5FW8A 5LGHL 2WW8A 4KTDH 3WELA 4NJ9H 1JGUH 1FNLA 4Z76B 2EIEA 1DEEA 4URKA 3MACH 4G9DA 4NQVB 4MDRA 3RB7A 3RX7A 2BHUA 2MOQA 4B3EA 1UC6A 3NSJA 4U6HA 4HG4J 1PNDA 3UTSD 4GSUA 2WINA 3LRLA 3TZVD 1HL9A 1OZTG 2ZIDA 2IALA 1BQHG 2L3BA 4ZFZA 2PKDA 3DURB 1ASOA 2VLJA 2NY2C 5KJ4A 3UJTH 5CLTA 4Q6IC 1KPVA 4PTUA 5AVTB 1EHLL 3VW3L 4LRIC 4DJMA 3IU3A 4PVBA 3PHQB 3SQRA 4PWJA 2FEDD 1TNNA 4P3WA 4PIRF 4KRLB 1LE9A 4MJIE 4N0YL 3SGDH 2IDSA 3QCVH 4WFHE 4WWKC 2EADA 1MCNA 3RVXD 5IJBC 1H9VA 3IMSA 2IG2H 1I4FB 4AJWA 1R9FA 4J28A 3GZKA 2IQ9L 1MHEB 1X5XA 4JFUA 4LCYA 3NN8A 3RAJH 2Z31A 2VH5L 2XQYG 1U8MB 1NCDL 5ANMB 3VD2A 5C2UB 3CMOH 2XIBA 2FQDA 3IJ8A 2A9NH 4OZGF 3SDAD 5IEHB 4RA0C 4IOIB 4JFWA 1T7VA 3QJOA 4IK7A 3WAJA 3RGHA 2IFFL 4WI4A 5D71H 2AK4E 4N0FB 5AKVA 3SYAA 4DAGH 2GSGB 1XEDA 4M8RA 4N0UE 5HJ3A 3C2SA 1Q0YL 3GXDA 4WKZB 2A5UA 4QOKA 3Q8BA 4YHMH 3RX9A 4LP5A 3IDIB 3FU7B 1GRWA 4Q9QH 2WP3T 3CQFA 1E3XA 1RZJC 1DQMH 1W0WB 5FO8B 3TT1H 1AI1L 1NAMA 4K2UH 5BO1L 3A47A 5IMOB 1S7XB 4HUXA 3ARFB 4MWFB 3VMNA 4LZKA 4RMTA 3NIFF 5GS2H 3ATEA 4MLSA 4YHNB 2H26A 2Y6SC 4NUGL 4H8QA 3ZZSA 4O4YH 3KW7A 2ZUTA 5CGYC 1HOEA 3LKRB 3AY2A 3F6JA 4DPBX 4LT7A 5JIHA 3Q48A 5EOTA 2J6WA 1J1PL 1KTBA 3IETA 1LD9A 2VR7A 4D0DB 1DQKA 2C9UA 4R96A 5I1LA 2I07B 5IM7B 3LEYL 1Q9WB 5GSRA 5D7EA 4YSOA 3VXOB 1A0QL 3NPZB 4TL4A 2H1PH 1LEGA 3T8VA 4WTWA 4IBUA 2X1XR 2Y7QA 3HCVB 4XNBA 1FC2D 3QS3A 4KKCC 2WBJB 3HZKB 4Z7IA 5CD3A 2WBXA 4KQ4H 4PSPA 3ULVD 5C0EA 4G1EB 4Y2NA 2BS71 3UG5A 4MFHA 1N18A 3DVGA 3QC6X 4XP4H 1LYQA 2YPLD 2NY1D 2P46B 3N85H 5K1NA 2GIXA 1HCYA 4UBDC 5DZVA 1O6SA 3BDBA 5IF0A 3QIUD 1GGCH 4MD5A 1BEYL 4X8JA 2IO5A 2AXHA 3M46A 1MNNA 4ZS7H 1UM4H 3E8UH 2EZ0C 5E1AA 5IVXF 4CVWA 4NENB 2A4EA 3L9EA 3D34A 4G6ML 4JY4B 1Y1UA 3VSVA 4JKKA 5CJOH 3HG0A 5IMKB 2W65B 4L3FA 1UD3A 4ZFGL 1CBVL 3RGVA 4L8SB 2BXZA 5I1CH 1ZCRA 3GK8L 1VEPA 4DTGL 3FTZA 3LNIA 4G9FB 4UIKH 4CW1A 5MI0C 4JW3A 5DA4A 4PD4K 2FBOJ 3UACA 4BEIA 3R4RA 3ZQWA 4WV1A 3M1BB 2ZCKH 3IFLL 3MBXH 3O4LA 3SE9H 4OF7A 3TO4B 2CBTA 3QJRB 1YEEL 3PIQA 1JWMA 4OLXH 2XIDA 2B4CL 3MLZH 3P3RA 4GRWH 1EAQA 3RILA 1NGXB 3ZGIA 4GS7B 5IQ9B 2UX7A 3GJFA 2NX5D 3TS8A 5INCB 4KXAA 1BZEA 1T7XA 5C2BH 4OFYD 5K9KB 4PJGE 4L29B 3NJKA 1WAEA 4Z7UF 3UPCA 1FGNL 4ILDA 3LD8B 1HZHH 4PW3A 5L7XH 3HAEA 4W6WB 3ZW3A 3ETBF 4ZXBB 1DFBH 3WKML 2Y36L 1QFWH 4LAJH 2UV3A 2UY6A 1UD8A 4YEFA 1C5CH 3BESR 4PJBE 5EFIB 4CVXA 2WK2A 4YPJA 4NZFA 2RFXA 1JK8B 3LB6C 4UQ9A 2LOEA 4K7PX 2OX5A 3PFQA 4ZMTA 2Y1AA 5ICYB 1CF8L 4R90L 3VNYA 4FXLA 2C5DC 3VM7A 2PYFB 2PW1A 3EH4B 4N2BA 4WFEE 4RETB 1T5XB 4M5ZH 1G7JA 1JMXA 3WHE1 4OJDH 4MA1B 2X4RA 3WFCH 1A3QA 1KTLB 2XA8L 5KG9B 5I8CA 5C0GB 5LJYH 2HKFL 4KPHL 3NSXA 4IOSA 2G4EA 4XVUD 4XMVA 4P4RA 3MR9B 5FPIA 3CVIH 2FHFA 3DNKA 2DJMA 4XNYH 3QUYD 2VLKD 3P73A 4MZIA 3IFOB 1QEWA 4PWFA 3D85D 4HDIB 1HOCB 3UYOD 3TA3D 1Q9KB 1G7PA 4LLVA 4HJJH 3R7QA 5HHMD 3VWJB 4OFPA 1A1OB 4AEHL 1TJHH 4F7TB 2FX8H 2Q20A 4YDJA 5JUEH 1ZLWH 3HS0C 4X8XA 2B9AA 4CGUB 5LXVA 4C54A 4V2CB 3RWHB 1XIWB 3PV6B 4JFQA 2WXPA 5E1IA 3MLWH 2B14A 2WQUA 1PIGA 3KJ6L 4OBRA 2YD5A 2K78A 2P8MA 3MRHA 3MRKB 5D72H 3QUZD 1L0QA 1FC1A 3RZCC 5HGBB 5DD5H 1CK0L 4YK4B 3VAEA 3GXUB 2OP4H 4GG8A 4Z3TA 3WS3B 4Y1AB 5FX3A 2R0ZH 3MBWA 1MCEA 1KCRL 1AZVA 3UJJL 2A1WH 2A73B 3O8XA 4G6KH 2F58L 1QRND 1HVXA 3DDGA 5C9JB 1MRFL 5I8EA 3VXNB 4M00A 2EKSB 5KYYA 4RZCA 4QJ5B 3U2SB 3EF7A 1NDMB 4QRPB 1U8NB 4KJPD 3L95B 1EAJA 3CFKA 1Q9OB 4YSQA 5KSBA 4FX5A 1YLBB 5MERA 3NYKA 4Z3HA 2H6PB 5IB3A 1X3DA 3WEXA 4TLTA 5EU5A 1W72B 2IANE 4W9LC 5FFLA 1KN4L 3MUUA 2QKIA 1SGKA 1U4EA 2V9UA 5D2LE 4F9LA 4FA8A 1U8HB 3KDPB 4JPIA 5F8QC 3TWCH 4AH2B 1BMWA 4MX7B 2WSKA 1OV8A 1K72A 2VKXA 4PS4H 2ATKA 4S11A 5IT2L 2R2BB 3ULVE 2MHAB 2YD7A 3MRNB 1ZLVH 1OAYH 3NT0A 1C08B 2JB5L 2K6YA 3CZJA 1SVZA 4D3CH 2XCMC 4HK3J 2HVKA 4FYTA 1SFHA 3TVMA 3PXHA 4ZTOH 3VRIB 3AUWB 4DGIL 1EVTC 3O3DB 4FA7B 1MZZA 5CD5D 3TJPA 1VFBA 2J72A 3PCYA 1F6FB 3A6CL 4EXPX 3ARGA 4ZMVA 2FR4A 2NY4D 2NUPB 1YJDC 4JCLA 5JA8B 1ZVSA 4AKOA 2NCMA 5CILH 1QO3B 1AGFB 1VESA 1XGUA 5ISZD 4P4KA 4HK0B 4O02H 2XVBA 1XT5A 2Z34A 3K5SA 4XTRD 5GZND 2EDTA 2VW6A 3OLGA 5F3HA 4IMLA 4CMHC 3I85A 5FC9A 4B9PA 3LZFL 4OI9A 2WLLA 3UAJD 3AXHA 5D7LB 2C7UB 4B50A 5LHDA 1CE6A 1G5GA 3V0JA 4RGNB 4MD0B 5J3HD 1FDLL 1AIFA 5BS0D 4TM9A 3PP4L 2P5EB 4H4NA 5FXCH 1Q90A 2NX5E 4KKLD 3BZFB 2R23B 2HZHA 5SWSE 5CLYA 3T4AB 4Z3EA 2X4QB 2XKUA 3KYAA 4HFWA 3FB5A 1O7DE 2F53A 2F5BH 2ZG3A 4S1QL 2BSTB 5TH2A 3V2AR 2D2CC 3O6KH 4HJGB 4KVNL 3HRPA 5KVGH 4F58H 1GSKA 2JB6A 3X11B 1E67A 2P49B 3R06B 5EC2B 2R69H 4P48A 2JIXD 4L3AA 1KULA 2QSTA 3IMRA 4MNHB 1AXTL 5AYTA 5F0JB 1S7UA 3BE1L 1D7BA 2CCVA 3GXTA 5C8JA 3DETD 4QEGA 1HQ4B 3F7PC 2F54D 4JDEB 3PDDA 4TQEH 2G5BA 1DUZA 1HX0A 3MV7B 3GBLA 3QDHA 4DCQB 1Q9LA 2OJZH 1Z9SB 1EO5A 5MP6H 2K9UA 3J7HA 4WI2A 5DHYA 5FK9A 1A9BB 5DEZA 5FDYA 3IRPX 2VABB 4M5YH 4TNWK 5DUML 4WI8A 1PPIA 3O9WA 4YGAB 2X1PA 3ZL4L 3UBXA 1XB6A 4JM0A 2X42A 3US0A 4R97B 5HHME 3ZRFC 4L8SC 1R75A 2DQCH 1BVKB 3RWCA 4F15C 4IU3B 1IVTA 3OZKA 5FFOA 5J1AA 3ULSA 4WF7A 4MMYA 1A6TA 1JWUB 5TDNA 1KN2L 2YN5A 4LAQH 5I23A 5F8RC 1QLFB 2OFQA 5CEXA 5KBNC 3INUL 1K4DB 3BPCA 3TO4C 5DK3A 1R3LA 3DO7A 2LVEA 2QVFB 4KBPA 3D25A 2R56H 3ZT5A 3QPXL 3P4MA 3P2BA 4I9WE 3QXWA 4JAMB 5D7HA 2ZZUT 2GK0A 4EMZA 2C8NA 2FBJL 5EBMA 3I74A 3FO9B 2KC0A 3G6DL 4ZQKB 1YO4A 4YXHL 3QZWG 4KX9A 3MJ9H 3Q9PA 4XCNA 1IT9H 3HS0A 1Q38A 2FATL 1X7TA 3U46A 4EVNB 5IB1B 3CBKB 3L4CA 2J25A 1W8OA 3CXFA 2H32H 2P28B 3D39B 4FQXA 4PY8J 4ZMXA 1D9KB 4ZXBC 4NRXB 3BLPX 3QNZB 5E2TL 2A9MH 4P06A 4LCIH 5IOPB 3D4GA 1U91A 2IC2A 3IAGC 2IWKA 4JG9A 5F7MC 3FRPB 4J3OF 4W68A 4JY5H 4MXWL 3JT0A 2HCZX 4UOZA 1SXSA 4Z76A 3SSGA 4RGMB 1KTCA 4NQVA 4QNPE 5IQ7L 1ETA1 4C4KT 3BP5B 4NN6C 3X3FH 2KS0A 3ZTEA 3A6BL 3N5AA 1JK9B 1YEFH 1HAUA 4YZFF 3FO0H 4UQIM 5ADOL 3DURA 1NIFA 3FUMA 5FV2A 3WIIH 3BHBB 1YQ2A 1MHPL 2PN5A 4KXBA 5F70A 3ZKQD 5ILTH 1DJXA 1QSFE 1P4BL 5K1VA 1NC2B 1WTLA 3LS4H 5HD8D 4F2EA 1AMYA 3GHEL 1HTYA 2CO3A 2MJWA 1TXKA 3PHQA 5DD3L 1SDAB 1QUPA 3IE9A 4QIRA 3NUKA 1IM3D 3LMJH 1DQDH 4JKNA 5B4MC 1PYWB 1MJJB 4UOJA 4TNVF 4FKHA 2AEOA 1MCJA 3MXWH 1GCYA 1A7RL 1I4FA 2Y5EA 4PLOB 5IR1B 3RVTC 4J4PA 2B16A 1MHEA 3DI3B 4UOW1 5CAYB 4ELMB 1N19A 1ZDQA 2DL2A 2EYSB 1QI5A 5EZLB 4YLQT 3N0PB 4XN4A 4EIUA 2QHRH 2PTUA 3QJFB 3S3DB 4DP0X 3GS4A 1I7ZB 5CGBA 3V6ZB 5D7LE 5AAWA 5IEHA 5KZCB 4IBVA 4X2UA 4IOIA 2XTJE 2YEVB 4HX1B 2NQCA 3PJNA 3OWEA 4N0FA 2PR9A 2GSGA 3V0AC 5KYWB 2RBLA 2A83B 4WKZA 2O5XL 3IJEB 3DPBB 3OAYH 3IDIA 4LPUA 3CVBA 3FU7A 2F7PA 5F88B 5J06A 1W0WA 4QTIL 3RKDC 1NGYB 5FO8A 1MNUH 1OM3L 2V33A 1UM6H 3E80A 5IMOA 1S7XA 4Y0GA 3ARFA 5AKTA 4JO2H 4MWFA 4OGAC 5E6IB 3SBWC 3UGUA 3R8BB 9CGTA 2ZXCA 4FKEA 2IH1B 3FUEA 4GSDL 4YHNA 2WUCL 1MCOL 1WFTA 3GSQB 2DM3A 1HWHB 4OFKA 4X7CC 4FQJL 2NSMA 4MAUH 4UNUA 4M5SA 4Y4KC 4MRCA 1L9TA 2YD1A 3LKRA 4HIHB 4ZPVB 3ZJAA 3MLTB 5CFAA 2KT6A 4G7SB 2FNBA 4POUB 4D0DA 1KJ2B 3HN5A 2YRPA 2D73A 2I07A 4F9PC 4NUMA 5IM7A 1GPOH 3BZ5A 2FGZA 2Z7UA 4IBSA 4KVCH 3ZSTA 1GR7A 1Q9WA 3NCCB 2E9BA 1MW0A 3VXOA 4A7VA 1MH5B 1ZANL 4YDIL 3HCVA 1BF8A 2J44A 4FFTA 1A4JB 2WBJA 3HZKA 3VX1A 5IBUB 4L8CB 4P23B 5J6HB 2VDRH 5GZOC 3ISWA 3SYPA 1EDQA 3UTZB 1LDSA 4G1EA 4HFUL 2DW5A 3DOHA 4H13C 3U4AA 3G5WA 3RU8H 3EFFB 1TQTA 4AL8L 4WJ5B 1YPZE 4NM4L 15C8L 5I0VA 3LRMA 3UMTA 1F4AA 3SDXF 4UM9B 2IPKB 3ARDD 2UVEA 3HZYB 4NENA 4JY4A 4FNSA 1NKOA 5DYFA 3ABLB 5IMKA 1TEGA 1FORH 3TBSB 2W65A 4UANA 4ZS6D 5I15L 1MCPL 3SJVD 4ONFL 4L8SA 2O5NA 4F1ZA 2BSBA 4ABUA 2HJLB 3HG1D 1PZAA 5EBLB 3O2VL 4G9FA 4PD4J 3WCYA 4CVZB 4Z95H 3T4AC 2ZONA 4QKXB 2E46A 3LIZL 1NINA 3M1BA 2CKBB 1ETZB 2OTWB 3TO4A 3KLDA 3D5OF 1ZV2A 2XTLA 5DVKA 2UZPA 5IV2B 3I9IA 4NGHL 3C2AL 3AWEA 2WOYA 4A6YB 3BAJA 5JYLA 1PFOA 4PY7B 4WTZA 1FGVL 5FA3B 1NGXA 5E6UB 5IQ9A 4BFRA 3HMWL 3LEVL 5CEYB 5INCA 2GAZB 5CJQL 2OTUB 2XVGA 3MREA 4OGXH 5K9KA 4L29A 1WFUA 3MA7B 1KC5H 3SODB 4FLRA 2ZXQA 1CT8B 2NY3B 2EDLA 1IQWH 1VRSA 3QUGA 2UXVA 1IKFH 4ZXBA 3ML9A 2CUIA 3F6IA 1MHHB 2VRQA 3MV01 4RAVB 4Q4EA 1RIVL 4LLMB 4G59C 1W72L 5EFIA 4AEFA 1Y6MR 2ZX9A 2OMNA 4ZW7A 2IBBA 2UZYB 1JK8A 4LASH 2ADFH 4PRID 5HVGB 4ZTPH 4LOUD 2IDQA 3EH1A 4M8VA 3OR6B 4ODBD 5AB0A 2B7DT 3S3PA 2B1AL 5L2KD 5ICYA 1MCWW 1TYEB 1U0QA 1A6VL 1ZTXE 2PYFA 2WC7A 2XZQL 3WKPA 3QHFL 1JJUA 1T5XA 4YOKA 2WXRA 5E1GA 2DQDH 1LDPL 4K5MA 5I26A 2H1LM 3RWDB 1KTLA 4A66A 5KG9A 3LV3B 5C0GA 1MJUL 2MTAA 4LPTA 5H2BB 3IAQA 1XH1A 3AZUA 2KMWA 1KJVB 3MR9A 4MZ3A 3NCEB 2XPZA 1ICTA 4NQUA 5KOVC 3Q7JA 5H94B 2Q6WB 3IFOA 3VSTA 4HDIA 4ODWB 1HOCA 3ZTDC 3FAXA 1Q9KA 2R2CA 3VWJA 1A1OA 5I8KH 1UH3A 1IGCH 4F7TA 3II1A 4MNGB 5FCUH 2L0DA 1SMDA 2J88H 5EZOH 1S78C 3RWHA 1T83C 1XIWA 2YAFA 3PV6A 2ZJSH 5D70L 1NPUA 4L9LC 2ZX5A 3OKDB 1E8WA 4DK6A 3MRKA 4AJ0A 4JRXB 2AANA 2Y6TE 4EKJA 5HGBA 2ROXA 2X05A 3DJ9A 2E9WA 4TXVB 5HHOB 1QBML 3WS3A 4Y1AA 4A7SA 4OF3A 1CVSC 1BOGB 2A73A 5T3ZD 4FXKC 1ZWIB 1OCWL 5C9JA 1NIBA 4ZUUB 2EKSA 3U2SA 3VXNA 1B4JL 1NDMA 4QRPA 1U8NA 1ZLUK 3L95A 3BN9D 3TT3H 1F90L 2GITB 2V7NB 1Q9OA 4O2CB 4YFLF 4IOFC 1N6QL 3K71A 3QVAA 2BK8A 1H19A 5HHNB 5A1AA 4K3JH 4LOFA 2H6PA 1P6FA 2FDBP 3MCLH 1FHGA 4Q89A 1EEQA 2EEFA 4Z7QE 3WFBL 4GLRH 5IFAL 2ZOTA 1UA6H 1W72A 3X13B 1BVZA 3CJJA 1DFXA 4QUOA 1WITA 1U8HA 3S48A 5SWZD 2VRAA 3S8GB 1GJUA 4AH2A 2DN7A 4APXB 4UYQA 4MX7A 1AO7B 4MJ4A 4XN1A 2R2BA 1RUQH 2MHAA 3MRNA 1BYOA 1TVDA 4JFZH 5AYUL 1C08A 4JQXA 4AG4H 2J1WA 4IRJB 2YKLL 2V5YA 3MNVB 2JELH 4XNAA 1EMTL 3UCRA 4BH7B 3L3GB 2Q10A 5IZ7A 4OZGB 2NNXA 3ZKXC 3II2A 1NWPA 1P9MA 3Q1EA 2ESVD 4XXCC 3VRIA 1TZOA 5D1ZD 3O3DA 4DWHA 1AQKL 5IMLB 4FC3E 1OARL 2AK1H 2WAQA 3VI3E 1VGEH 2XN9E 4XMZA 2Q3AA 4R6UA 1T0PB 2XZCL 2VDNB 2FNWA 2NUPA 2X9WA 4OJFH 4LSPL 1I1CA 5TDOB 4KRMB 1ZSHA 3HVNA 4P2RD 5LO7A 5T3XL 1JE6A 2VXTL 4I0PC 4JB9H 4PRHE 1EUUA 1QO3A 1AGFA 4A2GA 3SJVE 4HK0A 4XVSL 3REWA 2XUWA 3V6OA 2K6ZA 1C12B 4JR9H 2Q5BA 1DL7H 4WI5A 3NIFB 5C0IB 4JZJB 4BKLB 2J3SA 2C7UA 5D7LA 2OZ4L 2BCKB 5E9DD 3VFSB 5IBLD 4OZIE 1J0KA 2ITCB 1ES0B 5E6IC 4MD0A 1FVEB 3O2DL 4JPWL 1NCBH 3VD3A 4M1CC 3VFTB 1JDDA 5IQOA 2PPDA 1CLYH 1DVZA 4Y19B 3LN4B 1S46A 2P5EA 1HKFA 3PF2A 3NSYA 3VXRD 1Z9PA 1TZ8A 2YAOA 4AQAB 2PO6D 1TYRA 5BRZE 4HJEA 1A14H 3BZFA 2DMKA 2R23A 4JFYB 4ANXA 3T4AA 3AGVA 5HHVH 4GBXD 1RZIB 1XSKA 2X4QA 1DQQB 3D07A 3KMDA 1CIDA 1IE4A 1SUJA 4EBQH 2FHCA 2P1YA 3C5SB 4PJ7F 3ET9F 4TUOB 3GS0A 5C07D 2BSTA 1FJ1B 3BVVA 3TYGL 1RL1A 3CK0H 4HJGA 2CO2A 3DSFL 1IMHC 3RVWC 3MRMB 4X80L 2XN1A 1MCLA 3ECWA 3L2MA 3WKQA 3QEGL 5BQ7B 2V9RA 3R06A 4PRIE 3WMQA 5EC2A 4H88L 1LJMA 4BK8A 4MNHA 3V95A 2DQTL 3DO4A 4X7DC 3GO1L 3QJSB 1QYGL 2APVA 2WCSA 2DH3A 1HQ4A 3DUUB 1EERB 4M7KH 5CCKH 4JDEA 5JO5B 2NXZD 4MAZA 1XO8A 3MV7A 5DJZB 3LSOB 4DCQA 5IVXB 3K6SB 2I9LB 1MI5D 4K3EL 1Z9SA 3V8OA 1R3HB 1A9BA 2H3NB 2VABA 4OY9A 1XF1A 4ODUB 7CGTA 1UM5H 4NZUL 1MCRA 4A39A 3JWDH 1KOAA 3RNQB 3PL6D 3WYRA 4L2LA 1ZTXL 5DVPA 4W9IC 1BVKA 1TTRA 4IU3A 5HVFB 1QHQA 4NUJB 1QR4A 2PF6A 3TCLA 3P9LB 3K4DA 2E59A 4POZC 5H4ZA 3BLKA 1YMMB 1NEPA 2GJZB 1D7CA 3DX8B 1QLFA 2H1XA 3GKWL 3JVGA 2OZ4A 1K4DA 1GC1C 2LU7A 2QKSA 4KC3B 3VQ2C 3CHPA 4AJVA 2XOTA 3FMGL 4CC4C 4DP8X 1EHXA 2Y1VA 3FCSB 3O2DA 4FI6A 1EPFA 1TQVA 3GBEA 4JAMA 3QFJD 3DV4B 3I9GL 4OKVB 3VG0L 4FXTA 1CXIA 1KELL 4Z7UB 3VDBA 1PCSA 2CH8A 3FO9A 3GPEA 4ZQKA 5I1AB 1UJ3B 2NT0A 4HD9A 3B34A 4U1IB 4EVNA 2H2SC 2NY3C 35C8L 4W9JC 5EBGA 4C56B 5BVJA 1B2YA 4MGXA 3D39A 3HG3A 4JANB 3GMRB 3KAAA 4N8UA 1D9KA 1F02I 4PHZA 4F24A 1FLRL 2CJSA 4NRXA 3KZ8A 3QNZA 3PJSB 2A0LD 2VLRB 4K3DL 3L3HB 4Z7NF 5IOPA 1J1OH 1RHFA 1A6ZB 1K6QL 3FRPA 4IGBC 2QVTA 1UGNA 3HJEA 3OJ2C 2ZXDA 2E8YA 1BZOA 2K45A 1PSKL 3M8OH 2X4NB 1I31A 4J3BA 3BP5A 3G5ZB 4GINA 4GT0A 1CF1A 4YXKL 1WWWX 3EH2A 3HC2A 1JGLH 5IESH 2NZ9C 1JK9A 1N26A 4JDVB 5IJDC 1KJ2L 2CM5A 1DVYA 3BHBA 1E7VA 4G42B 4WUKH 1CTNA 4MDJB 1NC2A 1ZE3H 2Q87A 3RY6C 4BRVA 4PJAF 1I8KB 2ZSVB 4PMFA 3A5VA 1JXFA 4C47A 1F4XL 1KV7A 5KVEE 1PYWA 3MRCB 1MJJA 4PRBB 3T71A 3GUTB 5EO1B 4LCWB 4IDJH 3KL3A 5CU9A 4P9HC 5D6CB 1CE1H 1MN4A 4V33A 4OLWH 5IR1A 2ZKXA 4GRWE 1S6NA 1H3VA 4ABVA 4ELMA 1Q0XH 2EYSA 5EZLA 1J7VR 2ATPB 5GGTL 1LTXA 3UCQA 3QJFA 3NGBC 2NCEA 3V6ZA 1I7ZA 5D1QB 3VI4F 3EO0B 1EUTA 3S36X 4FMFA 3FPXA 3RE0A 4HX1A 3HN3A 1DSFL 2YD6A 4PJXB 4YHLL 5KYWA 2RIKA 1MOEA 4Y19E 2A83A 1CXFA 2D4DA 3L5WB 3QNXB 3IJEA 4FFZH 4JG0L 3DPBA 3IYLW 1TKWB 4PJ9C 4ZOBA 1E9PB 2APXA 3VXRE 2Q8AL 5ACLA 3SKNB 2QVMA 5F88A 3GMQB 1RIUL 1T04B 1NGYA 3SGDI 1IBYA 1UURA 1BWWA 2DF3A 1XAKA 2CKBL 3JV6B 1X6NA 5C07E 4PR5B 2QPFA 3MDJA 5E6IA 2E9IA 6TAAA 4RA3A 1VZGA 4H20H 2IH1A 3MJGX 4I0CC 4DZBB 4I3RL 3MPCA 2HFEB 3GSQA 2O6EA 5DMIH 3IGLA 1OAQL 3GXPA 2W80C 2NNFA 2Y25A 3P40A 3FL7A 4XAKD 3KPTA 4A2MA 1IM9D 1UXMA 1AG0A 4YDMA 4HU2A 4HIHA 1RZFL 4ZPVA 3MLTA 5DT1L 1EZVX 4IRJC 4AV4A 1KJ2A 3QJHB 4U1JB 1ZGLM 4LSRH 5KWYC 4AYID 3QZLA 4JEGB 1UUSA 2D0GA 3BH4A 4FQIH 3B7SA 5AL8A 5JTWA 1EHNA 4EN3D 1MI5E 3WFEH 3FTGB 3GFUA 3WOVA 3ZKSD 3QEQB 1N8OE 1A4JA 3O3AB 1OQOA 2M83A 4MXQD 4L8CA 4P23A 5J6HA 2BZDA 4BXSV 3UTZA 5KBDA 1XGTB 2GEEA 3EJSA 3LNGA 4LKXB 4N25A 4PB0H 5G55A 1C5BH 1M4KA 3KPRD 4TUJB 4TQPA 3EFFA 4WSKA 4JFDB 1DCLA 3VA2C 2VZTA 4HXBL 4N0CD 5GGTA 3O4OC 4D9LL 2GBVA 4WJ5A 1OVZA 3Q13A 2IIJA 3V5HB 4DGVH 3HC3H 2DQUH 2BH0A 1IC5L 5LCVH 3IU4H 4CN1A 4UM9A 2IPKA 4KZDL 3C60C 4RWHA 5KYXB 3HZYA 1TNMA 3TBSA 2CHNA 5E9NA 4ODSL 5JYMA 2WNXA 5HDOA 1C7SA 1P84K 3ULUC 4N5UA 2K7PA 3N41F 2HJLA 2DEYX 2G9KA 5EBLA 4CVZA 4TVPH 5DC9B 3HI6L 3FUDA 2W59A 1BXXA 5BZXA 2F1BA 2WUBL 2CKBA 1ETZA 1VEMA 1PIFA 2OTWA 4M7ZB 3P54A 3RGBA 3H54A 4U7MA 1AD0B 2R4RL 2ED7A 3SKOA 3QDJD 1MIEL 5IV2A 3T2OA 4A6YA 1HE7A 4PY7A 5FA3A 4TUUA 2FX9L 5A3IC 1YCSA 1WUZA 5CEYA 2DI7A 4PWIA 5JORB 2GAZA 1XVSA 5EIIB 4AMKL 2OTUA 3GXMA 4HUKB 1JVLA 4HQQH 3MA7A 2YPVH 3C08L 4JX0A 3DJZA 3X3GH 2A6IB 5CBEB 4MJ2A 1CT8A 4U31A 1MAML 3PGDA 4FP8L 2WO3B 5IROC 3WKYA 1MHHA 1TTFA 1IFRA 1FE8H 1X5LA 4LLMA 4RAVA 4E41D 5IB4B 5E95B 1VACB 3TBVB 5BV7B 5C6TL 4UQ3B 1YEGL 1MEXL 4PMEA 2YEZB 5DJ6B 4MS8D 1KXQA 1O9WA 1I53A 2ICES 3OR6A 1GGIL 4NRYB 3EGSB 1B6UA 5FV1L 4NN5B 3CLFL 2ZG1A 1FAIL 3VQLA 4WFFE 4XI5C 2C9PA 2EXYD 3F84A 3NEXA 2OK0H 3CGTA 3QNYA 1CU4H 4AXWB 1SVBA 5F7DB 4Z7AA 3U0PB 2JSFA 4B96A 3RWDA 4ZNEA 4AYSA 1ZIBA 3LJ3A 4KMQA 3KBPA 2BIOA 3LV3A 3T04D 5H2BA 1CDGA 1SHSA 1XMEB 5LNGA 1KJVA 2VDNL 3FT2B 2NXYD 4XRCB 5H94A 4PJXE 2Q6WA 3OZ9H 2VC2H 5J6SA 4ODWA 3OV6A 4OVVA 2Q8BL 3M86A 1QFWI 4O2EB 3SDDB 1VFAB 5DFVC 1JPSL 4NQDB 5ENWB 4KMTH 5EDXA 4PLJC 5KVGE 3GPSA 3V4UL 4GI8A 5HYSB 4CC0A 4PV1C 1UJ3C 3GMNB 4MNGA 4XAWL 3ZRSA 3VD7A 3QZOA 2VZUA 1JXGA 1SQMA 3PGFL 2WLMA 3OKDA 4P5TD 5I1GH 4U7SA 2JLLA 3A4FA 3BKJH 3NJLA 5CU5A 4XMKL 3RWJB 1A7NL 2ODHA 3IN0A 3QE5A 3L48A 4JRXA 1BF2A 2QDVA 4FL4C 4ONOA 4HPYH 5KJ7E 4G71B 1CBJA 5IK3B 4E5XB 1HHIB 3LNDA 5HHOA 2MQ0A 5DVNA 1IGYB 4CGTA 1BOGA 3GSXB 4JM4H 1ZWIA 4A2LA 4NOBA 1KGWA 4ZUUA 2ED9A 2OI9B 2YAMA 2BZ7A 1AGBB 4L3CB 5CJ5A 5F0LB 1ILSA 2GITA 2V7NA 2WZ5A 4O2CA 5HI4C 2AJSL 3UEQA 3UDWA 2A77H 5HHNA 4RVBA 1JSYA 1FYTE 4KJQD 3UTSB 5IGXL 4AVIA 3SGEH 4PGZA 2W81C 3TZVB 1XSOA 3TIEB 1VZHA 3X13A 3TC9A 1CGSH 4DH2A 3SKJL 3K3QA 3JUZA 3KDMB 3ARED 3SD2A 4FZ8H 4APXA 4E42B 5C0BB 2RCSH 1N3NB 1AO7A 2YQBA 4U3XA 3B7RL 1EJFA 2CA4A 1JG9A 4IRJA 3MNVA 3V5DB 4BH7A 3EYUH 3L3GA 1CFVH 4OZGA 3HFFA 3KPRE 2VOTA 1NL0H 5DRXB 4LSQL 2O6DA 4DQOH 2NNAB 1KEMH 1XCQB 2J55A 4HIEB 1RHHB 3VGAB 3DXAB 1ORSB 1CUOA 1L6XA 3SD5A 2EDRA 4IBZA 1X5KA 2XN0A 3K7UA 3ARBB 4UWQB 5IEKB 1KGYE 2VL5B 2FJUB 3LKQB 4QRAA 4FERA 5TDOA 5CEZL 1U2YA 2RACA 3S35H 5GS0C 2UWEE 3SDAB 3Q1SH 2D0FA 3THML 3O0LA 1CICD 4YWGL 3SO3C 3Q6GH 2HX8A 3EDEA 1X7QB 4XMPL 1FIGL 4KHTL 3VQ1C 1C12A 4CSSA 4JFHD 5IY5B 5I18L 5GGRB 1UKSA 4I1PA 3KLLA 3DROB 4BFOA 4KV5F 4F7EB 1IX2A 2B2XH 4JZJA 1BFTA 4BKLA 4HIJB 3VFSA 5C0IA 2BCKA 5EU3B 2ZWKA 5JW4Q 3MRDB 2ITCA 1HESA 1ES0A 4N2LA 4M03A 1FVEA 2XWBB 4K7PY 2I27N 2JE8A 4NQSB 5I74B 3VFTA 1GZPA 3QDJE 4ZOEA 4PJDF 4Y19A 1JWSB 1GGTA 2I60L 2VSDA 2A7BA 3LN4A 1FCGA 4HAFA 12E8H 2WZPD 1SXNA 4UU9B 5PAZA 4OD2B 4AQAA 1BAFH 4JFYA 2VSMB 3DOSB 3BAYA 1DQQA 5DLML 3C5SA 4LDOB 1RURL 3ALPA 1H3WM 4TUOA 1GJIA 1FJ1A 1EWHA 2RQ8A 4KO5A 3CWGA 1U33A 1IKNA 3STLB 3EXLA 3MRMA 4E41E 1KYFA 2DQIH 4HWEL 3L7FB 1I1AD 3B43A 1NGQH 5IHLB 4Y1TA 3TH2T 5BQ7A 2K8MA 5FM4A 5AAPA 4WTQA 1XB8A 2JQAA 2F8VA 3AW5A 2PCXA 5AW8B 2WYTA 3ARVA 1WA0X 3MV9B 3VYNA 3WTVA 2BSEA 1TQUA 3NIGF 3DUUA 5EOQH 1KB5B 1QATA 5JO5A 4MCMA 1OSYA 5IROA 3PWPD 3W11D 1MF2H 5DJZA 5CBAB 3LSOA 2DQJL 3SDXB 1Y1DA 5IVXA 3WTSA 1OB1B 3K6SA 2I9LA 4F1SA 4MMZB 1SF3A 2YPLB 4M61B 4F8TA 1R3HA 5F7LB 2H3NA 2YXMA 2NLJB 5F21B 3QIUB 4ODUA 2CJ3A 3ZRCC 5F6IC 3K0WA 3MZTA 2FGWL 3RNQA 1BFVL 4NQDE 2BSSB 2XX1A 4QHKI 1H8LA 5LNDA 1RV6X 3QR1A 4NUJA 2UYLB 2MFNA 3T6ZA 1BIIB 1TR7A 1E5UI 2GI7A 2IGFH 3P9LA 4NOFA 2XTSA 5C6PB 3OSKA 2VXVH 5FHBH 1YMMA 2GJZA 3QH3B 3DX8A 1P6AB 1RKRA 5F9JB 4M7ZC 2DLIA 4ZODA 3V6BR 4Z7WF 3QIBD 4U4IA 3KH4A 3FCSA 1LO5B 1V7NH 2I7SA 3ZTNH 3DV4A 4OKVA 1UD5A 4Z7UA 1ULVA 1G87A 3QS2A 2ID5A 3SKUD 5I1AA 4WO4B 3L1GA 5ES4B 1UJ3A 3R18A 4NO5B 4C4UA 4EI5C 5CS7A 4U1IA 2DD8L 4HPOH 3CX2A 3WIHH 2DWYA 3GUFA 2C9XA 3EJCA 4ELKB 1YY9C 2FJHB 4C56A 5I5MA 3X11A 1TFHA 4JANA 3GMRA 3UXFA 2X0VA 3PJSA 2VLRA 1M42A 5EUOF 2W9DL 5D1XD 3L3HA 4OZHE 1QBBA 3I3BA 1KBWA 1SDYA 4WCYL 1BD2D 4S1RH 5BRPA 5HY9B 4JM2C 3UPRB 3PQYD 5CSZB 3QQ4B 2X4NA 4NN5C 2HTLC 3G5ZA 4FNLL 4W9GC 4Z78B 2CU9A 1MFCL 2H0JA 3FN0L 5B1CA 4LQFH 5DMGD 2CNYA 5LG6A 4JDVA 4J39A 3L3JB 2YQ2A 4AYMC 4JGUA 4G42A 5IMMB 3LQAH 3FQ1A 2WWNA 2ZX6A 3UZVB 3MO1B 4MDJA 2BVTA 4DQAA 4UQDA 2MKLC 4KH9A 5KBKA 3T0ED 4X8GA 4P07A 1I8KA 4OF6A 2ZSVA 5HDWA 1IGML 1RU9H 4GSQA 2EC9U 2LABA 5A7BA 3REVB 2X70B 4F7MB 1ZEAL 4ZX4A 1RJCA 3MRCA 1X5JA 4PRBA 3GUTA 5EO1A 2M26A 4LCWA 2BJMH 1NEZG 1QFWM 5D6CA 4OM0H 4XXWC 3WE1A 2VLKB 2IAMB 2KLSA 1T1ZB 3D85B 2BP8B 3LRHA 3GSWB 4DKFL 4Q0XL 2QSCL 1DVFB 1LEKB 4GEJA 4Q9BA 4FGMA 4DP6X 5IW1B 5D1QA 3EO0A 2LR4A 4J3OC 2DIEA 2N7AA 1XSIA 4MAYC 4DOHB 4UNVA 1N5YL 1RULH 2WBKA 1G6RB 3FW6A 3ZYIA 5EORL 2WP3O 1MW3A 4PJXA 4A2DA 2PP9A 4QWWD 3WIFB 3L5WA 3QNXA 2AEQH 2YC1B 3QUZB 5F97E 3BWUF 1LHZA 2NY6C 4OJYA 1TKWA 1HINH 1PF3A 2XKSA 1JNNH 1E9PA 3D3VE 3DJRA 4F7CB 2HJKB 3WJMB 5HHQB 3SKNA 3VVWA 5AOMA 4YPGB 4DN3H 1T4WA 3GMQA 3WLWD 5TFSH 1T04A 1MKFA 4BFKA 1QRNB 1HHHB 3X1GA 3JV6A 3RTQD 2Q86B 4BZYA 3TZVC 4PR5A 1RIHL 1DBMH 2MNJB 1LLAA 4OKDA 5LG1A 5SX4I 4DZBA 2HFEA 1S8DB 3QQ3B 1FNSH 3MA9H 1I3GL 4F3FB 3CG8A 4KHXL 3QEHB 2FWSA 4DPAX 2I9TB 5C7ZA 4HISA 3MCYA 2FEDC 1KTDB 1GSMA 2V5MA 4FI8A 4N8VB 1KACB 1AZCA 3QJHA 1LK3L 4TNWF 4U1JA 3CVHB 3S2CA 1KCSH 4TULL 3IE4A 3BD3A 3RVXC 4PJEF 3V4PB 1AS6A 4UOQA 1P4LB 3VGAC 1RZKL 3N6YA 4HWBL 4N8CH 3JWOC 5TJWK 5BV7L 3MUHL 3IMWA 3MXVH 2Y3NA 1JD7A 3FTGA 1KGCE 3MNWB 3QEQA 2AJXH 5C0ND 2J6EL 2R39A 3O3AA 1NUDA 3ARPA 4UI2A 4XPBH 3SDAC 1XGTA 4LKXA 4KITB 3W37A 3P2TA 1T22B 4E2OA 1X4XA 1IBFA 3B2PA 2ZWYA 5ABZA 4FG6C 2BP0B 4TUJA 1G94A 4JFDA 2N7SA 3SDYL 4NKQB 3EYVB 1GAFL 4ANUA 5ISZB 3V5HA 3ZX1A 1MLBB 1U95B 4WNSA 1KYOK 1N7MH 4DNLA 5K39B 2BC4B 2EH7H 3CUPB 4M6OH 2LLNA 3BC9A 5I74C 4JG1H 4XN7A 5KYXA 3ALWA 1MCWM 2PYEB 3H56A 3JYBA 4EKXA 1WO2A 3TV3H 2VWEC 1P84J 2DAVA 3GB7B 4I18C 4QXTB 5FYLE 5FCSH 5HTSA 3SBQA 2NSXA 4D9RD 4Z5RB 4PJ7B 2ZPKL 2JI2A 3G6AB 4XP5L 1YEKL 2WXMA 3EJYD 1QLEB 3FTWA 4JUSA 4P59H 3V0DA 2D31B 1OKEA 1N4XH 1RY7B 3RX5A 1JFQL 4J2QA 2F5AL 4Q14A 3V52H 2OZNA 4EJ1C 3CFTA 3UTTD 5AG8A 2PPEA 5I30L 3DX6B 2H2PD 1DLFH 2OMXB 1AD0A 5D1XE 1D5IL 3VGBA 2DIBA 5DHVH 1BD2E 1JZDC 2AXGB 4LPWA 4X6DF 2AQ3A 4UTAL 3IGFA 1CCZA 5JORA 1GMIA 5EIIA 1DDTA 2MIZA 1FHNA 1QQDB 2JH2A 3B9KD 4R4FH 4B95C 5F9OL 3CFQA 1CD1B 2EACA 2HH0H 4X5RA 4HCGA 2A6IA 5CBEA 4RMUA 1QWUA 2XACC 3FHQA 3M88A 3ULVC 2VDMB 4B27A 5E8DH 4FLHA 2LVCA 3AG1B 3AUVA 5GXBB 4U6VH 4YDLC 4D8PB 5IB4A 3PWJB 4KTEH 4HWBA 3T0EE 2NY1C 2F54B 3TBVA 4UQ3A 2XYBA 1PDKB 5CZVL 3O41B 2E76C 2YEZA 5DJ6A 2J6EA 2NY2D 3QIUC 4O2FB 2EH8L 4NRYA 3EGSA 1R34A 2G0LA 4YBLC 3DVFA 1IEHA 2PXYB 2YRBA 4JK0D 4KK5C 4XMLH 4MNQE 3WTYA 3QG7L 3C8KB 2EDDA 2XWEA 3PUCA 2C1OB 2NY5C 1OSZB 4HJ1A 1WE5A 3HNSH 4AXWA 4HC1L 5F7DA 3IBEA 2JJWA 4OCWH 3U0PA 3OKLB 2X7LA 4WWKD 2CHZA 4ODTL 5E51A 2CIKB 1ETJA 3GSNB 1AJ7H 2F18A 2BVPB 4XBEL 1CXHA 5DURB 4J3SA 4EOWH 3FT2A 1F3RB 5IW3A 2FIRT 4XRCA 3WFDH 4F2ME 1MFAL 3ERXA 3QRFM 4BWTA 3SDDA 3NABL 4O2EA 4ZOCA 4NQDA 5ENWA 5DR5H 5GHWL 3LPFA 3C5ZB 2KZKA 2DM7A 3LDBC 3GMNA 4CBZA 2YEQA 4LDEB 3ZPDA 2HPOA 3Q2WA 4NNPL 1A8JH 3T65B 1B2WH 1EZSA 2YBGA 4JHWH 4Z7NB 1GVIA 1T2QL 3T1FB 4FQPA 2V3FA 3RWJA 5EDSA 5EEWA 4MQ7B 4AYFB 5B39G 1Z9NA 1GW0A 5JIIA 4GQQA 5IK3A 1O7DC 2IOIA 2W07B 4MCZB 1HHIA 4Y5VB 4E5XA 5J89A 4MYWB 1IGYA 1WLHA 5K59F 3ATAA 3GSXA 3F00A 3PWLB 1CS6A 4NZTH 5LUMA 3EFDH 3RUGF 1EDYA 5D96B 3VSQA 5I9QB 2R0KH 2PETA 4OVUA 1AGBA 4L3CA 2AV7B 1SOXA 2BWDA 4J8QA 4UINL 3WY2A 2V4LA 4YX2L 3AQYA 4KDVA 4PJAB 4PIBA 3CH8A 3HKZA 3UTSA 5I73B 4LKCB 4XHJD 4YBQC 5DUPL 3TZVA 3HKFA 3TIEA 3AB0C 1GYWA 3DBSA 4MB1A 5EO0B 1MFBH 2XXGA 1RUAH 3HG4A 3KYNA 5DZJA 1T0MB 2BY2A 5E94B 5SX5H 4HUVB 1JNLH 3HPLB 3ZDYF 4POYA 3M17B 2NW3B 4LNVA 3KDMA 4E42A 4AQ1B 1JMZA 1A6UL 1G6VK 5TPWL 5C0BA 4O9HL 1N3NA 4GXVH 4FG4A 4XVUC 3X1EA 5I1JL 4HIXL 5SX5K 5BZDB 4OZHF 4PRAB 1PKQE 2DJ4A 3E3QE 4XWGL 3QUYC 1ODAA 1KB5L 3V5DA 4ZJ9A 4TL5A 3VI4B 1SUHA 3S37H 3TA3C 4HC1A 5DRXA 1M7XA 2NNAA 1XCQA 5JIMA 4HIEA 1RHHA 2IOOA 3HE7D 3GM0A 4RISH 5AKRA 5IQNA 4DO5A 2A6JB 1R3JB 3DXAA 5I1EL 1ORSA 1LWHA 2CGRL 4PLKD 1G84A 3ARBA 3VM5A 5IEKA 1OAXH 1LGVA 1RUKL 2VL5A 3LKQA 4U1GC 5MEND 2X5PA 4HLEA 5I1HL 2PYEE 3UYPB 5FLUA 3QJQB 4KRNA 3SDAA 2LQRA 4AGLA 2HRLA 4GLRI 3B6SB 5KN5B 1JS4A 4JLRB 2EUWA 1X7QA 4UUJB 1I9JH 1QSVA 1XXFC 2OXHB 3BGMB 3KWTA 2G2RB 5JW4N 3QZMA 5T1DH 2PW2B 5GGRA 4UB0H 2Z8VC 3IN2A 3MLYH 2DBJA 1TCMA 3DROA 5F96H 1JZ2A 4B9JA 4F7EA 1OE3A 3SE3A 7FABH 1NANH 2HT3C 4HIJA 3V7AG 5KW9H 5EU3A 3UTTE 3MRDA 3QW9A 4M7LL 4NUPA 3VXME 3C87A 2XWBA 4NQSA 3KCWA 3L1OH 5A2BA 1UCTA 3LYRA 3SGKA 1JWSA 2QADB 3LHPH 5FYLL 4DO6A 5AUMA 2W0LA 1AYOA 3ARZA 2XA3A 4XB8A 3BMVA 4UU9A 1D3CA 4OD2A 4WW2B 4LHUD 4FQHB 2B5IC 3HN8A 5FM5M 2G3MA 3DOSA 2QZQA 4UV7H 1NGPL 1VCAA 5C0AB 5DI8A 4L3EE 3GI8H 1QW9A 3C09B 3FPYA 3OKKB 5FFGA 1IBGH 3BKYL 1BQ5A 3H6AA 3STLA 5F7EL 1OGAD 3BI9X 5JXAH 1BF5A 3SE8L 3OHXB 4P2OC 5IW6B 3I50L 5J8OA 3L7FA 3MRJB 3ESNA 1Z1WA 4GYBA 5J5EA 4I89A 2JTYA 5TE6L 3VFGH 4OV5B 1DBAH 3QZWB 1J8HD 4XPGH 3UFIA 3MV9A 5L0QC 2NY4C 4ZG1A 4NBXB 4YL4A 1KB5A 3HI5H 1VLXA 4WHTB 5I2IB 5TE7H 4BHUA 1WFJA 2EUZA 1VKXB 5CBAA 5KVDH 2OMYB 3KJ4B 3ISYA 3SDXA 3SYCA 2HKAA 2VDOB 4MMZA 2YPLA 4WO0A 4XTRC 5ADPL 4M61A 5GZNC 4JRWA 5DLLA 3V55A 2NLJA 3ZVVA 3VACA 3QIUA 5AZ2L 3N1FC 3TOPA 1ML0A 3UAJC 3VGHA 3GXNA 3JSSA 4OCYH 2XTJC 2QPSA 4Z7VF 2BSSA 2EIBA 5E6SB 3ARDB 5HDBE 3VXSB 5D2NE 1UWXH 2J8UF 2JF1A 4K9EH 2YOCA 5J3HC 2UYLA 1NCAH 2P24B 1BIIA 5E2UL 3IK2A 5ESVB 4JRYE 2FSEB 3QH3A 3BT0A 4WI3A 2VR6A 3BP6B 1O6TA 1UWXK 5F9JA 1KENL 4NP9A 1G6RL 4X5PA 1TJGL 1LO5A 1XZ0B 3E1ZA 3PREA 4NQED 4X83A 1KYUA 4MA3B 4WO4A 2RALA 2ZKYA 3RZCD 5AWNH 1ET5A 4NO5A 4K73A 2D03L 2AABH 4XC3L 2AJYH 4ELKA 2FJHA 3TF4A 4LLQA 1OPGH 1E4XL 4OFYA 3VXPB 3SE6A 3H85A 4ODXB 1M7IB 4B9KC 1FF5A 1BAGA 1MSPA 4XODA 1DBBL 3DETC 4C4KO 3JBG7 1NLDL 2HRPL 5EWIL 1TZGH 5KSVB 1LO2L 5HY9A 3LOWA 3UPRA 2F7QA 5CSZA 4I1RA 3QQ4A 3RPIB 1JL8A 4TSBH 3W5MA 4Z78A 4PBWD 1R0AH 2V2TB 2EAEA 3S5LG 1REIA 4LCCB 3BKML 1GYVA 5I6OA 3L3JA 4YO0B 3CVHL 2ZP8A 4E9LA 4UT9L 5IMMA 4Z8FH 3ILDA 2BNQD 1ZLDA 3MO1A 3Q43A 3V4PL 3UZVA 3WHXB 1EQWA 4GAJL 5TD4A 3WMPA 3QIWB 4BFFA 1IAII 1ITBB 2HB0A 1F6AB 2WWMD 3BJ91 2JJVA 4MJJA 5E6YA 4ZFOB 3HUJB 3ZY7A 4TVPE 3CFBA 1INQB 3REVA 1WFNA 1YEHL 2X70A 2W1NA 2WBWB 1L9SA 4F7MA 3MKKA 2WZ6A 1FVCB 5MENE 4S1SH 3CVCA 5EPMB 2XVKA 4IJ3C 2B3IA 2VZSA 4LGPB 2HJFB 4J3XA 5D93B 1BIHA 4A2EA 2UXTA 4EZLA 1HIMH 2YMTA 2WV3A 3B5GA 4YSEA 5A2AA 4N3UA 1CG9B 2VLKA 5D6DC 1IJNA 2IAMA 1HILB 3OM3B 4PWHA 1T1ZA 3D85A 4FJZA 2BP8A 3GSWA 3MLUH 3WEMA 1PMYA 5AZEH 3BAEL 1AGEB 1DVFA 3QA3B 1LEKA 1IAIL 1T6WA 2HT2C 5IW1A 4XNXH 4QKTA 1L9MA 3VDAA 5F9WB 4WGVB 3UBGA 1G6RA 2APFA 2WNKA 5FWRA 2FT7A 3QWRA 4KKRA 3C6EA 4BH8B 2ZWSA 2DYRB 1LMIA 3WIFA 3RWFB 2X1QA 1F58H 1YNTB 2YC1A 3QUZA 4V1DD 4NO3B 4LFHD 4YJZL 1BX2B 5E2WL 3T6WA 3L2LA 1FG9C 2B59B 3FJTA 4PVMA 5D96C 4F7CA 4P9HH 2HJKA 3WJMA 2V2XB 2O1AA 5HHQA 2HFGL 4LHQB 1J0YA 1QLEL 4YPGA 5ALCH 2JCCF 2CHXA 5ANHA 1QRNA 2X28A 1HHHA 1DANU 5AVYB 2BPBA 5I73C 2Q86A 3JWNC 3MX0B 4P99A 4F37K 2Y06L 4ORGB 2ZWNA 5I71C 3NRQA 4KY2A 4MA7H 1OGAE 2VB5A 4U1LB 1W0YT 2HWZH 5E2JA 1S8DA 3ZYZA 5HD8C 3QQ3A 2MNUA 4PM1A 4F3FA 1JCVA 1WBZB 3L16A 3HG5A 3B2VH 3QEHA 2VLLB 3VWKD 1IC4H 1QNZH 2FO4B 4MDIB 2I9TA 1LO0L 2JKJA 1J8HE 1KTDA 4H1LH 4UZSA 1AQMA 5SWZB 1WEJL 4ZT1A 4N8VA 1TETH 1L9QA 2AP2A 5ID1B 3CVHA 4IRSC 4UT9A 4Y9EA 3V4PA 4OU3A 5DS8B 1P4LA 2X9YA 1EIBA 3L5IA 4L8DB 4RGOL 4BXVA 1GTFA 1QUNB 3D06A 3MNWA 5FGBA 2ESVB 2XZZA 5JPMA 1V27A 5D1ZB 2GI0A 3II3A 4IMKC 5FR3A 3US1A 1NIAA 4EDWH 4YQXL 4U1MB 3S34H 3NIDF 3VJ6B 2YO3A 3STBA 1T22A 2D3JA 3SPJA 5T8IA 2IV8A 3KYKH 1KG0B 3VXSE 3IPEA 3QZBA 2Q7AA 3BD4A 4LGSB 2DWXA 5I8OH 2BP0A 4P2RB 3JTTB 2IFGA 4TF4A 4FRWA 2B39A 4B0MB 5JW3L 5AVSB 1A7QL 1ND0B 3EYVA 3GSNL 1CN4A 1MLBA 1U95A 5LWYL 4PJDB 5A2IH 2ZUQC 3OB0H 1OT1A 1HCZA 5K39A 2BC4A 2KZBA 3CUPA 3LH2H 2PPCA 2ZCLL 4HF5L 3OL2A 3UAJA 4JRLA 4HIIB 4QRQB 2PYEA 3FT0A 4IIQB 4XNDA 4I85A 3PNWB 5E9DB 3GB7A 4QXTA 5D7JC 4Z5RA 3MYZA 3T5WA 2NY7H 4K8RC 4G8GD 1IZJA 1I9IH 1C1EH 2DQHL 2ENPA 4PJ7A 3KM2A 3WXWH 4PBVC 4NRZB 1L5GB 5BS0A 5BUAA 1FP5A 4QY8B 2WVUA 2AQ2A 2D31A 5TE4L 3UROR 1DR9A 4Y4FB 3QWNA 4UNIA 3HMXL 4FFWD 2FCBA 1CWVA 3DX6A 3L3DB 4PI0A 2OMXA 1RUPL 4GBXB 4RH4A 1A7OL 2AXGA 3MROB 1FFRA 2OR7A 5E1HB 3NIGB 4TRPH 3P9WB 4XBGA 1MLCB 1QQDA 2K6WA 2I5YH 3MODL 4Y89A 2C4FU 4PJ8C 3CFDB 1NFDE 5BPPA 5I1KH 1XCWA 1CD1A 1PG7H 4X4MA 3TXAA 3LPOA 5LGHH 5LBVA 5I6XB 1OALA 5GIRB 1E5YA 3CN1A 4KK6C 1Q72L 2D7PA 1WFOA 2HXAA 5I6MA 3IDYC 2OMVB 4ZUVB 4D8PA 5LQBL 5M95B 3ABGA 2FYYB 1VCBC 3PWJA 4BK5C 2F54A 4PRPE 1PDKA 3CVDA 3O41A 4ERSL 2NXZB 1OTSD 4O2FA 4YHZL 4WUUD 5D55A 4ZPTB 3GMLB 1XFPA 3IJ7A 1EHLH 2PXYA 3JTSB 2ZYRA 2WXNA 1DLHB 3VW3H 4Y2DD 5C09D 3C8KA 4KFZC 1M1SA 5MHSE 1LM8V 3ILPB 2C1OA 3S35X 1OSZA 3QORB 3DX3A 3PL6B 1SM3L 3QDMD 3RQ3A 3OKLA 4Z7WB 3OQRA 4OBSA 3QQDB 2CIKA 3GSNA 1JGDB 2BVPA 1ACZA 2OQJB 1YYMH 4KGJA 4WU5B 3UABA 8CGTA 1V3JA 2GEQA 2IQ9H 2WJ7A 3EIFA 3IS0X 1VFUA 1NWOA 4X5QA 2VH5H 4E9QA 1T1XB 3ZUNC 1NCDH 1O9VA 1DP0A 2E74C 3TX4A 3DOIA 3WFZA 3IGUA 4RFOL 4BUGA 2FEJA 4V1DE 3S3JA 1AD9B 2YLKA 2IDFA 3C5ZA 5D6DA 3ZE1F 1U3HB 2OK0L 5E5MB 1M1XB 2IFFH 2WLHA 1BAWA 4HCFA 4GPVA 1I9RH 3QFJB 5EUOB 3T65A 1WP6A 3MLXL 1Q0YH 3B9DA 2CLVB 1G7MA 3T1FA 4GAGL 4P5MB 1BEXA 2VUYA 2WYHA 3HMXA 3ZQ9A 1C5DB 4MQ7A 4KKAD 4AYFA 1J5DA 1SY6H 2C3XA 4Y5VA 2W07A 3P1VA 4MCZA 5AW2B 1AI1H 5IHUL 4XCCL 1ZXQA 4M7JL 1PJ9A 3PWLA 5BO1H 3L4WA 2CK2A 3FUJA 4MRBA 1TO5A 3HB3C 3TEYA 4BSJA 2M1KA 2ZX7A 1T7WA 1XX9C 1QRKA 4I4WB 4MCYB 2Z4QB 4LOUC 1LO4L 1TENA 2AV7A 5EU6B 4PJAA 1NICA 4H26B 4NUGH 4S2SB 3GJFH 1A7BA 1HEZB 4LKCA 4XNUL 3CDFA 1IAIM 5EO0A 4HUVA 2LE9A 1J1PH 2WNGA 5E94A 1J5HA 2MQGA 3EKCA 3HAEH 3HPLA 1NKRA 1P5UA 2F19L 3U6XA 3M17A 2NW3A 2EDEA 3LEYH 4AQ1A 4TTDD 4XWOC 3NJNA 1A6WL 3QNFA 1BFOB 1GZHC 2FT6A 4KJWD 2EICA 5D93C 3VYOA 1XB3A 5BZDA 1A0QH 4PRAA 5I0DA 5SV3A 1FI8C 3CZGA 3VI4A 1Z9OA 1XBDA 3I3EA 1UWGL 1Z9LA 3HEIB 1PY4A 4PP1C 2VDOL 2YWYA 1R3JA 1R33A 2A6JA 3PWVB 3BPLB 1XH3B 4X5WB 1E42A 5F0PB 5FGRA 2HG0A 3F7QA 1S9YB 5EEVA 1AACA 1Z5HA 5AW7B 3UYPA 2BO0A 1QSEE 3A3YB 4B53A 1BEYH 3SGEI 3B6SA 1DQVA 2VISB 5KN5A 3BPOB 4JLRA 5HYJB 5IJKC 4AVHA 4G11A 4UUJA 2OXHA 3BGMA 2G2RA 1MPAL 2PW2A 2VXUL 1JGVL 4G6MH 4BZ1L 4KTDL 1FCCA 3ZR5A 4EIZC 4ZFGH 1ZAGA 1MCHA 1PX3A 4Q9CA 1RJLB 3GK8H 3BN9C 4Z3GA 4DTGH 5FYJD 2EE6A 3ME0B 2F6AA 3APFA 4J6RL 2HUEA 3N55A 4OLVL 3HOGA 3QPQD 1XGRB 4MMXB 3WJJA 2ADYA 3QUKB 3IFLH 2J2ZB 2R4SL 4WW2A 1YEEH 1YEJL 3HNTL 3RP1A 4FQHA 3QRGL 2B4CH 3LXCA 4PJEB 4ADGA 4JO1L 3EHBD 2VQ4A 4X7FC 4HS3B 1THAA 5C0AA 5HGDB 1IM9B 3N40P 3C5XA 3JTBA 3OKKA 1GCFA 2NDFA 3BLBA 3UP6A 2Y23A 2Z64C 3KS0H 1UOLA 1QLRB 3IDXL 3OHXA 5IW6A 3LKPA 1AIZA 1FGNH 3CMGA 3T6QC 3MRJA 2AQ1A 5D1ZC 4GG6F 3QJZA 3RAJL 4OV5A 4I87A 2Y36H 3WKMH 1CXKA 3QZWA 1U58B 5GPRA 4ALAL 5C09E 2WAHA 1PJWA 4XPFH 4WHTA 4C55A 5I2IA 5KTEL 3WDJA 1VKXA 1FA4A 3MJ6A 4LIQE 5K1JA 3QDME 2OMYA 1CF8H 2EDQA 2VJ8A 3BUBA 4I2XE 5FKAB 3NCMA 5D7KD 4R90H 4ZFOL 3FU5A 4OF8A 3DWTA 4R4ND 5AVVB 1BXAA 4YHML 5A16B 5DMKB 2CM6A 1EANA 1KGXA 3IJYB 4JFED 4X50A 3ZSSA 1PLGL 4Q9QL 2WIIB 3PPEA 2XA8H 3ULAB 4AGMA 5IBLC 3KBFA 5CHNB 2HKFH 4KPHH 2ZAHA 2ITDB 2EO7A 3ARDA 2LV4A 3VXSA 4RRPG 5BOPA 4LLUB 5DGRA 1LK2B 2P24A 4E9SA 2EEBA 5JQHC 1G9NL 2W60B 5ESVA 2FSEA 4WSGA 4AGQA 2V3EA 4BZ1A 1A66A 3AMKA 1UJTA 3BP6A 4ZSOE 4AEHH 2CJUL 2PO6C 4G7RB 4X6DB 2YLHA 5C0DA 4U7KA 4G80B 4GBXC 1Z0NA 3TEZA 4JFPB 5T1KD 1XZ0A 4PJFF 1KCLA 3SDCD 3I84A 2I85A 2CAKA 1JZHA 3RDTD 1SBSL 3O0RL 3KJ6H 1BP3B 4MA3A 1KTJA 3K1DA 4UAHA 4KDWA 3NESA 4D9QD 1BVNP 5LN8A 1WZMA 4YHPB 3V8CA 3KWVA 3PV7A 1W16A 3TJEL 1QBLL 1F86A 5FB8B 1PS3A 5T3ZL 5I6XC 4WVRA 1MCDA 3B3BA 1KCRH 3UJJH 3VXPA 4K3HA 2F58H 4WFGD 4ODXA 1M7IA 1AKJD 4KQ4L 1IEBB 4XCFL 3TPKA 1X4ZA 2COVD 4AMWA 5DJCB 3EH3B 4XP4L 1SYVB 1ACXA 5AZUA 4N24A 4L4TD 5KSVA 1FZKB 4G6AC 3N85L 4EIBA 1VFMA 3RPIA 1AKPA 5B38B 2V2TA 4JE0A 3F7LA 4P04A 2TSBA 2DIAA 4XC1L 4LCCA 4Z7OE 1KN4H 2C3HA 3QG6B 1MIML 4YO0A 3OR7B 2BSDA 4AQ8A 5JZ7D 1H3UA 2ZXGA 3B2DC 3WHXA 4OM1L 3QARA 1G9ML 5IT2H 3QIWA 1H3GA 1F6AA 1KCVH 2B9BA 3HUJA 5CJOL 4ZFOA 2JB5H 4ZMWA 1INQA 3TLRA 1FVCA 2CBMA 2D7QA 3AY4C 3FBQA 4UIKL 5EPMA 3S36L 3DX9B 4DGIH 3U6RB 4FXGB 3DJSA 5DZPA 1A3ZA 2HJFA 1GZHA 1KIQB 4KOCA 4NLHA 2NRDA 4FQ2L 3A6CH 1CG9A 4LO9A 1HILA 1EFQA 4KO6A 2EDYA 4PJIB 2EVJA 5IG7B 1WZ1L 1XXDC 4ENZA 3PAVA 4IHOA 4XNZB 1S5IL 1ZOXA 4I0PD 1OTTD 1AGEA 1OAUL 3QA3A 4LBAA 3T8MA 2Y7SA 4NHUB 1JHKH 1CLZL 1OHZA 3BT2L 3H9SD 4P49A 3T3ME 4PRNB 2YSTA 4B9FA 2W9EL 3HA0A 2ZD0A 3VRLE 4WZ9A 1PX4A 3RUGB 1K5WA 1H15B 3G5XB 4LVOB 3GINA 1IB5A 1QOKA 3LZFH 1CGYA 1ESOA 3SBRA 4BH8A 1HZHL 1M7UA 2A0LC 3HC4L 1YNTA 3RWFA 1OM9A 3FT3B 4NO3A 4RX4D 1BX2A 4JE4B 5CFHA 3BJLA 1FFQA 3VMOA 2B59A 1G0XA 3CC5B 3FH5A 3N1PC 5HVHB 2V2XA 1MCFA 3ZKMD 2HUHA 1C5CL 3MMEB 1JHLH 1FDLH 3O81A 4LVNB 1DO5A 4LCUB 4C4BA 5DUJA 3PP4H 3FB7B 2LU4A 4G1MB 3MX0A 3ZDYB 1I8UA 5DS2A 4ORGA 4BFJA 5DQDL 2NR6A 1MXDA 5I5IA 5JOFB 2PWDA 5CGTA 4XE0A 4U1LA 2XBDA 2D7TL 4Y5XC 1K4CB 4NIYE 3AXLB 3U2IA 4M5ZL 4G43B 1WBZA 2IADB 5C3LD 3LN5B 1P4IL 5CCJA 4S1QH 2VLLA 2EDMA 4GAFB 2FO4A 4MDIA 4LGRB 1KCUL 5SWZA 3N1GC 4ODHL 4FLQA 2BNRD 4TYUA 1TQSA 5AVUB 4CSZA 4EF3A 5ID1A 3T0BA 2X12A 4OH2A 3M45A 5E2VL 2EYTB 1BJ8A 1AXTH 1R6VA 3KE0A 5DS8A 2CO7B 3BE1H 1T80A 1FH2A 3PS6A 4L8DA 5D7KE 4QCIB 5D7SL 2K4WA 1QUNA 3OLDA 3VRJB 1B4LA 2ESVA 1KEGL 4UQAA 2CPCA 5D1ZA 4JFEE 3QI9B 2NQ3A 4QHPA 4U1MA 3BKCL 3AS3A 4R0LC 1XEUA 5AOKA 3VJ6A 3MLWL 3QO0B 5D5MF 3RWGB 1ID2A 4W4NA 5AOJA 5KUMA 3WNNA 1KG0A 1BBDL 4GMSL 5D72L 4LPCA 3KR3L 5DUMH 4P2RA 3JTTA 2RQEA 1QASA 3BCDA 3ZL4H 1ND0A 2Z91B 4LIQL 5KJRL 1NCWH 3IKCB 4PJDA 1BW8A 2VR3A 5KVFL 1BHGA 1H5BC 4NI6A 5CNHA 3PY9A 1E28B 1KN2H 4HIIA 4HJSA 4QRQA 4IIQA 4L1LA 1BGXL 2CBQA 3OKMB 3PNWA 5E9DA 4MMXC 4WKXA 3FRUB 3Q5TA 1T3FB 1AC6A 2Z65C 3SPCA 4WENB 3INUH 4D9QE 2W9LA 4OI7A 4WY7L 2WHVA 1L5GA 4NRZA 4QY8A 1E6JL 3QPXH 1YNLH 4ZMYA 1HQRB 4KNSA 2KDYA 2EDNA 2FBJH 4Y4FA 4NZRL 3G6DH 4YXHH 2LLLA 3GMMB 4WFGE 2DKMA 3L3DA 2ERJB 4P2QB 1WAAE 2OMWB 3N0AA 4UYPA 4GBXA 1FIEA 3T6XA 5HDQL 3OVUB 2L8AA 1AFVL 1XSJA 2RHEA 2QT6A 1KPRB 1PZ3A 3J8F7 3MOBL 3MROA 3NQIA 4R7LA 1CC3A 1VADB 3U9UB 4L4TE 1VJSA 5E2TH 3O11B 1MLCA 2GBUA 4EN3C 3SZKC 3CFDA 4Q56A 2EVGA 1N0XL 4ADJA 1I1AB 1OGTB 3EDKA 5IJVB 3GJEB 5I6NA 5GIRA 2VR8A 4MXWH 4MXQC 4TQHA 1FUNA 1T7YA 4A38A 2EQDA 1BLNB 1J1XH 3X1NA 4QRRB 1S7SB 4LSTL 5IQ7H 1ZVYA 1IBZA 2OMVA 2C9SA 4ZUVA 4MA8H 2FYYA 3S37X 2K4AA 4P9MH 4Z7VB 2GJ6B 3PWPB 4K0OA 4N0CC 5ADOH 2R1XB 1W6WA 1MHPH 1UWEL 3CSYA 1P4BH 1JZJA 1BZDA 2D3VA 2J8UB 3GMLA 3LH9A 4U2ZA 4ZPTA 3NFSL 2VMFA 1OP3H 1YHPA 4OUOA 3IMTA 3JTSA 1DLHA 4HKJB 3GHEH 3ZO0A 4QJ4B 5DD3H 3ILPA 4PJIE 4LB8A 4Y16D 3QORA 3PL6A 3CFEB 4GW1B 4Z7WA 2JV6A 6PAZA 1KGIA 1ZA3B 3QQDA 1PGRB 6FABL 2LTQC 1JGDA 2X9ZA 2OQJA 3CHQA 4WU5A 1A7RH 2K1MA 4GUCA 4GQRA 1SN2A 2EXWD 4TNFA 2FBRA 3G9VA 5IJCC 1T1XA 2OYMA 2Z0BA 3SKMB 1SN5A 3SHSA 2ZOWA 2H0FA 4GRLD 3F3HA 4ADIA 3U30B 4RFNB 1E2ZA 3QIBB 4L05A 5L4JA 4ZFQA 1AD9A 2EDXA 5KAQG 1U3HA 2YARA 5E5MA 1M1XA 2X1WL 3IDUA 1TQCC 4UF7C 3QFJA 5EUOA 4F58L 4JFTA 2NY5H 3RIKA 2EE2A 2GTQA 2G60L 2O5XH 1KBKA 2CLVA 2DDQL 2Z3FA 3ECVA 4P5MA 5CIPB 1U3NA 1C5DA 3L3KB 1JF5A 2NZ1A 2GJPA 4L4VE 4GIPD 3MOQA 3DYMA 1OM3H 4AEEA 1BQUA 4NC1C 4Y5YB 2BIQA 4L5FL 2BSCA 5B3JE 4YSUA 5JW4M 4HIPA 4EI6B 3MRFA 4B9IA 4DKTA 3G9AB 5F3BB 2VLJD 4I4WA 3NVQA 4MCYA 2Z4QA 2VN4A 5EU6A 3PQYB 2FLBT 4GSDH 3KEDA 3ZMRA 1T21B 3ZE0F 1AR1C 2J8HA 1DJYA 1MCOH 2WUCH 4H26A 1EV2E 4ZK8A 4S2SA 4M5YL 3KHQA 2EIKB 3BAKA 1HEZA 1X9LA 2K7QA 4FQJH 4BUQA 5HSFA 2VUOA 1YMHB 2EXYC 4GMTL 4XPTL 1I3VA 3ZMNA 3A4EA 4HLJA 1KZYA 3J27A 2CE6A 2XQYK 3KXFD 2DYSB 5K9OB 4DETA 3H2WA 3Q01A 1X9UA 5JHDD 1D5RA 2YQ3A 1BFOA 5FWQA 2Z31D 1E4KA 3ELQA 1ZANH 2NXYC 4YDIH 1MCIA 1ZD6A 4N20A 1O5DT 5FUCC 1T03L 3OAWA 1I9EA 3RFRA 3K2MC 4NNYB 4FULA 3W3BA 2R56L 2X0WA 1Y6NR 4B6ZA 1WC7B 3HAEG 4O51B 1W15A 4YHIB 3PWVA 1XH3A 3LZOA 4X5WA 2DKSA 3L13A 3L81A 3LZNA 4NZ8A 1GHFL 4QOKD 4PCTA 1S9YA 4AL8H 1IT9L 3SQOL 5C08D 4LVOC 3PDOB 4P5TC 3MI6A 1D6VL 1WTGT 2X3CA 1JPFB 4NM4H 2VISA 15C8H 2DLFL 4R2GC 2JCCB 3MNMA 4ACPA 1H8OA 5HYJA 2ZAGA 4TNEA 4W9FC 5HVHC 2BVQB 2GW5A 5ITBH 3HE6C 3CH1B 2YWZA 4B5ZA 2WGNB 1GZQB 5JOEA 4DN4H 4JY5L 4LEBA 2CALA 2QSQA 5I15H 4NEHB 1MCPH 1LVEA 4ONFH 5E8PB 2I24N 5B1JA 2VDPL 1RJLA 3ECBB 1XH2A 4HYTB 3ME0A 2JKNA 3O2VH 3OQ3B 2LAAA 3A4AA 2QV2A 2TSAA 3D08A 5EV7A 1K5NA 3ESUF 3FN3A 2X88A 3LIZH 3FO0L 1XGRA 2G5UA 4QRFA 4YAQB 3QUKA 3WS6A 2WGXA 3LNFA 4EE2A 2J2ZA 4FTVD 4W6XB 1N9PA 3LS4L 4ONGL 4PJEA 4XB7A 5IHHA 3NACL 4NGHH 4PJ5D 3C2AH 5K69A 2KQMA 3AREC 1FGVH 3NFPB 4HS3A 3FBKA 2CDGB 5HGDA 5JR1L 1DQDL 4HEPA 1IM9A 4BWUA 4LVHB 3S3CB 5JPNB 2MCG1 2QVIA 4AVKA 1QLRA 3D6GA 3N42F 5DJAB 3NIDB 4PJCE 1CGXA 3VG9C 3AQDA 3NZ8B 1LE5B 3U2JA 1NOAA 2BXYA 3NSDA 4ZZFA 1RIVH 3DC0A 1U58A 1PW3A 1W72H 2H0EA 1KLUB 2XQBL 4IS6B 4PW9A 4XP1L 2X6MA 4N2GA 4XMWA 4PGCA 2B1AH 1CICC 3O6FB 4XI5D 1UOVA 4UIMB 5D8JL 5FKAA 2KUTA 2Z7ZA 3ESVF 4QRSB 4ABWA 1A6VH 2ZUUA 2ZOKB 5EA0L 2XZQH 5DMKA 2CZNA 3IJYA 3ZIYA 3QHFH 5A16A 3X2QB 3FC8A 2XN2A 2GSMB 1LDPH 3BYYA 4FQ1L 4WWNA 1A7PL 2GB2A 1MJUH 5CHNA 2P5WB 2ITDA 1UM6L 4L4JA 2XJKA 4LLUA 4QT5B 3QXUA 1LK2A 1YN6A 2W60A 5GRJL 4GW5B 1NFKA 2HN7B 4YN3A 3G6JE 3ARQA 1PAMA 3U7WL 5GJTL 5FECB 4X6DA 4OD3H 4UZGA 5E4EB 2YAQA 4G7VH 3NOIA 4G80A 3OG6B 4JFPA 1BQLH 4F20A 1MJ8L 5D70H 1DHKA 4OCSH 1UADC 4XOBA 5JOPE 1SJXA 4OIBA 4KVCL 5CINL 1XTMA 4GUQA 1FL3B 1U6AL 4JL1A 4YHPA 5FB8A 2VLJE 2FQEA 1QBMH 3ATBA 3ZDZE 5I76B 2GHWB 3K5RA 1SEQH 3B9KB 4JFOB 3WD5L 4LPXA 4XP9L 4GH7B 1OCWH 1IEBA 1E5CA 3KPNB 1B3JA 3I6GB 5HI4D 1F90H 5DJCA 3JXAA 4GY4A 1SYVA 3WO3B 1N6QH 1CTOA 1AY1L 1FZKA 3RU8L 3STZB 2N0MA 3D9AH 5B38A 2BFGA 3QZNA 4H8WL 3WFBH 1VAHA 5IFAH 1BBJB 1QP1A 1OAJA 4A68A 2NY2B 3BWZA 3QG6A 4Q6IB 5CWSB 3W9DB 4OJCA 4YFEA 2QTEA 4IOSD 5EF1A 3WUWB 3TN0C 1URIA 2LAGB 3LRSB 2O26U 1OP9A 4NO0B 5AYUH 1FORL 3EDDA 3NPSC 2YKLH 5GGSY 1JZ7A 1Z3GH 1EMTH 4YNYB 5KS9F 4AJYV 4WWKB 3TTYA 4QOKE 4EDXB 4IIZA 3MHZA 3U6RA 1J9RA 3DX9A 3IEAA 3ZE1B 4FXGA 4EAEA 1AQKH 3V4VB 1KIQA 1OARH 2JKTM 3BGFC 4A2FA 4CNIB 5J7CC 3TJHD 2XZCH 3EYQD 3EZ8A 1DBJL 4PJIA 3KPOB 4LSPH 5IG7A 1KJ3L 1SLUA 2Z1PA 2GBTA 5T3XH 3FQ4A 3L3OB 2VXTH 4NHUA 2O5YL 1MAKA 4TLSA 1Y18B 1A21A 4PRNA 3KPPB 4HH9B 3EOYG 4XVSH 4NQXB 3O8XD 4J23A 2YN3A 4ES8A 1KC5L 3RUGA 1H15A 3G5XA 5J13C 3BUYB 3PLYA 3LPPA 5D1XC 1VA9A 2DWTA 3FT3A 4X9FA 2OZ4H 2QQLH 3CC5A 2A9BA 1S7WB 1DYZA 5T5NF 3UBXG 4QGYA 1QZ1A 2O6CA 2HT4C 3MMEA 3O2DH 4JPWH 1C8PA 5CXPA 3MLSL 4BQ9A 4LCUA 4XZ4A 5CZXD 2AEPH 3FB7A 4N4YB 4HBCL 1PG7X 4G1MA 4G3YL 5DMGC 1U8PB 1J5CA 3TBTB 3TEWA 3OB8A 1HZLA 4EXKA 1K4CA 3SCMA 3AXLA 4DK3A 3WTXA 4YL9A 4G43A 2IADA 1MVUB 3EYOB 3LN5A 3T0EC 3TYGH 4AY0A 1T7ZA 3TVMD 3DSFH 4JGJA 5KANG 3HI1B 4X80H 2MSPA 2O4EA 3FCBA 1NBCA 3QEGH 3VFNB 2ZCHL 4H88H 1WBYB 2EYTA 2DQTH 1NDGB 2VL4A 5JDJA 1DVSA 2CO7A 4GP4B 4RDBA 1X44A 3GO1H 4JY6B 2NMSA 4QCIA 4MJID 5I8KL 1BMGA 3SQBB 1QYGH 4WFHD 1MXGA 5H37A 1CL7L 3VRJA 4FZEL 3QI9A 3Q44A 1PAZA 5G2NA 2W8CA 3IPBA 4OZFB 2W95A 4K3EH 5F7FA 3QO0A 3RWGA 4CRPA 2GK2A 2KERA 3D4ZA 3ZDWA 3LPWA 1J9QA 5K33A 3BAXA 3C6SB 3W0WB 4QWWC 4XH2B 2BOBB 2VXSL 4NZUH 3O4LE 2K3HA 2Z91A 3V79C 5GRVK 5I0YA 2AK4D 2NNCA 3G08B 1ZTXH 3IKCA 3Q8FA 1FPTH 1LEIA 1AHKA 1OB0A 1QBAA 3WLWC 4P46D 1ACYL 2WM0A 1RSYA 1E28A 5HHXL 1MW1A 2YRLA 4I77H 1R1CA 1E0OB 2VN6A 3OKMA 4HKXB 2YUWA 4P3DB 4X6CF 3RTQC 4PCYA 3V5KB 5A40E 3FRUA 1T3FA 3B9EA 5T1LB 5EF0A 5MI0B 1XAUA 3K4AA 2XI9A 3MCLL 5AENA 2WQ8A 3FMGH 2F53D 4NCDA 4GW4B 5DFWH 5EHFA 1T89A 1Z32X 3T77B 2QQNL 2B15A 3I9GH 3VG0H 4QXGH 3SPGA 3GMMA 4LHUB 2JI3A 4KY1H 1J8RA 4P2QA 4C59B 2OMWA 1I8LA 4GG6B 2IBGA 4IDLA 5BJTB 1AMXA 4AUUA 4M6NL 1YY9D 1KPRA 4JFFB 35C8H 4WEEA 1VADA 3U9UA 1J87A 2AI0H 4LLDB 1UYWL 3KPMB 3O11A 3AT8A 4K3DH 4V11A 1K6QH 1I1AA 4HIQA 4K8RH 4ZW6A 3TNMB 1OGTA 5C0NC 5IJVA 3GJEA 3KLHD 1HXMB 3QHTC 5CUSL 4JM2D 1RMFL 5AB9A 3D0LB 2DLHA 1PSKH 4N9GB 4KZEL 1BLNA 1ZS8B 3E3QC 1HYRC 4XB3A 4QRRA 1S7SA 1UZ6F 4R5TA 4PREB 4U6YB 3H2PA 1NBVL 4FQLL 4Z7VA 3D51A 1KJ2H 2GJ6A 3GT6A 3PWPA 2HG5B 2R1XA 5AVWB 4Y1SA 2J8UA 3CBJB 5C1MB 1DL7L 1UENA 3S88L 3Q8AA 4GKOA 2NZIA 4PJHF 1JXKA 2BINA 3DI2B 2BZCA 1F4XH 2YK1L 3OHMB 3AM8C 3LNHA 3GWJA 3LNEA 1JNHB 3CFEA 2F0CA 4GW1A 4NQTA 2VGLM 3BUTA 1V05A 1ZA3A 4B97A 3WTTA 4PJFB 2R51A 1I3UA 1VEOA 4K5LA 5E4EC 5GGTH 3SKMA 2RD0A 1GS7A 4XO5A 5CJ8A 1HEJC 4PUBL 1NBYB 3JZYA 2H2PC 4MAYD 1CFSB 3QIBA 4RCAA 3E7JA 3Q06A 4F37F 2YZ1A 3DMMD 5BUPA 4CA4A 4Z0BH 1ZE3C 4KAQL 2GTWB 5KSBE 2VR4A 3CK0L 4F92B 4NQEB 1J05B 4M3KB 3GIZL 2WWOA 4ORZC 4YDZA 1Y0LB 3TYFA 3RZCB 5CIPA 3TCTA 4JG0H 1S5HB 1TQWA 4BK4A 4D8OA 5IWLA 5LXGL 3L3KA 1YDPB 2PMZA 2X6CA 1YN7B 2Q8AH 4MTMA 1UACL 4Q9RH 3AS1A 1RK0B 1RIUH 4XVTL 4M7KL 2YFNA 4Y5YA 2PNDA 2CKBH 4UT6L 5FGCB 3UZEA 4EI6A 1K85A 2CXGA 4XN5A 4FOMA 3D69A 2IXQB 5F3BA 3IKKA 3F58L 3ZDXF 2CBPA 4Z3IA 3PQYA 1T21A 4I3RH 5CMAB 3E9TA 1OAQH 2AFNA 4NWUL 1YMHA 1F8TL 2C7FA 2WNWA 3JWDL 3WO4C 2EIZB 3AT9A 1RZFH 3FSZA 5E9AA 5DT1H 3EJZC 4Y7MA 1DTUA 4YFDB 3QP3A 5JMRA 2BNQB 3ZHLA 3BRGC 4NPYB 5K9OA 1H0DB 5G4MA 1KTKE