2AF2A

Solution structure of disulfide reduced and copper depleted human superoxide dismutase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human SOD1 before harboring the catalytic metal: solution structure of copper-depleted, disulfide-reduced form
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 37
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2af2A00
2Z7UA 3ECUA 4A7TA 3KM2A 2Q2LA 2WZ0A 2AQSA 1ESOA 1SXAA 1SXCA 2AQNA 1Q0EA 1E9QB 1SXSA 1UXMA 3CE1A 3F7LA 1DSWA 2VR8A 4A7SA 1UXLA 1JCVA 2C9UA 3GTTA 1SXZA 1SDYA 1SOSA 2ZKXA 1L3NA 1OEZW 1BZOA 2XJLA 2AQRA 1KMGA 3K91A 4A7QA 2AEOA 2APSA 1EQWA 3LTVA 2E47A 1CBJA 1JK9B 3H2PA 1IBFA 3KH3A 2C9SA 1SRDA 2SODB 1OAJA 5KBKA 1E9PB 1B4LA 1RK7A 1IBBA 1S4IA 1Z9PA 2WZ5A 3KBEA 2Z7YA 2V0AA 1EJ8A 4A7GA 2K4WA 1U3NA 1E9QA 2ZOWA 4B3EA 1IB5A 1AZVA 3GZPA 2XJKA 1SXBA 2GBTA 1B4TA 3KH4A 2VR6A 4U4IA 1JK9A 3CQPA 2JLPA 3MNDA 1TO5A 1YAZA 2GBVA 1HL5A 2GBUA 2AQTA 1OZTG 2C9VA 2LU5A 1P1VA 4A7GF 4BD4A 5KBLA 4A7UA 2Z7ZA 2R27A 3HW7A 3KBFA 3ECVA 2AQQA 1PZSA 1IBHA 4OJAA 1XSOA 3PU7A 1SXNA 2Z7WA 3GQFA 1F1DA 3T5WA 1CB4A 3QQDB 1YSOA 1BA9A 4OH2A 3HFFA 1FUNA 1E9OA 4MCMA 2ZKWA 1PTZA 2AF2A 1XTMA 1MFMA 1OZUA 2NNXA 3RE0A 1E9PA 1QUPA 3S0PA 3F7KA 1E9OB 1IBDA 3GTVA 3SODB 1PU0A 1DO5A 1Z9NA 2WWNA 2WYZA 4L05A 1F18A 2E46A 1HL4A 5CU9A 1YAIA 4FF9A 4N3TA 3MKGA 2WWOA 1N19A 1OALA 4A7VA 5KBMA 3QQDA 4BCZA 3L9EA 1COBA 2WKOA 3ECWA 2VR7A 3CQQA 2ZKYA 4MCNA 1F1GA 1TO4A 3KM1A 2WKOF 2AQPA 2JCWA 2WYTA 3L9YA 3H2QA 1XTLA 4BCYA 1SDAB 4N3UA 1N18A 2WZ6A 1F1AA 3GZOA 1SPDA 3HOGA 3GZQA
chains in the Genus database with same CATH superfamily
2ENJA 2EAEA 2ZG2A 4F5CE 3CVIH 1QP1A 2W92A 3ARBC 3VCLA 1AGFB 2HFEA 1PKOA 1ZA6B 3CSTA 3QZNA 4X8XA 5EOCL 4F7CB 2AJXH 3IGKA 3DLQR 3K6SB 3IDGB 2Y1ZA 3GRWL 2DQCL 4QHPA 5CJOL 1TZOA 3D8MA 4JANB 3RKDD 3RDTA 4K2UL 4Y1AB 5F96L 5FYKH 5I82A 3TIEA 3NYKA 2O6EA 3FBQA 4OCXH 1JXKA 1G84A 3QIWC 1T21B 4OW6A 1UEYA 4ALAH 1IBFA 2Q6WB 2MQCA 3TJHD 2NZ1A 2SODB 1A65A 2V3FA 2WK2A 4K7FB 4N85A 4NQCE 2HFGH 4GG6A 1BZ7B 1MCKA 1IBBA 2AXGA 1GA2A 4HWNA 1BQ5A 1FNGB 1U3NA 5EBMB 2YBGA 1MIML 3Q1EA 5CP7A 4HCFA 4L1TA 3FQ1A 4AQ8A 1EFXD 1IBYA 4LHUG 3W0WA 4JFYB 5D2NC 5CINH 2XZAH 4NM4H 5F9OH 2OZ4H 4B7LA 1U8NA 3PIQB 3VXRD 1P4IL 5AOZA 3C09B 3PV6A 4X8GA 5DVPA 2QPFA 2XY2A 2WGXA 3L6FB 2LV4A 3APNA 4QRTA 3PUUA 4FYRA 3H42L 3MZTA 4FA6A 5FWRA 1DQIA 2ETWA 2YA2A 3FCTB 1CFVL 1HSBA 1JNHB 3QDJB 1FL6B 2OJZL 5I76B 4LAJH 1VFAB 3TF4A 1M2VA 3S34H 3EXJA 3QS2A 1P4BL 3ARRA 1J05B 3WFHA 5E5MA 3T0DA 3P4OB 3RX7A 3BP7A 2BERA 1L5GB 3UO1L 4WV1B 3B9KD 4LCCC 4X5QA 4QOKA 4RSYA 5GGTH 1PVHA 1ODAA 3GI8L 3EDJA 2IPKA 3K4AA 2XN9B 3UYOD 4AQ1B 3NA9H 3TBWA 1NGPH 2HVJB 2F18A 3FBKA 4UMGA 4X9IA 3VSUA 1VCAA 5F3HB 2B8OT 3C5SA 4DZ8B 1MCCA 35C8H 2FX8H 3JWOL 5JQ6L 4ZQKB 3CX5J 3SOBH 3GWJA 4F7MB 4X7TB 3ZDZE 1IC5L 1AHKA 1XBDA 1I7ZA 1UADC 3KM1A 3NZHL 4XPHL 2V33A 4U31A 3K71B 4FI7A 1J48A 4N68A 1URIA 3IE9A 1AP2A 1WV7T 2BFVH 3EYOA 1WBYA 1DVQA 2GJ6D 2GAZB 3U9UA 4OCNC 1XSJA 4FP8H 5DRZB 3K80A 4KAQL 2F7IA 4MQXC 3RUGB 2WZPA 4AQ8C 2FLBT 1EAOA 2E6JA 1RJLA 3MMEA 4I3RH 4PY7A 2QTEA 3WE1A 1YCSA 4AMKH 2ZJSH 4ERSL 5IJKC 3RWJB 4D2NA 2FATL 3V95A 4HOMA 1J8HD 3TH2T 3U7AA 5KSBE 5AW9B 12E8L 1TTFA 1IIIA 2E56A 3C2AH 1KJ2L 4RMBA 5HI3D 5JMRA 4YX2L 1A4KB 1BZOA 4OUOA 2BP0B 5DA0B 3BIBX 4NKOB 1YNLH 1DFBL 4YGVA 3SGJA 1L0YA 3ZDYB 5IMLA 3HBZA 1UKSA 4APQD 4KDTA 2YKKA 5CCKH 5BZWB 2VSKB 2EH8L 3OAYH 3ZRFC 4WO4C 3SDCD 4L29A 4HT1L 3BPLB 1JHKL 4QRRD 3QFJE 4ZNCD 4Q6IA 1BCIA 3DHUA 1NM9A 1HL9A 4KKLD 1XSIA 3VXSE 2E59A 3VE0B 4CVZB 4OFIA 5C6TL 1KZYA 1GZQB 1ZRUA 2MSPA 1AD0A 5B1KA 1DBKH 1AP2B 3EYOB 4XHJC 3ATBA 5F0PB 2VLJA 3P3UA 1PLGH 3KVDD 5E4OA 5EIIG 5DS1A 5HYSB 1FO0L 4I4WB 4P9ML 4NZDA 3PP4H 4MTMA 5LKNA 3ECVA 3W37A 5FECA 1CIUA 2H6PA 5EBLA 3VFUB 3M1BB 1NDMA 1NAMH 2K78A 4HJ0D 1PMYA 4I9WD 4L3AA 1JN6A 4OUUA 5LDUA 4M7ZC 2CJ3A 1L6PA 3VACA 2FK9A 3AY2A 1X6NA 1WUZA 5T1MB 4PY8J 4GO9A 4YE0A 1DE4A 2QFRA 1MCIA 2YUZA 4M93B 3V0WL 5KAQG 1AR2A 2HJFB 4X7SH 4NQSA 1G6RL 2WY3B 2AJYL 4P5KA 4HVBA 1OTSD 1AO7A 5D5MA 4WUKH 5D7JA 5TE7L 5E9DB 1E9PA 2R9HD 4UT7H 1KIUA 3MRCA 4EUPH 4FZ8H 2WVSA 3FB8B 5FYKL 1KXQA 1O6SB 4ALAL 3P69A 1OTUC 2R2BB 3DTUB 4GS7B 2OYKA 2ZOOA 3T3ME 5D1XA 1ID5I 3TA4D 5FA4B 4RZKA 3QXAA 1EAPA 4FN0A 4WV1C 5FUZH 2J44A 3LKSB 5F7BA 2VZ3A 5C0ND 4XP5H 4MS6A 1BVLA 1D7CA 4JFFD 3A67H 3IU4L 3MUGB 4O51B 4PV8B 5CGYC 4N86A 1ORQA 3T3PB 4BZ2A 1HT6A 3EOBB 3H9YA 1L9TA 1KC5L 2RBLA 4L2YA 5DFWH 4P46B 1IFGA 2V9UA 4PY8I 2CRMA 2CDFB 1LVEA 3BQUB 2VMEA 5ICYA 1F11A 1MVUB 4Y7MA 5LCVH 1OVZA 4BH8B 5EEZA 5JMOC 1PZ2A 5ELIA 1LK2A 5KVEE 2P5WB 4QI3A 3ARFC 3F64A 5ICUA 4I3SL 2WLIB 3ROOB 3CZGA 2EDTA 3LJ3A 3U83A 3A23A 3D9AH 4XVUC 3T8VA 3BSHA 4P5SA 3X3FH 3RWDA 2OA9A 5JIKA 4XWGH 1Z3RA 2BY1A 1C16A 1H0DB 3CC5B 4N0FB 4HHWA 4APQA 2EXWC 3B83A 2NPLX 1DDTA 1RIUH 1OGAE 4WU5B 4Y4FA 5EA0L 3HUJB 1RUML 3UOAB 4XMWA 2WZ5A 3RLSA 2W0PA 4Z9KB 5J6GA 4F37F 1SYVA 1JYWA 4UT7L 4JKPL 1R4XA 4ONFH 1PYWB 3HMXA 4I13B 4GEJA 1A6PA 1K4DB 2XY1A 3TVMA 4ZD3H 2AJ3B 2BDNH 1RURL 1IFHL 1YNTB 3UIYA 2X1PA 2E27L 3C5JA 3DV4B 2VKWA 2YZ1A 3ZZSA 2FWSA 3H4FA 3WE6B 4I2XA 3RWEB 4F8QA 4FA8A 4M1DL 3KDMB 1LHZA 3BI9X 5FUOL 3WY3A 3EYSH 1ZVHA 4N1EA 1WPCA 3GSUB 4PRNA 3VVWA 3IDIB 2QADB 3SDYL 1F1DA 1VEMA 2W07B 2BNQE 2X4OA 3ZMRA 1U30A 1AXTL 5HYSG 1J7VR 2N01B 3ELQA 5D55A 1RJYB 2NY1B 3GBMH 4P4KC 4ETYA 2E7LC 3MZGB 5D7SH 1TCMA 2FATH 2QQKL 5D1QD 3IJ8A 4X4KA 3G6DL 1NEZB 4YBQC 2QQNH 1U8QA 2WBJC 1S7WA 2KZKA 4G70B 4KU1A 5E2TL 2F68X 4NWTL 1GSKA 2EXSA 1GZHA 1QRNB 3D2UA 4MQ7A 4PJGF 3WIFA 2C34A 2J5LC 2C26A 5K9KA 1DANT 3AQZA 1V7ML 3NJKA 3MJ7B 2Z0BA 1G6RA 4X6FA 1NANH 1JHKH 5DJ2B 5GSVB 1MLBB 1E8YA 3UAJD 1JZFA 4ZG1A 1J0YA 1Z7JA 4OZGB 3REVB 1MHPL 4HZLB 5C0IA 3D69B 5CLWA 1QTYT 1VLXA 2DWXA 3E1ZA 1A5FL 3SN6N 1P5VB 4Z7WA 5GGSB 4A2GA 1PLAA 2CR3A 1NFDB 4X6CF 5D2NE 2VDQH 3CMOH 4JQVA 3VA6A 1FNEA 1M7DB 1THCA 2K7PA 1E5AA 1IC1A 1B9KA 1OPOA 2VDKH 3VTAA 2YK1L 1FNAA 1BG1A 3L4UA 3BVUA 2VR5A 3NDYE 3QI9A 3BPOC 4X7EC 3QR1A 2DLTA 2BRRH 2V5TA 3QDGA 3QQXA 3D51A 4PGEB 4S1DD 5B4MD 4LKXB 5SX4I 1SHSA 3LKOB 3BAXA 2PO6C 3MV8B 2HWZH 2ALAA 1OGTA 3V6BR 3WG7B 1M57B 5L7XH 3UADA 4X9YA 5D2LA 2BIHA 3MJ8B 2DIEA 3RWGB 3ARXA 2VDQB 2FBJH 3INUH 5I23A 2RGSA 2A6IB 2YXWA 4M6OL 2V0AA 4DP2X 5K9OA 3BPNC 5DFVC 5ISZB 4C58B 4NO3A 2NY1C 2RFXA 4PJIE 5JO5A 4ZQKA 1S7RA 4PW9A 1NBYA 4YDKL 4TLUA 4WI8A 3L5JA 5E2WL 1MIMH 4W6YB 1KGIA 4DP8X 4HXBL 3HG1E 5AZUA 5I75B 2J71A 2QR0A 4ZOCA 5F88A 3S35H 1I3GH 4Q14A 2XN9A 1IE5A 5JNYB 5IP4A 4MB3A 2VQ1A 4RAUA 3HVNA 2YAQA 1R33A 2X4RA 4PJGA 3VGEA 5IROD 5ANMB 1NUGA 3BFQG 4L18A 1X9RA 1CFVH 1JFHA 2Y4SA 4CW1B 4UTAL 3QC6X 2QPSA 4LSRL 1PNCA 1GY2A 4EN3A 1E0OB 1FV1A 1G7JA 2JCCB 3QFJD 4NN5B 1ZV5A 1KFGA 3D12B 3IRPX 4HUWA 4PREB 4M48L 4RIRA 3S0PA 5K9JH 4LU5H 3SDAB 1ZWIB 3JZ7A 5D2LB 1DVXA 1OCZB 3CTTA 5C2BH 4Z23A 1J1PL 2VN4A 4OKVB 4EZJA 2CDFA 5ALCH 4K3EH 1QYGL 2H7WA 1G7HA 2NY7H 5JW4R 1LNUA 2C4FU 1Y6NR 4G6FB 4YZFF 3KPPA 4JKWA 3ZGIA 4EUPA 1NKGA 5EIIA 3Q13A 4H2CA 4LSUH 5KBNC 3VXTA 2EUVA 4U6TA 1N3NB 4IU2B 2DDQL 1RK1A 3FKUS 5DHVB 4FERA 4WGKA 4QMEA 1CXFA 4G7YL 1AZNA 3WGVB 4JY5H 3AS2A 3BPNB 4Z7UF 4N0UE 5C1MB 1X5KA 2C3VB 4AYFB 1GAFL 3ML9A 3QNZB 3MLVL 4U7SA 3HKFA 4GQZA 2AJZA 4GI8A 3TS8A 1DZ0A 2HB0A 5I5IA 4UM9D 3MNWA 3COOA 4LLMA 4GXUN 3Q7JA 2HKFH 3HZYA 4HGWA 4J12A 2WIIB 4ODWA 5EN3A 5FYJH 5DD3L 3EDKA 1EWHA 3D7PA 1D7FA 3MJ9L 4FNLH 1LDPL 1ROWA 4V1DE 2OSLA 4RGMB 5EU5B 4RZCB 1YEIH 4BYHA 3BP5A 4G7YH 3PWNA 3FCTA 3HRZA 4J39A 4PJCF 1EGJH 2OM5A 3L7EA 3N50A 4J1UA 2UZXB 4LQ1A 4P4KD 3LRKA 4JG1L 1I7RB 2CGZA 3IDUA 5CJBA 1MFVA 3OD3A 2NY2D 2XT1B 3PL6A 5E6IB 2VXVH 3MI6A 7FABL 3OHMB 2EIJB 5GS0H 4I89A 5AALA 2BC4A 3WEBA 3H3PL 5M95B 1Q8MA 4F7EA 5I6OA 4LCWD 4A7UA 1P7QB 2NY4B 4ZW8A 4R7LA 4Y4KA 5DD6A 1OT2A 3E8UL 4BQCA 1UD6A 1AFVH 3DJSA 5KSUA 2MCMA 4H88H 2OW6A 4OGQC 2Z91B 1H19A 3O11A 1OGAA 4OFVA 2MPVA 4WUUA 3F7VA 4FQQB 2JJSC 3APCA 5E6SB 3CHRA 1Q0YL 1FFOA 5BRPA 2GTZB 5B1BB 5IOKA 3L5WB 4K07A 2MRYA 4AYBA 2XTSA 2FWOA 5CZKA 1A4KA 4RNRA 3L3KB 2HG5B 2CO7B 2I07A 3APFA 1MFMA 3FCSA 4FQPA 2UV3A 1PY0A 2EE2A 3VXUA 4WWPA 4HIXH 3B1UA 1PCSA 1HN1A 1N7MH 1RUMH 5JW5A 3PP3H 3DTXB 4MNQA 4FL4B 2HWZL 4GO8A 2BNRD 5DRZA 4FF9A 3GHBH 4AMKL 1N64H 4LEEA 2ICES 5ISZD 3HI6H 2XSKA 2Y1VA 4NQED 3RY4A 1EFXB 5B1AB 4FXKA 5DI8A 1CR9L 3DRTA 1X5YA 5CBAB 1MVUA 4BH8A 2CKNA 2EH8H 5K69A 4OLXH 1XWVA 5C7XL 5EFIA 5FO8A 3MXWL 1P7QA 3QHFL 1EBAA 3D0VB 3MRIB 2DQJH 2UY6B 2FGWH 2Y5QA 4KI5E 1D9KC 2ZUXA 3O6KL 1KXTA 2FNBA 4MMYA 4XCFH 2WUCL 1E90A 4I0PB 4GRLA 5F7YC 4FABH 4OAWA 1KC5H 3TBSB 2VITB 3C5ZB 1FZKA 3RP1A 1NC2A 5F71A 5I6LA 1V54B 3MV7A 2YXFA 4JKMA 4MXQD 2DQTH 4NKIH 1EAPB 1RVFL 4X98B 1UZ6E 5DWPA 2K9FB 1E4HA 3PABA 4PI2A 4C56D 1ORSA 1CFSB 4PIRF 4YHKH 2VQTA 2JXMA 5I1JH 1NIDA 3PP3K 3SCMA 2C3GA 4JO3H 2F5AL 2PCXA 1HHHA 4BFIA 2Y36L 4O4YL 2GUYA 1OSEA 3N44B 5AVZB 5ID0B 1NLBL 4GAYB 2DKUA 3SE8H 2C9PA 2ZYSA 1JNHA 5L8LB 2X4RB 3L2NA 4O58H 5EO0B 4EBQH 1OAQH 3R4RA 4PJ9A 4PJDF 4XMXA 2FR4B 3L4YA 2H3KA 4O9HH 1CGSH 3NTCH 4M61A 3MBXL 3RJOA 4NN5C 5IB2A 1CL7I 1QA9B 4CN6A 3MC0A 4AENB 2CBQA 3ZMEA 4AV4A 1EHAA 2GBVA 3DVNB 1XVSA 3L4TA 3CDZA 2N0MA 3CMGA 3DX4A 3HNSH 1J8HE 5DUPL 1J0ZA 1K5NA 2AW2A 4KQ3H 5BRQA 3GO1H 2YO3A 2NXYD 4FG4A 5J6HB 1ZK9A 4QT5B 4HK3N 3AAZA 4OJFH 2J1XA 1GHFL 1NAKL 3ES6B 1E5CA 3ARGC 3UMNA 5K9QG 2P52A 1LEKA 4X5XB 4G83A 4R4BB 1RMFH 4TLTA 3K2MC 1FUNA 2BSTA 4FFVD 1LK3H 2H47C 1SJHB 3DK0A 2NQCA 2HUHA 5JIQA 3PJSA 3KPQA 4NYLB 4B53A 5A2JH 3F12B 1AE6H 1FNHA 4PW3A 4XO8A 5E4EB 3QZMA 4M4RB 2J2ZA 2KT6A 3CFUA 1RPKA 1B4RA 3GGWA 1LWHA 1ZS8B 5KVFL 3H9HA 4PBDA 3MLXH 4I77L 1T7VA 4OZ4B 5AW3B 1QKZL 5EUKB 3S36L 5AOLA 3GO1L 4FQLH 4KK9D 2TRYA 4C4UA 4OCLC 2WWOA 2IH1A 3BWAA 1ZLUK 1OM3L 3PL6D 4NIYE 1XGTB 2BX5A 2HKAA 4L3CA 1CICB 2FB4H 4PJFE 1JPFB 4PTTA 1E50A 3CDGA 2GEEA 4RMSA 1EUTA 1OT4A 3HG3A 1MOEA 2HN7A 2PYEE 4TQHA 3SD5A 1X5GA 5FO7A 1SUJA 4BSVA 7CGTA 3QDJE 3JT0A 2NY0C 3C8KA 3D4CA 3NACL 3ABGA 1RFDH 3QFJA 5HGDA 3FOMB 4X8JA 3ZE0F 1DBBL 4LP8A 4MD0B 4UU9A 3RX9A 4J3XA 3OR6B 3QORC 1CYXA 4UI2A 2UY7B 5FGCE 1I8IA 5TF1L 3VD7A 3A6BL 5F7LB 1UT9A 5IROA 1JZJA 5CNHA 4BCXA 3MA7A 2A6IA 3L3JB 2E74C 5F6HI 4C4KT 3OHXB 4XPTL 3TNNB 4KJYA 4JRLA 3IXTA 1PQZA 3GKZA 1T1ZA 3WIIL 2IAND 2ICWA 2JJWA 1MNNA 4Z3GA 2JCCE 1UB5B 3WI9A 1UWEL 1FDLL 2WIIA 4AZ8A 1HU8A 3S5LG 3HJ0A 1SN5A 4EJ1C 3TFBA 3HMWL 1IM3D 4DFIA 4GINA 1B4LA 2X3CA 1DCLA 1GC1L 3FFCD 2K4AA 5TPWL 1T0MB 4W9JC 5HHPB 3VWJB 4JJ5A 1TTAA 1YDPB 4ZMQA 1JUFA 2WUBH 1BOGB 4U4IA 4CVXA 1E6OL 3AREB 1SJXA 2YUXA 3OM3B 4BM7A 1BJMA 1FPTH 1OAZL 1TO5A 1BIIB 4U6YA 1YYMH 2XXMB 3RG1C 4ENED 5JIIA 2WXFA 4FCHA 1UATA 2EH7H 4X4XA 4QWWC 1WGOA 4BFJA 3TZVB 4LEOA 1BJ1J 3FT3A 4G7SB 4GUCA 1MIEH 2PXYB 5E1IA 2UWEA 4G9FD 3SPCA 5IHWA 1A6AB 1IC7L 4R96B 4ZFGL 3LKQB 3IETB 3MV9A 1TVHA 1IT9H 4MRBA 5C07A 1BQRA 4H0HB 4PFEA 5CSBA 2ZXAA 3EUDA 3V6ZB 3JV0A 4ZAKA 4JK0D 1LK3L 4PLJC 2H26B 1AHWA 1WA2X 4DVRH 2W94A 4XPFL 3CDCA 4R2GB 5CEYB 4U6HA 4NUJB 1QRND 1ULVA 3I2CL 1S3KL 3DVGB 4HP5A 5KYXA 4HDIA 1YYML 3MLYH 1E9OB 1CN4A 2Z31D 1KCVH 3ZU8A 3IS1X 5D1QB 4LOEA 2WXJA 2VXUL 3UTSE 4BUQA 4D8PA 1EGJA 5E00A 1KCUH 1MRDL 4F8NA 3UBHA 5KVEL 2IG2L 4HHAA 4PJCA 3PAVA 4JFFA 3OB8A 4GRMB 3MRRA 3MKKA 1F4XL 4PG9B 4DN4L 2F61A 5IB1A 3BUIA 3K6SA 1A6ZA 5DC0A 2B1AL 3L3HB 2H0FA 2Q7YB 2EXTA 2AQPA 4DEPC 1JGDB 2DEYX 1T5WB 3FFCB 1UC6A 3T3MF 3C9NA 3LNFA 3N43F 7TAAA 2A9NH 2WXIA 4G6ML 5J1AB 3GXUB 3LQAL 3L4VA 2F19L 2IFFH 2ZCLH 4Z76B 4XNUH 3MRJB 5IFJB 2FUTA 4FXGC 1J1XL 2HJKB 3O9WC 4QRSB 3ZKNC 5A2CA 4B9PA 1PYWA 3TBTA 2OTWA 1KLFA 5HI5C 2Y7OA 4R26H 2Y72A 1BF5A 3AGVA 1XX9C 2A77L 5DJXB 2C7UB 4K8RL 3TWYA 2CCWA 4S2SA 4QNPE 3LPWA 2Q7YA 1DVUA 4P05A 3GMMB 3SDXE 5E70A 3BLBA 4XI5C 3UABA 5DUMH 1S7QB 4E41A 5FF6A 3B2XA 1IIKA 4QTFA 5I2IA 1DBAL 4G8IB 1LILA 4FNRA 1QZ1A 4ZI8A 4JVPA 2IFFL 3MBEB 3QCUL 4WNSA 2MFNA 3JVGC 4JFED 3QA3A 1UCBH 1X7QA 3HI6L 1FL5A 2EIZA 4FHBD 4NO0A 3K2IA 1JGLL 2PF6A 3X1FA 5H35A 1A8ZA 1UKTA 3BVNA 3KL5A 1P4BH 3HPJA 3OQRA 4D7PA 4P46D 2X1XR 1NCUA 3BJ91 5EG6C 4NBXB 2VABA 1ETZB 1JXJA 3IU3A 5IJCC 5JR1L 4D3CH 2Q9OA 3HLAB 3NJJA 3NFNA 4PJFB 3CHOA 3GIZL 4YBLC 1YPZE 3SD2A 4UTBH 3RL1A 3EOBA 3O8XD 2E7MA 3D30A 4X5WA 2QV2A 2A74B 4Z95H 1QYGH 3CXHK 4HBCL 4AL8H 4OJAA 2H6UA 3US0A 1JAEA 3DX0A 1MI5B 2H1PH 3S36X 1T6VN 1MFBL 4NAMA 5GSVA 5FK9B 4PH8A 3B2MA 4QLRA 5GZND 3BKML 1P6WA 1NWPA 4AMWA 1YQVH 1WIPA 3TA3D 3LQZA 1XH3B 2QDWA 3SZKC 1MJ8L 4PJHB 2Q8AL 2AV1B 4JR9H 3G7TA 3ZHLA 3MLYL 4L37B 2ZUWA 5E4IA 3WTSA 2DM4A 3FUKA 1JBJA 2XWTA 1MJUL 3SDXB 2VDRL 1P7BA 3OR7B 3Q05A 1R3IH 4F2FA 1B4JL 4WEEA 3DUSA 1R5WB 3FQUA 1N0LB 2GJ6A 2GI7A 3DPDA 3WIHL 2BVUA 3ZTCC 1NGQH 1UM4L 4JE0A 4CRPA 4WTZG 5IV2B 4BCZA 1CGVA 1S9WA 1UTDA 5JOPD 2BHZA 4HS6A 4NM8L 2WWKT 5EPMA 1HZLA 3P77B 3ZDZF 3PXJA 4KJYB 1CU4L 4RMTA 1ZT7A 2IAMA 3IE4A 4PJIF 4UDUB 3DURA 3T6ZA 1RP9A 1KEGL 3EO0A 1XTLA 2YSSB 3HNSL 4AQZA 3MQIA 2OK0L 2GSIA 2F15A 1A6VL 3DV4A 3P9MA 4R6UA 4Z7WF 3QEQD 4K3DH 3LZRA 3RFRA 5FYLL 3UIZA 2RAMA 3D0LB 3N40F 2X0UA 4PJGB 4LCYB 3WXVH 2CR6A 1NCNA 3FMGH 3CFDB 4HV8A 1EANA 1HXMA 2EC9T 1QFWH 2ZXWB 4AG4L 2HN7B 3M8OL 4FLRA 5GRZA 2APTA 4OF7A 1OL0A 4AQOA 4JZNA 3R4DA 3V4PB 5GGRY 5C0BE 3D07A 2E8ZA 1PGRB 2KLRA 1F4WL 1INEH 4XAWL 3X1EA 1BVZA 3I6LE 3MRFA 1MW2A 1O7DE 5DK2B 4DSYA 3JV6B 3ZE0E 1EJ6A 3QXVA 4JY6B 3NSDA 2XXCB 4LGPB 1PW3A 5J3HC 1NA8A 4D9LH 4YC2B 1UOLA 3QJSB 1HOEA 4EQ3A 1NC2B 1E7VA 5IGXH 5KS9B 3WKML 3MCKB 2FX9L 1NGPL 1FVEB 1GYUA 1TQCB 3LKRB 1UXWB 1ET5A 32C2B 3MJWA 4G42A 4PS4L 1X5MA 3GZKA 1NINA 5CJ5A 2ED8A 2A1WH 5IM7A 1FL3A 4N8CH 3N9GH 4JFFE 1S7TB 2F19H 2ZCLL 4X0KA 5EEWA 1K5WA 2CXGA 2YXVA 4NZTL 4FC3E 2WB7A 3UTTE 4Y2DC 4AWJC 1EHLL 2ADIB 3RY6C 1M6OA 2YQ2A 4LCVA 2NNAA 2EVGA 1G94A 2YD4A 2ZXCA 3FJTA 1MPAH 3MXVH 4L4TA 1OZUA 1D5XA 1ZPUA 4KRNA 4B9GA 1KB9J 4XMPH 3UZEC 4M6AA 4NP4H 3SE3C 2OJEA 5F9OL 4Z1PA 4KITB 1QHPA 3MA9H 4IMLA 4PLOB 1HXKA 2CRYA 3O6FB 4OZHB 5DS8B 1JF1A 2VDPB 3DK2A 1M1XA 3JYCA 5E6ID 3AT9A 1FFRA 2IJ0C 5L6YH 3RUGE 1B2YA 3ARGD 4UTCA 3I9PA 5F93C 1BHGA 1EXUA 2CUAA 2WAHA 3FQXA 5DZPA 2NXYC 1M2OA 2FJHA 4JY4A 1F90L 4D0DB 1OM9A 1RIHL 2EE6A 2FDBP 3JWDH 4PG2C 5EV7A 1N18A 4EBQL 1QI5A 4D3CL 3C5XA 4QPEA 3DHMA 4ZFGH 1J5DA 3KM2A 3VB8A 4BJLA 3VFTA 3W81A 1J8HB 1KCSL 1P6AB 3B9EA 1HAWA 3HB3C 2PN5A 2YBRB 5C0FB 3A6OA 5FFLA 4NT6A 1QEWA 4ACPA 1T5XA 5C07D 2RMNA 3ETBJ 5D1ZI 1HWWA 2DW5A 2X28A 4LVOC 1WEJH 4LSQH 3VFOB 4HX1B 1BGXL 1YNTA 4F7TA 3E6FB 2I24N 2JJUA 4Y1AD 5DEJA 1R0AL 3FU6A 4H8QA 3I6KB 1D6VL 5F1NA 1HE8A 2VDMB 4LP5A 4PRBB 3ZKSD 3H56A 1AD9B 3DTXA 6TAAA 4ZK8A 1UWEH 4W68A 4LPYA 1Q9LB 2DQJL 1RZFH 2C4FT 3QXTA 3WFZA 2EDQA 1GAFH 1M1SA 1THAA 4P48A 1XL4A 2ATKB 2X53A 3BE1L 4RCAA 5HYJE 5SWZE 5SWSB 5KSAC 3IFNL 1T22A 1VFBB 4DPBX 4E0RA 3L3KA 3NFPA 5F1NB 4Y5XC 1WCBB 2AI0H 1D9KD 1UT1A 3CK0H 1KEGH 3P3YA 3ABLB 1TLKA 2HRLA 3OMAB 4JFDB 5ILTH 3I6KA 1PZSA 3HMXH 1TEFA 2C9XA 3L9RB 4JFQB 4GIOA 5DD6B 5E9DD 1MREL 4OD3H 2V8LA 2OCCB 1ANUA 3I6GA 3FO2B 3K5RA 1OAXH 4KO6A 2MCPH 3AG1B 3QFDB 1K8DB 3FHEA 1DLHA 3IDJB 3LRMA 4UINL 3P73A 2H3XC 2W9EL 3BAEH 3D3VA 3FRUB 4PVMA 4DGVL 1XF4B 3UJJH 4N0RA 4P2OB 43CAB 4QLWA 3IKCB 5DHYB 1DQDH 1T20A 3CFKA 1X5XA 2XN0A 3IF1B 4HK0A 3ZGHA 1W91A 3KJ4B 4X9FA 1X9QA 1LEIB 2HT4C 1QHQA 1KBGH 2P24B 2YFNA 2A9AA 2VR7A 5C0JB 5I76A 5ANMA 1ZS2A 3FB5A 5IGXL 5L2KD 1WFJA 3OQ3B 1L9OA 2DQIH 4LSVL 3ZIYA 2WSPA 3SYAA 5GS2D 1AZRA 1OF0A 5LBSA 2OXHB 3PCYA 5I0VA 4LDCA 1KGCD 1YYCA 2BNRA 2VXVL 7FABH 5I1CL 2BSDA 1SJVA 4NERA 3RJDA 4GSDL 1GSMA 2ZUQB 2XV6B 3EO1B 5I17B 3TBVB 4KPHL 3FONB 4ZTEA 2AK1L 4Y9EA 3L16A 4MQTB 3Q2CA 1INQB 2HLAB 5JHMA 1C1EH 1IAIM 4PUBH 5ISZA 3ZHDA 2YSSA 4TULL 3VTMA 5SV3A 5CLZA 1WITA 1YEGL 3VAEA 2M2DA 2VAAB 3FYEB 4U1GC 3ZW3A 3SO5A 1LGVA 2B77A 1ML0A 2NR6A 4OQTA 5KS9E 2Z8VC 1PL3A 3KPPB 4BKTC 4Q9QL 1PSKH 1OGTB 1CGWA 2V7NB 3UPCA 4XI5D 2XBTA 4Y1AA 4E5XB 3MLVH 1Z2KA 2Y5TB 3O4LA 1R5WA 3H7LA 2B9BA 3VSQA 1AMYA 1XMWA 2WTPA 4PRHB 2VR4A 3KWWA 1WC7A 4S11A 1AZVA 5ESAB 1DFXA 1Q9WB 2GBTA 4ABWA 3AVEA 1P84K 2YAPA 4NWTH 2GQHA 2ICEC 5GS1C 2EO7A 4JY6A 4Z78B 3BWZA 2N7AA 4YUEL 3P9WB 2KYIA 1ZS8A 3OJDB 4GQRA 3Q1SL 4W4OC 5HGBB 1MRDH 5JPMA 4GSXA 1KTLA 5FB8B 2VXQH 2Y5TA 3O4LB 3F3HA 4GG8B 1UACL 5I1KH 3JYBA 4HPHA 4LCWE 2C9RA 4OH2A 5ADOL 3BPOB 2DLEA 3GHEH 4G1EA 4Z0BL 4M5SA 1A7QL 3ES6A 4YFDB 3WFCH 1WFTA 5I73B 25C8H 1SHWA 4TOYH 5GQBA 1BPLB 4U3CA 5EN2A 1KDIA 1S7VB 4ZW6A 2RB8A 1FFPA 3VFVA 3KR3H 3ULUF 4ZD3L 3GD1C 4DUXA 1RZGA 3DURB 3EJCA 4GRWB 4LSPL 2HYMA 4NC1C 1P7KA 2YARA 2Y23A 2ZX7A 1JZDC 3KZ8A 2B16A 3MXVL 4HUUA 2A2QT 1FRGH 4PVNA 43C9B 1H3GA 1BBDH 2APXA 4E9QA 4B9YA 3I9AA 4MASA 2DQCH 4R9HA 1YMMA 4BE6A 4OGAC 3A4AA 4PGEA 1YEDB 4MJ5B 3QZWA 4EI5D 2K3HA 4NLAA 3VXMB 3C60A 4O02H 7PCYA 3MRGA 4PWJA 3FQRA 4JM2F 5D96C 4V33A 1ZA3A 4M6OH 3AT8A 4N8CL 5CJXA 3IDNA 3QO0B 4GW1A 2BP3A 2ADJA 1K4DA 5DXWA 1GGBH 4R5VA 1NFDA 2XVLA 4TUKH 5JHBA 1JZ7A 1NIFA 2GY7B 2O26U 4WO4B 3KBPA 1P5VA 1DQKA 1BP3B 2PCPB 5JR1H 1TJHH 2VE6A 4LDLB 3PIQA 3CXDL 1FC2D 2W65A 4XWGL 3G6JF 4FJYA 3HAEG 4HALA 3VWKC 2F54A 1MQKH 3BDYL 4QRRB 5GGVH 3ZT6A 2P5WE 3OVUB 3D0VA 4PJ7B 3BUTA 4FNPA 5TE4L 2J5LB 4JFQA 2R1WA 3SKMA 4ADJA 2EE3A 3P30L 2VDOH 1S9XB 4GG6B 1WAAE 4PR5A 2WN2A 3HAEB 4BZ1A 4GQPH 3LZPA 4WFED 1PY9A 3QPXH 4XMLH 3EYFB 5KJ4A 2X4TA 2J8UE 1T21A 4P07A 1RZQA 3T77B 3E80A 1VEPA 3ULVH 5EEXA 1ZLSH 3JWDL 3FT1A 3D25B 4MA1B 2GG1A 3WIIH 2JNZA 1R3JB 4C47A 3GI8H 4AYMC 2G0LA 3QT2A 3GXFA 1ZGLP 4DTGH 5HJ3B 4M56A 5D1XE 5C0CB 3JBG7 2GABA 1X5IA 3F85A 1U95B 2ARWA 3UH8A 3LEVH 5CXPA 3KJ4C 3SPIA 4F8LA 3NFSH 5F7DB 2R29H 1WE5A 1E5BA 5I6MA 1UFUA 2V3DA 1VPOH 2FJGB 3BX7C 4FXKC 5HHNB 1WH0A 2WLYA 4KK9C 1T1YB 1U8IB 3NCBB 2G30A 2KQMA 5E2TH 2VISB 1T83C 2XWBB 4NCC2 4IGBD 1MFNA 2RIKA 1D7BA 3QP3A 5HYJD 1OD7A 2Z1KA 5J6GB 2ZUQC 1MIEL 1XIWC 4Z76A 4YDLC 1AQHA 3V5DA 5IW3A 2F8XC 1W0VB 3VXOA 1QSED 3DGGB 3LEVL 4OT1H 3MX0A 4QCIB 5H8DA 1A9BB 2WCGA 1GGUA 2CM6A 4DGYH 4OB5L 3DIFB 4O00A 5CN3A 5D8JL 2JKNA 1RJCA 2H2SD 4P3DA 3TXAA 3WFDH 2BOBA 4NBYB 5EU5A 2YEVB 2X4UB 4JX0A 4UQ2A 2VLJD 2CH8A 3IM1A 2AV7A 2BW4A 4I18B 4IHOA 2LU4A 3FB6B 3H7BB 4KZCA 3SE8L 4IMLB 2GJJA 3DMMA 4DCQB 1EZUA 3V6ZA 1HSAA 1LL1A 5I0DA 2CO4A 1JV2A 3US9A 5J5EA 1LWRA 4UIKL 3V6FB 3P4NB 3QIUA 4JREB 4KKCD 3NJNA 1BF2A 2H26A 5E6UB 1IGIL 1UVQA 4DKEH 4YPJA 3S35X 4UILH 2AEOA 3W39B 3CBRA 4JFHE 1FQ9C 1QFHA 2A4CA 3EYQC 2R2CA 1KJVA 2VSDA 4PMEA 1I8KA 4YVUA 3VRIA 1IVLA 3QXDB 3RZCD 5DZNA 4IRZL 3ZHKA 2ITCB 1D6VH 3ARFD 3N1GC 5DJ6A 3MV8E 4MXQC 2ZOKB 4HJJH 5TDPB 3K6FA 3KPMA 4OU3A 3J07A 1N5YH 5IMMB 2OCJA 2VO5A 3WTVA 2VLKD 2VLLB 3STZA 4L4VA 3STLA 1AGEB 2BSTB 3RL2A 5JDSA 1OAUL 4A6YA 2VXTH 1HL5A 3I9GL 4OKVA 4DZBB 2OLDA 1PF3A 1HZHH 1GL4B 3D09A 2WKGA 1FVDB 4MMXC 4F15B 1WFUA 4QT5A 3VWJC 1A8JH 2VUYA 5AAWA 2H6PB 3PGFL 5IQ9A 2A83A 4XXCA 3G6DH 3E1F1 5EDXA 2VLRA 1RHFA 5I5MA 3BN9D 4Y8DC 1SY6A 1P2CB 3F7QA 1G9EA 2JFCA 4ZO9A 5KSVA 1F5WA 1KJ2B 3KE0A 4FMFA 1MEXL 1RK0B 5LXGH 4L3EB 3OKMA 4M6NL 5IMOA 1XGRA 1R5IB 2FB4L 4L1HA 2YPVH 5E1QA 2ODIA 4U6XB 1JPGA 4KX8A 1YNKL 1CXLA 4JLRA 3MNMA 1CQKA 2OZ4L 1A9VA 3V0VA 4AT6B 1F6AA 4PGZA 1AQKL 1KENH 4G9DB 3HI1A 4X5LA 2MOGA 3RURA 1HOCB 4GS7C 3C8KB 3WHE0 3BYTA 3WN6A 1QRNE 4LLUA 2C3HA 3IJSB 3OKMB 1A3LH 1XB3A 5CMAB 5KW9L 5DWUH 4N1HB 5FA3B 4P59H 1PLGL 1A3QA 4YR6A 2BDNL 4DEUA 1TYJA 1JXGA 4BSWA 2CHWA 3K74B 3ENEA 2XA3A 5D6DA 5I30H 1CFSA 1F13A 1JVKA 4HJ0C 1ZLWK 4WW2A 1CDIA 5FW6A 3SYQA 3U0PA 3H9SD 2IQAB 4EIUA 2WWKO 3IEAA 3I85A 3KPSA 4KHTH 4LO9A 3BZDA 3QEHB 4Z78A 3WXWL 4MNGA 3SO3B 3ILPA 1MRFL 5F0JB 1D2PA 1VRSA 2AJUL 2DLHA 2PP8A 3GIVA 3UBXA 4MBOA 1JK8A 4LLWB 4H13C 5DGQA 1SM3H 1YMMD 4UV4L 1DSWA 1JD9A 3L9BA 1I1YA 3N41F 2ORBL 4UOW1 5E8OB 3TPUB 4LBEA 1S7XA 2IBZY 4MWFB 3DTDA 3QXDA 4H1LB 1Y18B 3CDZB 3FO9A 1AGDB 1ERNA 5IW6A 3FULA 3HC4L 4P5TA 4OFQA 4RMRA 2NY5C 2V17L 3QEQB 1TNMA 3NPSC 1LO0H 1RZJC 4R26L 2FGWL 3PV7A 3VYOA 3TIDA 2ADGB 3F7YB 1C5DA 4L8BB 3CVCA 4CU8A 2IDCA 2NYKA 4PVBA 5MEND 2QZQA 2VUOA 3IU4H 3MPCA 4KKCC 3S5YA 1T2QH 4JAMA 2YC1A 4WI6A 4I0CC 3IFLL 1QRKA 5MERB 1YUKB 3MREB 5FGSA 4DKTA 1MLBA 4Z7QE 1T03L 2MNWA 5D6CA 3HCVA 1CICD 3VXPB 3X11B 2EEBA 1AANA 1Z3GL 1KXHA 2HJFA 4UZGA 5ID0A 4YIQA 1QLEH 5A6MA 1PG7X 4Y88A 3FU8A 2ICEB 1SLXA 4BK5C 1E4WH 2O5YH 3D2UB 1I82A 4HF5H 4Z0XA 2AVFA 5FW7A 2XICA 3KPTA 5DRXB 3VUAA 1ZCRA 1IGTB 4KI5C 3M1BA 3EJSA 3OZKA 3IMRA 3JWNC 1DLFH 4NZUL 4TSCH 4YHIB 5GISH 5KJRL 4O2FB 5C9KA 1IBHA 1VACA 3HS9A 4GKZB 3GMLB 5K9JL 4XVOA 3KPNA 4X7DC 4YBLB 4HWEH 2X3AA 5BRZE 3F00A 5A7EA 4JDVA 1TFHA 1A66A 2Z8WC 3D39E 2DQEL 2P8PA 4I0KA 3P4LA 4GRLB 1QLRA 3KEHA 1PU0A 2WSDA 3GHBL 2WN3A 3IMSA 1F42A 4P9MH 4AQAB 5T5FH 4ZPTA 3E2HB 1IBZA 2QT6A 3IMTA 2DI7A 2JWYA 3BZEA 3JWNH 3GMRB 1EVTC 4NOFA 2J6EL 1J9TA 4PJ7E 1SN2A 4Y2DD 2XKSA 3QUXA 4B0MB 3Q48A 2CKBL 4PP1C 2GJ6E 1ADQA 2CJSA 5C0CD 5IQOA 2ZYIA 4R4FL 2JMRA 4IYKA 2E4TA 3W38A 3OZ9L 5MEOA 2PR9A 3R7QA 2J8UB 2EE0A 3RWHB 1OOWA 1RU9L 2CLVB 1Z9MA 2LW3A 4UANA 3G9VA 4JQVC 2JJTC 3NGBC 5DF0A 3VRJA 4YSEA 1EEZA 3NCMA 1B3IA 1VAHA 3PWUB 3QB7C 4LSRH 3KXFB 2JLLA 3BZ5A 2F54E 3EF4A 4ZMZA 3FT9A 5TJWK 3BKJH 1TCRB 1WBZA 3PHOA 3PXLA 3BCFA 2YAHA 4KGLA 3OTTA 4UQCA 4U1IA 2Z35B 3KVQA 4OR1A 1EA9C 1NCCH 3MRHB 5G5DA 3TBBA 4GFXA 4P23A 4RQQB 5JIPA 3APDA 1L6XA 1G7HB 4GAGL 2WYHA 2EZ0C 1FVEA 2YR3A 2ZYRA 3IJ7A 4NQCB 4QOKD 2QPUA 5CJOH 3IETA 1Z9SA 5H2BA 4JRWA 4XBGB 2WQRA 3LQAC 4GMSH 4KFMA 1BOYA 3VFSA 4QJ4B 4LSUL 3H9SB 4QR7A 1AJ7L 4Z5RB 1D3CA 2VDQL 1ZTMA 4AIZB 3LEYL 2W0FA 3T3PE 2PTTB 1U93A 1J8SA 1UD4A 3JWOH 4XNBA 2APVA 3RBGA 4GKNB 3GM0A 1UM6H 1U8OB 3II3A 4PRIA 5I8EB 1T5KA 5IVOA 2H0PA 5BZZA 1IC4H 1U2YA 1JWMA 4JZNB 3V4PA 4ZS6C 3VXRA 4YJZL 2BS71 2PYFB 4IOIA 3ECQA 4ONOA 3FZUC 4GO6B 3IPEA 1AO7D 3CH1B 4MMZA 4HGWB 4M5TA 2FWUA 43C9A 3F65A 4WFHD 2AGJH 2HCZX 2OSXA 3KWTA 2G3ZA 1YLBB 3OLGA 3CN2A 3QIBC 4IDJL 4IU3A 3RTLA 4HW6A 2OJZH 1JPTL 3EFOB 5DSCB 2WC7A 3S97C 4TNGA 2I5YL 1NGYB 3GI9H 3FFDB 5C71A 4LFHG 1JYNA 1IL1B 4PJBB 2FEEL 3CFJB 1KELL 2R59A 3RNQB 1J0JA 4KOCA 2XV0A 3U6RB 2BSRA 2H32A 2JK5B 3MOAL 2NY5H 4W9LC 2EDDA 2WCPA 2WKOA 5I74C 3QNYA 4HCIA 1RUAL 4KQ4H 4QXUH 4YWGL 1FIGL 5ITFA 4P4KB 1M4KA 3X13A 1RV6X 3NIFE 4L48A 3K6NA 1FZJB 3MRLA 4ODXA 3VGFA 3G6AA 3LQMA 2BVPB 5GRVL 1ZT1B 3EBIA 3RZWA 1P4UA 4LDOB 4JM4H 1NCAL 4NKQB 4YFEA 3SE9H 1HZKA 1FO0H 4PSRA 3MHZA 3PREA 3LQZB 4GXFA 5IR1B 4L1DA 1CGXA 1E4KC 3VX1A 4PLKC 4EDWL 3ZZQA 3OGCB 1WC7B 1WDAA 4PJ8A 3ASNB 3BOVA 1NLBH 3GSNH 4LOVA 1ITBB 1BD2A 3QZBA 1QPPA 2R4SH 4IRSC 4M62H 2AJXL 4FTVA 2HJLB 3G5YA 5GZOD 5AVYB 1XGPB 4KKAD 2NDGA 1FNSH 1WT5A 2CU9A 2E0PA 1EERB 1HHJB 2A9DA 4P23D 4QRQA 5CD3A 3S8FB 1DJSA 2WMPB 5DYOB 4WHTB 2OYLA 3W0WE 3D85B 4YZFE 1BQHB 2OKMA 4CC4A 3T6VA 5DR5L 1URLA 2VC2H 3SGEI 5CWSA 4C57C 1E28A 4UDTA 3TT3H 1JPTH 5DT1L 3ZYJA 1ETB1 2N7BA 2VZTA 3ZYZA 4Y1AE 1CLYH 1KJ2A 2XJKA 1NBYB 1YEGH 3OSVA 5JA9A 4NHCL 3J7HA 2CO3A 1U8HB 3QUKB 3AGWA 3SSGA 2PYEA 2VN6A 3ESUF 3HE6B 3VNYA 5DHXB 2XZCL 3OKKB 4Y16B 2NOYA 4L4TD 5EOTA 1HQ4A 3M7FB 4NX0A 2G4EA 5I1CH 5KVGH 1MQKL 4WCYL 4Y2LA 2UUDK 5BV7B 5FO2A 4OD2B 5LAPA 1AGEA 2QADD 4HWUA 5FUCC 1KTRL 4OM1H 4WW2C 1V7NH 5KZCD 1NCAH 1SEQL 3GBDA 1N4XL 4OCRH 3NJFA 1LP9E 3A0OA 4L1LA 4XP1L 2DIBA 8FABA 1RIHH 1N70A 4S0TD 1WF5A 4AJYV 3D4ZA 1LE9B 2GIMA 5EZLB 3ZO9A 4ZMVA 5H37A 1GCFA 3VDCA 4IBTA 4K55A 3IBEA 3MN8A 4M62L 2QMKA 4OAWB 4WEBH 3MLWH 4H44C 5I1DB 3RY6A 1ZHBA 1SMAA 1E7UA 2TAAA 2EJ1A 4BFEA 4HLZH 2AK4E 3WNLA 5TE6L 2O1AA 3AM8C 2WNGA 1F45A 5IJBC 1U3HB 3ZE2B 5FXCH 5CBAA 2J3SA 4H4NA 2ARJA 1A1OA 3BPCA 2DWYA 2DH3A 4QXTB 1TSHA 4X4YB 4FHJA 4M1GH 5ALBL 4OJFL 4XCEA 1B2WH 3P1VA 1E40A 1GYWA 5E2WH 3GRBA 3ZL4L 4K0OA 1O9VA 4POZD 5DO2C 4HOWA 3T2LA 3F7LA 5LGJA 1XXFC 1J5IA 5MEOB 5TH2A 5I19L 3V10A 1UEMA 4OVVA 3VCLB 4EVNB 4XPFH 4YSRA 5A6IA 4CUCA 3OJ2C 3VI4E 2K1MA 2H0EA 4G6KH 1AH1A 4U3SB 4YX2H 3TEZA 3EKCA 3KLKA 1OGAB 3OGOE 3EJYD 4RWHA 4WFFE 2CLZA 4ZTOL 1UZ8A 4R83A 3QIBD 4FYTA 4IOSA 3ZDYF 5CEZE 3BWSA 3T0VA 4IRSB 2VM3A 1EDQA 3I02B 5EORL 3AZUA 1IB5A 1SUHA 1BQLH 4Q89A 4FJ6A 4U3SA 1DUYB 4OFKA 3FOLA 1W8EA 1FWXA 4HUKB 3C6SB 5GRJL 4RRPM 1BMZA 1G0DA 1GTNA 2ERJC 2PP7A 2ED9A 1BYOA 1E8ZA 4AEHL 1XR9B 4TTGA 4NKIL 3RVUD 1A7BA 4ZO8A 3WLWD 1KJ2H 4PD4K 4QTIL 4X9GA 5E0QA 3DSNA 1INDH 4YLQT 4CC4C 2UY7A 4FKHA 4WO0A 4RFOL 2B08A 4GAJH 1MI5D 1U3YA 1LTXA 4GLRI 1QO3B 3CVDA 3LS4L 5C0GB 1HINL 2XRAL 2XWJB 3BEVB 5JXAH 1XGQB 1KGJA 1G9NL 2CHDA 1XTMA 1ZSDB 3ULVC 1TJMA 2R0KH 3MGOA 4CVZA 1GXEA 2R8SL 1CDGA 1GTFA 3BQUA 4OFPA 1ORQB 2LOEA 5CEYA 1HAUA 2J1ZA 2QJDA 3AS3A 3G3LA 1KT2B 2JIXA 1C5DB 4L8BA 2VL5A 3HPLA 5BNXD 2FGZA 3UTSB 1BBJB 2BMKA 4FI8A 4WHDA 3UZQB 1WWBX 2Y06L 1E27A 4FMKA 3RKPA 5CKGA 2CPCA 1MVFA 1I53A 4TVPH 1K4CB 4PV9A 3V4VL 4AKQA 1IV8A 4FXGB 3VJ6B 4Z3IA 4XN4A 4WFGD 3ARQA 3L4XA 2M1KA 2L7QA 4M7KH 4NSKA 2DOCA 2Z1PA 4JG0H 3KLHD 4G1MB 5EF2A 3FUDA 3MYJB 1OSYA 5IWLA 3FO0L 3H3BC 1KIUB 3FRPB 3D4YA 3MRCB 1O9ZA 4MJ4A 4Z95L 2EDBA 3TOPA 3AXLA 3GYRA 2OXGA 1KPVA 2W95A 3DMMC 4TSAH 2FH8A 3QJHB 3MBXH 4J6IA 3R7RA 3TASA 4AIEA 1TKWA 5F89A 3VU2A 5D71L 2HH0H 5CEZH 1G1KA 2CDGA 4XBPA 1K5NB 5ILTL 2AQRA 1U92B 2ZCHH 3WKNA 4XMKH 1A7RL 2YXMA 3TJHC 4ETQA 1EQWA 1G7MB 2IDFA 2ZP8A 4NRZA 3BQUD 3OSKA 1I9IH 2R2HB 4XRCA 5I66B 2I85A 1KGYE 5DJ0A 3KLAA 3T2QA 2WLMA 1ADWA 5K33A 5DYOA 3PDGA 2X1OA 4LLQB 1IQWL 3ZDYE 4K23H 1MFEL 5EUOB 1ASOA 3OC5A 3VXPA 3X11A 5J11B 4TNVF 4ZW7A 1YY8A 3L95A 4NKDB 3ZOAA 5IQLA 3TVMC 3CVHA 5FO9B 1JNJA 1EZVY 3QUYD 5HYIA 4AEHH 3QE5A 2WNXA 5KYYA 1OZTG 3RX8A 3TZVC 2ZNXA 4Y1SA 5DJ0B 2Y7QB 5EF0A 1EBPA 4NNYB 2OMYB 1PDKA 2E9JA 1J1XH 3S6CA 1M6UA 1WEJL 1QFUH 4JDEA 4WJ5B 1BM3L 2AQ1A 4YXKL 5AQ0A 4LXFA 5EUOE 5GJSH 3QRFM 5KN5B 5I6XB 1SEBB 1S9YB 4HAGA 3HBQA 2ODHA 1TFPA 4JY5L 4R7DB 3U82B 1IAOA 2H2PD 5IEKA 3LMJL 4B9JA 1HVXA 4GSRA 5IFHH 5KOMC 1P6FA 3X13B 2WTOA 3P2DA 1TPXC 1YUHB 2J1WA 3K1KC 4PJHE 1J9RA 3CV5A 3OR7A 3N42B 5FO8B 1I7TB 4JFPA 1PEZA 2EXYC 2Z4QB 2ZSWB 4AV5A 3HS8A 2E7HA 4YHPB 5IEKB 3EZJB 2VL4A 3HBPA 4RGOL 1X4YA 4POUB 1CDBA 4WI7A 3RDTD 5DC9B 1MCOH 2LLLA 2XTJD 3Q2WA 4AIXA 5BXFA 3Q2NA 2EKJA 4UV7H 3TV3L 1KN4L 3LYRA 1NCHA 4O02A 4LT7A 2ZIDA 3T3PF 3LAFA 1R34A 2NY5L 1HIMH 3SKNA 4AEIH 1U2HA 1A25A 4JHAL 3WELA 4I9WE 5D72L 4JPWH 3PPSA 3MUJA 2IANA 3ZQXA 3TO4D 5IHUL 1JHLH 1WBXB 2WLLB 5D1ZA 3CLFL 3SPJA 3V5HB 1XF2B 1TZIB 4MD5B 3O2VL 2P8MB 4TUJA 1V3JA 2HVJA 1EMTH 4DVRL 4OJYA 1A4AA 1GGYA 5ISZE 5D7SL 1F3JB 3TO4C 4Q6KA 1WA0X 1BF8A 4JM4L 4K3GA 5EEVA 4EXPX 4UF7C 5EO0A 1T04A 1QSFA 1RULL 5BUPA 5H35B 3SBRA 1KBBA 3O11B 4WUUB 2A6JA 5CUSL 5FM4A 2B1HH 3ASOB 4L2LA 2XFXA 4XO4A 5I74B 5F72S 2EDNA 3UZVB 3T65A 2EH7L 3VG0L 3K91A 5BS0D 5LDSA 4L23A 5F1KC 2FT8A 1KB9K 1KSRA 1T6BX 1WO2A 1HSBB 3CFNA 1WD8A 3O41B 2HT2C 1YNKH 2WXPA 5I75C 1YN6B 3EG9B 1SHXA 3H3KA 4ZMWA 1FN4A 5CEXB 4AKPA 5AYQA 1I1AC 1L9MA 3P4MA 1YPZF 1Z5LB 4YPGB 4NQDB 5H37H 4JFUA 5T3XD 1KLFB 1I1AA 1TMQA 4J1UB 4OCXL 3ZR5A 2UXVA 3TNMA 3X14B 4YSUA 3KH4A 4H20H 4KKQA 4P4RA 1N0XL 4CBZA 4XWOC 1QFPA 1OCWH 1ND0B 4ZODA 5HYJA 1UZ8B 1WFIA 4UAOC 3DRTB 5IHBA 2O6FA 4ZUUA 2BVOB 3MRPA 4FFTA 3LZFH 3HZYB 1I8KB 2PP9A 4UM9A 5J12C 3WL9A 3IRCA 2X6CA 1EEZB 3L08A 3L3HA 3BT2L 5EU6B 1M05B 5HJ3A 1OARH 3GSOA 4YSCA 1N6QL 4F7CA 1BAFL 1ZJBA 4Q9RH 4MAYB 4M8QB 1CB4A 2FL5A 1GGTA 2EVIA 1VCBC 4OQTH 4KO7A 2W81C 3NACH 1B0RB 2FYVA 5TH2B 5LGYA 1XEDA 4F7KA 5BV7L 4RMVA 1YECH 5I1GL 4W93A 4KMQA 2OMUB 3SIKA 5LNGA 1LEGB 1AJ7H 1UJ3A 2CO7A 2I07B 4R97C 3CLEL 4LEBA 3OMNB 5EOQH 2OL3L 2OK0H 1FLRH 1OE1A 2NW2B 4OGYL 5FYLE 1D5MB 2DLFH 1KCRL 3D06A 5EU3A 4DKAA 4UQ2B 1A1MB 1DUZB 1YEEH 1BEYH 3BHBA 5F9WB 2F9BT 3A6CL 1NMAH 1QASA 3I74A 4M5YL 4YSTA 1KTKE 1AGBA 2Z91A 4UUJA 1J11A 5HDWA 4DGWC 2BO0A 3UO1H 4D0BA 4MCZB 3BW9A 1IM9A 4IBYA 3CFEA 5HYQA 3U36B 1SOXA 3EIFA 3DOIA 5AZ2L 5IVXF 2CM5A 1ZSHA 1Z5HA 5JW4Q 2UWEB 1F8TH 3DI2B 3GSNA 5L2KE 2B59A 4XH2B 4JJHA 4Y89A 4YE4H 3T0XA 5BS0A 3NESA 2Q8AH 2SEBB 3NRPA 1PNDA 1Y1DA 4W4OA 2BFGA 4XCCL 1UD8A 4M7JH 4E42A 3ALWA 4XTRD 3U4BH 2DZEA 3IJHA 4A7SA 1P5UC 3LS4H 5EULV 3PGCA 5JXAL 1OXYA 2V9RA 1ASPA 3E6HB 3P40A 3JWDC 4CMHB 5I1AA 3FT4A 4UB0L 4DTGL 4NDMB 5SX5K 4OQ1A 3M45A 5LXVA 2NY6D 2QHRH 4AGQA 3AY4A 2Q20A 4NEHB 1BX2A 3ZDZB 4Y2NA 3BAEL 3G9AB 1YO4A 4ODHH 3O6FD 3SDDB 1DJIA 5LBVA 2F0CA 3P9LA 1RLBA 5AAWC 5GXBB 1VDGA 1NDMB 4OUUB 4YDMA 1XB6A 5F6HJ 3JVFC 3MRNA 1NH6A 5J1TC 3KXFD 3VNZA 3OKNA 2Z65C 5DJDA 5DZLA 3ZKXB 1KLGB 3FH5A 4MLIA 4BHUA 3Q8BA 4U7KA 1S2EA 4U0RC 4F91B 1NAMB 2DYRB 5KUMA 2OMBA 2XWZA 5EORH 1ECYA 5MEQA 4NPKA 4QAMB 3D9AL 4MJ6A 3HVDA 4NENA 3V7AE 1S9VB 3CXDH 5GGQL 5T1LB 1L7TH 3KPOA 4LHQB 4JFPB 4ZFFB 5KBLA 1KCLA 4JKLA 1TNNA 4JN1L 1VKXA 3OAZH 2GTWA 2O5XH 1DBAH 3K4ZA 3RWFA 1MHEA 2DQGL 5I8KL 4PJXA 2MOQA 4Z7VF 2P5EB 2HLFC 3SCMD 4G82A 4BFBD 1Q94B 3TBCA 3ARBA 3CCHB 4ISVA 4OIIL 3T6XA 1PLCA 5IB4A 5GS2H 1MCLA 3Q43A 4GT0A 2VR3A 5L4IA 1BA9A 4QAWA 5AW8B 4LCUB 5BQ7A 1C5CL 4U1JA 2Q3XA 1A6WH 1FNFA 5LBGA 4QHNB 2OPCA 1NC2D 8FABB 1BQKA 3FU0A 5ESAA 1EJOL 1FI8C 4ODSL 3EJYC 3EHBB 4YBQD 2IWEA 3UL4A 4ANVA 3O6FC 5FOBB 4F8OA 5E94A 3UMTA 3VWKD 2EIBA 2VLKB 4ZJ9A 4AQ1C 1OANA 4N28A 2ENQA 2HSIA 2G5UA 2P5EA 4L8SB 4J3BA 4PJAB 4NI6A 4MXWL 1JNNL 2EE9A 5LLIC 3K4DA 1YEFH 4BKLA 2VERN 4C8XA 2DYPD 3RY5A 5SWSD 1WBYB 1U91A 3IAQA 1J8KA 4ZUUB 1S7UA 5GRUL 1G87A 4X5PA 3FFDA 4MJ6B 4UTBA 2PTVA 4ODVH 4XVJH 5GHWL 2NYZA 3CFJA 3II1A 2R2HA 4HC1L 4WHYG 4M7KL 2D31A 5AVSB 4NC2B 3S3SA 2G5BB 5JO5B 4NZFA 3LS5L 5EZJA 4FQIL 1KXQE 5IQ9B 5F7MC 1JG9A 4NJAL 4WGVB 2K6ZA 4F57H 3GLDA 3QDMA 4HIIB 1FVCA 1J0IA 4FGMA 1VESA 3HNTH 1PKQE 1IT9L 3FT2B 4LVNC 5HHME 4H8UA 3DXAD 4TNVK 2BXYA 1XCXA 3FSAA 3BESR 3DNKA 2QVFB 3RWEA 3DO7B 4ELMB 1KN2L 2BNUB 4JZOA 3HNVH 4XCNB 3X3GL 3QULA 2ZICA 3NIGE 5L0QC 4N6RB 4OF0A 2J1KA 4GKNA 1AS6A 4QHUA 1EXGA 3BDXA 4LPCA 1JGLH 4F1ZA 1NGXA 3B6SB 1RCYA 4NZTH 5IHZA 1QHOA 4XC3L 5FV1L 3Q01A 1GYCA 3V0FA 2D3NA 1UJTA 3VRIB 1KY7A 4M5YH 4MFHA 1JVOA 3DETD 3FO1A 1U0QA 3IDXH 2JELL 4JS7A 2BCKA 3PHQB 3R1GH 4H0LC 4I1RA 5D9SB 5LBSH 3RIFF 3R18A 4ZS7L 4P5TC 2UXTA 3X12A 5L4JA 5DJZA 2FNWA 4Z3EA 3VM7A 3IS0X 1KPRB 4HIEA 3OWRA 2AAVA 1S8DA 2WCSA 1MUJA 1TU2B 5AAMC 2CWRA 2KS0A 2Z93B 3PJNA 1MDTA 1T1XB 5BO1L 3FF8A 5DJ2A 1NFIB 4LSTL 5HDBF 8PAZA 3KWUA 2A9CA 1NFDE 2P5WA 1RZ7H 1H6TA 3QG6B 2AZUA 3Q6GL 1WHOA 3ULAB 3MJ7A 3NSYA 4H7VA 4AQEB 3ARGA 2DICA 1ZVSB 2WTRA 2D3VA 1YSOA 4Y5VA 3RDJA 4HUXB 1ZEAL 3ARDA 3GUFA 5FUZL 4A6YL 4Y5VC 4XE0A 1OF2A 2PO6A 4ES8A 3B7UX 3S5ZA 4WFFD 2OMVB 4RAVB 4GRWF 3POCA 4KMTH 3RI5F 3FMGL 2MQ0A 4HG4K 2HVKB 4F24A 2HT2D 1CLOH 3QQ3A 5ICXA 4M8QA 1TQBC 1J8RA 4JG5A 1P9MC 5AKVA 3FAXA 4OZFH 4P5RA 5GZOC 1A3ZA 1FG9C 2YJQA 3FOLB 4RFEA 2VQ4A 4IOIB 4WEMB 3VXNA 4ZRGA 3I02A 5L2KA 2J88L 3V0EA 3CQQA 2X4PA 1EAQA 5FKAA 2XV2A 5AVXB 4E41E 4PLKD 1BQSA 2FAUA 1B88A 3CUPB 4IBZA 1DTUA 3N1FC 4N9GB 2DB8A 4APXA 3H1ZA 5IEHA 1L6ZA 3IB4A 4JL1A 4LOUC 3NIDE 4K71B 4Z77B 2X89D 3DROA 2NTFA 1MF2L 4WFEE 4LPWA 4XNMB 4XN1A 3MAWA 3UCQA 2NSQA 1H6FA 3GSNB 3D33A 5KVFE 1EMTL 2R1YA 1IKNC 3HE7A 3HNTL 5CSZA 3UTPE 5GS0D 4Q2ZB 3U4EB 1NM4A 4UQIM 4ALAC 4XXWC 2BSBA 1JN6B 2FYYB 4OM0H 3V4UH 3RWDB 2G0KA 2X9WA 1G7LA 3GJFA 1FZMA 3CK0L 1YQVL 1G7MA 3NRQA 1ACYL 4J7RA 2NY4C 2WNKA 5DD1H 5GGUB 1OCOB 3SBPA 5TK2A 2LT9A 2EXYD 2ATPA 1BXUA 3E2HC 2DV6A 2NT1A 3FNKA 4EKJA 1A7PL 5IMKA 4NCC1 3GMPB 4PQXA 4NUJA 3GDBA 1CDCA 3HMWH 3SBQA 4JN2B 2KZWA 4K3JH 3WFEL 2QFPA 1BXVA 4IIQC 2CXKA 2EDWA 1JZ5A 4PLJD 2AHIA 4M6MH 4Z7IA 4Z7OF 1T66C 2F5BH 3DX3A 3O3AB 3BH4A 3RRQA 2GUOB 3DVFA 4ZOEA 4WZ9A 1AAJA 3ET9F 3WTXA 3GXTA 3MGTA 3FT3B 4JRFA 4AITA 1XF3B 2AS5M 5CHNA 4YHLL 1N9PA 2DIAA 5B39A 2I25N 3TZVD 1UM5L 4JO3L 3SGKA 3O81A 4LIQH 1G6VK 3PDOA 5GSRA 1PSKL 3L4WA 3TVMD 3BCDA 3DV6B 4YL9A 1RZFL 1XH2A 1LNUB 1QLFA 5KSAD 2CA4A 3TNMB 1SLVA 2COQA 3Q6FB 5AKRA 1MHPH 4HUCA 1J5OH 1ZLVK 3V4PL 3EHBD 4Y4KC 4XCYB 2VJ0A 1IRAY 1U8PB 1XIWB 2CCLA 1Q1JH 4S1QH 2GB2A 3UBXB 3OX8A 1NGZB 2XUWA 1ZD6A 2VDOL 5DZVA 1ACCA 4PGBB 3ATFA 5ADPH 3UPRA 1MXDA 3GKWH 4WTZA 5HI4D 4FQ1H 1OLZA 1E5YA 5J56B 4YHLH 4G6AD 4HG4J 4CADB 3EOAA 2GK0B 1ACYH 4MS8C 3QAZC 1CL7L 3OKDA 5C6WH 3N3EA 4KUZH 4CSTA 3HA0A 3T0BA 5EOCJ 2BSCA 2ESVB 5AVVB 1KV3A 2J25A 4GP8B 1UOVA 2FHBA 2ENPA 3WD5H 3M86A 5HPOA 2DL9A 2CJTA 3KCWA 3T0EC 1LD9B 1KEML 3TLRA 3X17A 4HEPG 1KFAH 2V2WA 2KMWA 2NY7L 4O2EB 1HHKA 1JPGB 2H41A 3CSFA 3O0RL 1JCKA 4RGNE 4QY8B 4J6RH 3UAFA 5JLZB 2GHZA 1JHTA 1IGFL 4LLVB 2BW5A 4MDIB 2KLSA 3FL7A 4ZPVA 1SXSA 2H6OA 1ZLVH 3VQ2C 4QJ3B 4L29B 1S5IH 5F9JA 2XBZA 3WLBA 5IIEB 3QDJA 4OJEH 4JG9A 2F7PA 5E6IC 1F3DJ 1ZVNA 1PD1A 4QHNA 2L7JA 2DJ4A 1KMGA 1KV7A 3MJ8A 5KAQF 5C3LD 3U9WA 3F04A 1FRGL 2WBJA 2ZXQA 2X0VA 4GRLC 3JSSA 2JKLA 5MI0B 2XU9A 1OAXL 4PJIA 1M53A 4PJXB 2AGJL 3NSXA 1QWUA 4NZRH 1OP5H 1IAIL 3ULVD 3MMEB 3O2VH 4PY7B 4ZTPH 1EO8L 3FU9A 3DPBB 4Y2OA 4UCFA 1RSFA 3U0WL 3ARDB 2XWTB 1HHGA 2VLLA 4JPIB 3IKKA 5F21B 3UC0H 3D3VE 4CKQA 2IH3A 4Y9FA 1QBLL 5AG8A 2X88A 4PJHA 4QRAA 3Q8AA 2DWDB 2J88H 3WEAA 3JV4B 1FLRL 2ICWI 4HC1H 4K5NA 3OKOA 4R0LA 3BGAA 2GY5A 4FQHB 4PJ5A 1FAKT 1I7ZB 1L3WA 2A6KA 3QQ4A 4QXGH 3WSQL 1YEEL 3KGRA 3OKNB 2BOCB 1INQA 2IDQA 4OD1H 1U8MA 4LLVA 3SJVD 1U3JA 5IUCA 3W5MA 1NC4A 2P3YA 4QHMA 2Q76B 1Q72H 4OZGA 1N8ZA 3IJSA 3CVHB 5AVQB 5CF3A 2HLEB 2DQGH 3HG4A 3MACH 1XAKA 2ICCA 3UTZB 3V6FA 2IPKB 1MFCL 4FKEA 4NN7C 3FH7A 4X99B 4GMSL 5DGRA 3V8CA 1Q1PA 1UH3A 4OZGF 1ZT4A 3SGJC 4LSQL 3GK8L 1IMHC 2WZAA 4PRID 1I31A 1UG9A 5FIEA 1AY1L 4CGUB 4FD0A 1OK8A 3WMPA 3DO4A 4DWHA 3JTTB 2XPGA 1DQVA 4EQ2A 3ZTEA 3HE7C 3PABB 1T20B 2I69A 1MCRA 1E2WA 1LP9B 3C6EA 2O93L 1N2RB 2HTLD 3OPUA 3IDIA 3V2AR 3N43B 1FZOB 1OLLA 1P7HL 4UOZA 3SDYH 3ZJAA 4HOXA 3HE6C 5JDSB 1BYNA 3LNHA 2DEWX 4HKZA 5SWZD 2WXOA 2FHCA 4JFOB 3HZ3A 4QUOA 3TWCL 3WDJA 3V5DB 3WUWB 3HOGA 4YOKA 4U1NB 2D4DA 4EI6B 4M1CC 2D03H 1NEPA 2DYSB 1KELH 3O3EA 3AREC 2Q1EA 3T04D 1OWRM 2JB5L 5BMFL 2MKLC 1V3MA 2R69A 1QABA 3LD8C 1Q0XH 4M7LT 3GIZH 3B9DA 4XBEH 1F4XH 3ARVA 1GIGL 2APSA 3QJRB 1ZE3H 4WVRA 5JDJA 4DPRA 4XVTH 3WHE1 3CBJB 2C1OB 1KCBA 3FU7A 2X5PA 3N55A 3TYGH 1HSAB 2XFGB 1A7QH 3BDBA 4ZOAA 2JTYA 2DM7A 2ED7A 3AB0C 2R29L 2GCYA 3D39D 3FQWB 3OBAA 4K7PH 2E9GA 3IDMA 1UOKA 3VGGA 3IU3B 5INCA 5DURD 4HUXA 4PP2B 1O6TA 4PJ8D 3SO3C 4QRPD 4X4YA 1UGNA 3MNDA 1KN4H 1DSFL 1TIUA 3LCYA 4HX1A 5A1AA 5JHAA 4MA3A 3GXPA 3Q1SH 3EBAA 3E3QE 4N87A 3MFGB 1DP0A 1HE7A 3EGXA 4Q52A 2VDKB 5LNEA 3BLPX 1HI6A 4P2AA 3LY6A 5KS9F 1AZBA 1JZ4A 2B0SL 4BA0A 5A6LA 3WCYA 4WNQB 3PU7A 3MV7D 2OR7A 3VXOB 1MHHB 4MJ2A 5F9DC 1SY6L 2CIIA 1NCGA 2HTKD 3P30H 3VH8G 4XAWH 4UT6A 2KI6A 1HX0A 2AEPH 2WGNB 3LEXB 3Q6GH 3QUZD 5L8KB 3QCUH 3LB6D 1FPTL 1XGYH 5D7KD 2NZ9C 1BM3H 2WBKA 3GC3A 5I1LB 1FFQA 2V17H 1D5BB 1CLYL 3BUBA 3H53A 3N91A 1WJ3A 3FN9A 1KACB 3MLUL 3GEWB 3FQRB 4QGYA 5DUBA 3RVTC 3UG3A 2X70A 1VGKB 3SDDA 1QOKA 5J57B 1UXSB 4GKSB 3GXNA 4PGJA 4N2AA 1HKLL 1CLCA 3PUCA 4KKAC 4N0YH 5E1HB 1KTBA 1MHCB 4IRSD 1HHIA 2NUPA 3S96B 2TSBA 3PDDA 1TQTA 1F1GA 3QPQD 3DX9B 3QCVH 4UQ3B 5D7IA 5TE4H 1ZDSA 3OHXA 4WKZB 3RWIB 1JPST 2BOCA 1NCBL 2VQUA 2UVFA 4FQLL 4D0CA 4ZXBA 4JPKL 3BGFB 4J3UA 1BJ8A 4XHJD 4JCMA 4N5ED 4HSQA 3ZHFA 4UU9B 4ZMTA 1F02I 3H6AA 3CFCL 4Q0XH 3G5ZA 2FECL 4OGXH 4JHVA 1RZIB 3QCTH 4FNTA 4X99A 3UACA 2I9LA 1OTTD 2AKRA 4ZX4A 4G1EB 4HLEA 4OF8A 4YEEA 1CG9A 4LPUA 3GMNB 2CK2A 3N1QC 4KRPC 5DD5H 4WO4D 4G2AA 3MRHA 1EZSA 1UWGL 4KWUA 5G5DB 2PWHA 5D93B 3V0AC 5KW9H 4R96A 3FC8A 4V2CB 3WFCL 2AJVH 2J6EA 5TQ0L 3ESMA 1KGUA 2F54D 3GPEA 3SGKC 1S3KH 1FYTA 3VXSA 3AU1B 4HH9A 1Q0YH 5EEUA 4WI4A 1CI5A 1I4FB 5CLTA 2CKBH 4GFTB 4HJEA 1CURA 2XN9E 1UQSA 4LHJB 3W56A 1KY6A 2AAAA 2J20A 2OMTA 3OKEB 4PPTA 4HC1A 3NCFB 2ZPKL 5D7IF 1A4JA 2HRHA 1WLHA 1FFNB 3GMNA 2X87A 3FZUD 4H1LG 4L3EE 3VXMA 3WGUB 5A43C 3HHSB 5T3ZH 3MR9A 4XN9A 4ZS6D 1F6AB 2AI0L 3JVGA 2H1XA 1YEHH 1QFWM 5T1DL 3EGSA 1EHKB 1F4WH 1RZJL 4XB8A 2F7QA 1NCBH 2ARJQ 4WIQA 4YHYB 5FHAL 2D0GA 1IGML 2KPWA 2VDKL 3DI3B 1I8MB 2ITDB 3HUJE 4LE8A 1YEWA 3MA7B 4XP1H 3VXQB 3CNKA 4UAHA 2NY1D 4DEPB 5I16B 1ITCA 1R46A 4F58H 3WHXA 1XCWA 5T3XH 4MD4B 3AY4C 2O6CA 3QQ9C 4P5MB 2UZYB 4FABL 1J5OL 2YWYA 1B3JA 2GI0A 3OHXC 4N2FA 5LBSL 4BV1A 3LV3B 5E8NA 3WNMA 3UTTB 2E46A 4Y4KD 1MJ7H 3FRPA 5C6PB 1EO7A 1WTGT 4P2QE 2IALB 3RU8H 4DERA 1XCTB 4KC3B 2BY2A 4CC1A 1RZJH 4KV5E 1NEZG 2XYBA 5F9AC 3CDGB 4XOBA 2Z8SA 5JPMB 1R6VA 3MODH 4JDZA 3BH8A 4LL4A 3L5HA 3K2UL 4JHZA 1DVFC 2P8LB 1XMEB 3L5XL 1I3UA 4GUPB 4HSCX 2EEXA 1F6LL 4J2XA 1LO4L 2CMRL 3F5WA 3ZPDA 3V6OE 3CZFA 3R8QA 1S7SA 5E2VL 1BFSA 4K3JL 4EEEA 1JSYA 1KNOA 2CAKA 1NBQA 3DYOA 3OF6D 4LLAA 4ORGA 5IBTH 4HUVB 2I60H 1M7XA 1QI3A 4A2DA 5HP5A 3EJJX 4P2QB 1XZ0B 2Z8RA 2WSKA 5K39B 1IM9B 1KYOK 2ROXA 3PL6C 1M3JA 3NIGB 1G5GA 2ZKXA 2KERA 3FQNA 4MX7A 1S5IL 4GXVH 1ETZA 5I15L 1SNRA 5GHWH 2AXFB 4U1IB 3AW5A 3B56A 2YD1A 4YDIH 3ROLB 4AEEA 3Q3GB 1XF3A 3BXNB 5HYFA 1GGIH 2J8UF 2NX5D 1NEZA 2R39A 4P2QA 4CU7A 4YHYC 4NIKB 3OAUH 1RMFL 4FLSA 3BUYA 4H5SB 3TA3B 1L9NA 4JRYD 5D1QC 1KNOB 3B2VH 3QR0A 1OTTC 4FFZA 4GIPD 1QUNB 1OSPH 1J87A 1QSEA 3MROA 4ODTL 3E8VA 2BWDA 2D7NA 5EBGA 1CGUA 3CHSA 3NJGA 3ILPB 5CILL 1HZHL 2L8AA 2ID5A 4I3GA 2GTZA 1M7IB 3UBXI 4FYSA 1NJ9A 2VGLM 2Z3FA 5BRZD 5I1AB 3SE4A 2B2XH 3C60C 3IVKB 2OL3B 2G2RB 4N4YB 5K1NA 1T4KA 5AD0A 4U49A 2F6AA 3QUXB 2BVYA 4LAQL 1HILA 3ZKXC 5HYJB 3WEXA 1ES0A 2FX7H 4Y7OC 1OP3H 5I18L 4HWBA 2PPCA 3NZUA 4OFDA 5IK3B 4IJ3B 4IGBB 3WNIA 1IVTA 3SKOA 1GS7A 1QTSA 2FJGA 1L9PA 2A0LD 2EADA 1R3LB 3PFUA 4LIQE 4LPVA 1NZRA 1MFEH 2JI2A 4FP8L 2ZKWA 2ZNWA 4XOAA 3HIZA 1JZ6A 2VUKA 3JWOC 3EJUA 4FQ2H 1FYTD 5F1OB 3EH5B 3GBNL 5EC2B 3VI3B 5CEXA 4L5FL 4FAAB 5D7LA 4C83A 3IDJA 2GKIA 2ZX6A 3LQAH 2AEPL 3HR5B 1CF8H 3FUHA 2CHNA 4UT6H 2WQXA 2ZZUT 1U41A 1HL4A 4UUJB 1YEIL 1O5PA 1GJUA 3PAUA 5DA4A 3IBOA 2OMXA 1VERA 5KBMA 4FTDA 4XPHH 4HJJL 5EO9A 4LARH 3VTTA 2XC8A 1O0VA 3VFGL 5T33L 3FCBA 4PTUB 4MCNA 5AVUB 4ZDHB 5HDRA 4K94L 3T09A 3HHMA 1KWKA 5J9PB 5D1ZC 3IDXL 4A68A 2ZXEB 1FHNA 3QPKA 3DX8A 3QZWG 5E08L 5MENA 3AG4B 5DC2A 4X6EA 4E0RB 3STLB 1QSFE 2DQDH 2BSEA 1E30A 4XPGH 1Y7VA 1JNLH 4P5TD 4X4MA 1SM3L 2Q76A 4UV4H 5A7BA 2PW1A 1J5HA 2AQSA 4JPVH 3DETC 2PXYA 5CM1A 2VXQA 4LSSH 4MJIA 2BSSA 3S36H 4HEPA 1CJYA 1K3IA 1TVBB 4LSPH 3BIKB 4IM8A 3F7VB 4FQQA 4GBXD 4MA8L 2W0KA 4S0SD 2V3EA 2NX5E 2YPLD 1J1OL 1NKRA 1IM3A 3EFFA 3CVHL 4X80H 1UA3A 1S7TA 1Q0XL 4HD5A 3B34A 4FLHA 1F4HA 3K2KA 5IVZB 3KNBA 3M1OA 3RGHA 4HKZB 4RWYH 4NFBA 4WWID 3L8QA 5D72H 5HDBE 4X7CC 3NQKA 1FIGH 2I9LB 1PBYA 1E9PB 2R9HC 4HBQA 3RZCA 2Z0UA 1NDTA 3NCCB 4LRNL 4PRAA 2X1QA 2WD0A 1AR1B 4JQIH 4HIJA 1QR4A 1YPZA 3ARFA 5EZJB 1I7RA 3AT0A 1CC3A 1E42A 2VYRE 4HCRL 5HVHC 4E2OA 1IQDB 4A63A 5J8OA 1INDL 1DL7H 1RHHA 1ZHLA 4Y16C 5BPPA 2VT0A 4OIIH 3HZKA 3M17A 3CVHH 5GISL 5CWSB 5FKPB 3PWJA 5IBLD 3D85A 2PPEA 5AKTA 3DHJA 4N6RA 4MZ2A 1JHTB 1MF2H 3PYCA 4YXHL 1PCXA 5DS8A 3CFDA 4HV8B 2IOIA 3NN8A 3VVVA 3LRHA 2CBTA 2NY2C 4L8CB 4IBLT 1ZLUH 3WO4B 3N06B 4U2ZA 1SVBA 5D1ZB 1KB5L 1KIQB 2YD7A 3DX6A 4UNUA 4KKLC 2NXYB 2A1WL 2NSMA 2A74C 1MLCA 3ETTA 2Z31B 3P0YH 3HZKB 3U1SL 2Q7AA 4NHCH 2D31B 4WSJA 3LKPB 4IMKA 5E8DH 1Y18A 3AU1A 4HH9B 2X2JA 4IKIA 1HH6B 3HC0B 4UT9H 5DEGB 4F58L 4PGBA 5DDHB 1VHPA 2Y1AA 5D1XD 1BECA 4IOSD 1CT8B 3CJJA 1EO5A 1AXSB 1LE5A 3LN5B 1G7IA 1XH0A 5AYUH 5A2FA 2PXYD 3T4YB 4BFRA 4K7PX 4NHUA 1KGWA 1UXWA 1SJHA 4HHGA 2EKSB 4NQDD 3ZTJG 1Z1WA 1HK6A 1SDAB 2X4SB 1UHVA 3A4DA 1E3XA 4GI9A 4BGDA 5DEGA 3LKNB 3U7YL 5CEZL 1IC5H 3NZHH 2H2SC 3L5IA 5F6IC 5DK3A 1NGYA 3MVSA 3S3CB 2NY3D 5E8EA 2I9TA 4ZYKA 4W4NA 2JI1A 5G4MA 2XPZA 1KIRB 5BOZG 5BQ7B 1UT2A 3UEQA 3KBHE 1KGXA 1OGPA 3DX9A 4UQ3A 5DMGC 1J86A 1JMXA 5IG7A 5DJZB 1MZYA 4QY8A 2YMXL 2XVGA 3EFDL 4MJHA 1XF5B 2VE6B 5FYJE 3UTSD 4MQSB 4F3FB 4DGVH 2Y0SA 2ZWKA 3TBYB 4PJFF 4AUYA 3MV9E 1LO3H 5KYUA 5C3TA 2NY6C 1DZBA 4KDTC 5TQ0H 4QTHB 3V4UL 4MNGE 3VGBA 4NQEB 3V4VH 5JORB 1QRNA 1XGRB 4XCCH 4UQAA 4C56A 4XRCB 2Q10A 4AVIA 1E9QA 4NQXA 4B3EA 4KRLB 2HFFA 3VU1A 4DP6X 3OV6A 5KEZA 2Y3NA 1PKQB 4YC2C 2CMRH 5AL0A 5ENWA 2P28B 5HHMB 5A16B 3GSQA 3POHA 4OLVL 3ZT5A 4PG2A 3CHPA 3HTLX 4G71B 1GW6A 2FYYA 5F2FA 1MAKA 2CGYA 3O4OB 5LHDA 4OFYD 2FEDC 2CDEA 4HJGA 1GGCH 1HQ4B 2IV8A 4WHCA 5CU5A 5D2LF 3NEEA 3MLWL 2XKNB 1DQML 1U8PA 1XIWA 4YWGH 1IILE 1X5JA 5E7FA 4YNYA 3H9SE 3S4SB 3G5XB 3LPOA 4AYEC 4PJXF 1QVOA 2N0KA 3T1FA 2DRUA 4ODVL 3QCVL 4M9OA 4PWFA 4XVJL 5AVTB 4RLDA 5DFVD 4UDTB 2AMUA 3ZDWA 3DX2A 2AK4B 3CUPA 4B6ZA 1NBVL 1YC7A 3NCEB 4BK5A 3ZE1F 1NCIA 5JPNB 3JZYA 3GFUA 5E8DL 3HR6A 1TTGA 4AM0Q 3PRZA 4M7LH 1FJ1A 3SDAC 3ZL2A 2XWDA 4FFZH 3BD4A 5DEFA 5B21A 3KW7A 4ACTA 4EVNA 1UWXH 1EAJA 2VDNL 3QQ3B 3QQDA 5AYTA 2EEDA 3RAJH 3L54A 3GBNH 1WA1X 2E4FA 1QUNA 2BIOA 4JRYA 3PAYA 3WS6A 5L88L 1MY7A 2ZKYA 1HI6B 1FG2B 5L9DL 1CS6A 1T1WB 1RZ8B 1ZIBA 5ADPL 1ZSDA 1FCCA 2XHNA 3FB7B 4XMKL 5HBBA 3BUDA 5HPMA 4MDJA 3VXME 2R0WH 4WSGA 3IGFA 1MNUH 1SPDA 5GZOA 2OMXB 3E38A 2O61A 1KYOJ 1ZVSA 5I18H 4KZDL 2AXFA 1A7NL 3KWWB 4P06A 5GRVK 3G6AB 5C2BL 1NTDA 1IGYA 3R1GL 3QO1B 2AQNA 3L4CA 1WIUA 3EYSL 7PAZA 1JZHA 4X7SL 3BWUC 4O51A 4PV8A 3UAJC 4R5TA 3ABMB 3D1MC 3OPZH 1KB5B 3KPOB 2ZKHH 4JFHD 4I87A 3H85A 2Y7MA 5J6SA 4XNZB 4BGLA 4PRNB 3KYNB 3FTYA 3UX9B 5HHOB 5ID1A 3KH3A 3U30C 4DW2L 1UENA 5LCVA 2PR4L 4M1GL 4GBXC 3DECA