2AF2A

Solution structure of disulfide reduced and copper depleted human superoxide dismutase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Human SOD1 before harboring the catalytic metal: solution structure of copper-depleted, disulfide-reduced form
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 37
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2af2A00
1XTMA 1IBDA 1XTLA 1IBBA 1PU0A 1SXAA 2AQTA 2XJKA 1IBHA 2Z7ZA 3KBEA 4A7VA 4N3UA 4A7SA 1BA9A 1P1VA 2WKOA 3S0PA 1S4IA 1SXZA 3KM1A 2SODB 2R27A 4MCNA 2VR7A 3ECVA 1JK9B 1SDAB 1SXBA 2VR8A 3H2QA 4MCMA 1SPDA 1SXSA 1E9QB 2WZ5A 1Z9NA 2GBUA 1Q0EA 3MNDA 1YAZA 2VR6A 3K91A 2WWOA 3CQQA 4A7GA 2C9SA 1E9OB 5CU9A 1XSOA 1SXNA 2ZOWA 2AF2A 2AQQA 1CBJA 2E47A 1OAJA 2E46A 3HW7A 1RK7A 2ZKYA 3RE0A 2AQNA 2K4WA 3KM2A 1OZUA 2Q2LA 1QUPA 1F1DA 4BCZA 1EJ8A 3T5WA 1HL5A 2AQPA 2GBVA 4N3TA 1TO4A 2ZKWA 2GBTA 3L9YA 1SXCA 1YAIA 1OEZW 1TO5A 5KBLA 3QQDA 2AEOA 2ZKXA 1B4TA 1CB4A 3ECWA 3CE1A 4FF9A 2XJLA 2Z7YA 4L05A 1HL4A 1F1GA 2JLPA 2WWNA 3GZOA 3L9EA 4B3EA 3KBFA 3PU7A 1SDYA 2C9UA 1F18A 1EQWA 2Z7UA 2WZ6A 2JCWA 1FUNA 1KMGA 1L3NA 1MFMA 2C9VA 3ECUA 2APSA 1F1AA 1E9PA 1UXMA 3F7KA 4BCYA 3HOGA 2V0AA 5KBMA 2AQRA 3HFFA 1SOSA 1Z9PA 3LTVA 1SRDA 4A7GF 1BZOA 1B4LA 1JK9A 4OJAA 1N19A 1U3NA 1E9QA 4OH2A 4U4IA 3GTVA 3F7LA 2AQSA 2WYTA 3H2PA 1PTZA 1E9OA 1IBFA 3MKGA 1AZVA 1JCVA 1UXLA 1COBA 2WKOF 1IB5A 1OALA 1E9PB 3SODB 1DO5A 3GTTA 3KH4A 5KBKA 2Z7WA 3KH3A 2WZ0A 1YSOA 2LU5A 4BD4A 4A7QA 1N18A 2NNXA 3GZQA 1DSWA 3QQDB 3CQPA 3GZPA 4A7TA 3GQFA 1ESOA 1PZSA 4A7UA 2WYZA 1OZTG
chains in the Genus database with same CATH superfamily
1SYVB 1RZPA 4YX2H 1KIUB 5AVXB 5EBLB 2YIHA 1R3LA 3L4CA 1NIEA 3BAEL 4OF6A 3QXDA 3KBEA 1MFNA 5D6DC 4GP8B 1J8SA 4Q74A 3NPSB 3DV4B 4WKXA 1QEWB 4LCWD 4XBEH 4PTTB 5I1IL 2AERT 2MNWA 2Y3NA 5DD3L 4O00A 4B9ZA 1QRNE 1DJHA 3HG5A 1DBAH 4HIEB 3EJQA 4QHUB 2DQUL 4OF0A 1CLZH 1BQHA 4K71C 1BIIB 3QPQC 1UJ3A 4OV6F 3GLZA 3GXUB 2IPKA 3ERXA 3L3KB 4DNLA 4W9KC 5C3IA 1NC2B 5C0AB 4CVZB 3HI5L 4NQTA 4QRFA 4DP5X 2JIXB 4MGXA 2Q5BA 1QHQA 3BCDA 1AAJA 1QSFA 2JKLA 3BEVA 2DBLH 1SJHB 1RIHL 4WW2C 4XPHH 5HHOD 4IGBB 4Y4HB 5ACMA 3Q1SL 1PLAA 4GBXD 3K0WA 4R7XA 4WEBL 1G9EA 1I9IH 3S35L 3K6DA 5F1SA 4A2DA 1INEL 2XV3A 2W91A 1SXCA 3CZUB 1OEZW 2VMDA 4PRDB 2EO1A 5C0AE 1DE4B 3D85A 4GB9A 1H8NA 2E4TA 1P4BH 5EULV 2VDKB 4G7QB 5TPWL 4PR5A 3HR5B 5I2IA 2WY3B 3L3GB 1F4AA 4Y8AA 4GKNB 4NUMA 3QEQA 1FG9C 3QNZB 1JRHH 3HEIB 2AJZB 3HG1B 2FWOB 4JQXA 1MDAA 4IRJC 4LEBA 4P5SA 3CH1B 4RGMB 4WGKA 4WY7L 3LKQB 4OFVA 4ZNEA 3PWVA 4FQXC 3T2NL 3BGFB 1Z6JT 4F1ZA 4H44C 4HWUA 3MVSA 1ZJAA 3BVNA 3NACL 4LZKA 1MCRA 3QEHB 1WAAA 3V0HA 2ZYIA 4FL4C 5FGBC 1E9QA 2QADB 4LT7A 3V0WL 5E70A 3FQNB 2X9XA 3LZOA 5IQLA 5KYWA 4WU5B 3HG1E 1JZEA 2FJFA 2B1AH 5EZIL 3RWGB 2QZQA 1V55B 4PJBB 3UPRB 1TKWB 2HTKD 1IL1B 4QO1B 3RFZB 5AUMA 2AJXL 4NP9A 3F7QA 2EUVA 3L9BA 1RMFH 4RMSA 1TZGL 5C07A 3A3YB 4DZ8B 2O6EA 1YY9C 3P3UA 4R4BB 3Q2VA 4JAMA 5CJ8A 4NRXA 4OLXH 7CGTA 3WN6A 3Q01A 3Q05A 4ZQKB 4YC2B 3GMPB 1JYWA 2R1YA 3VFUB 4ZUTA 1N4XH 4PJBE 2D03H 3D39D 4DSYA 5B7MA 4MZIA 5GHWL 1DVFC 2EO9A 4XPGL 1HKFA 2X2IA 3T0EA 3VXSA 1XR9B 4XAWL 2VDML 1S8DB 3CDGA 3U6RA 1XGZA 2FQEA 3H55A 4ZO6A 5LAXA 4M1CD 4GAFB 1YDPA 1MCLA 4QHKI 4Y4FC 5AZEH 3CMOH 3RX8A 1I1AD 1X5IA 4KKCD 2JELL 3MV9A 1CQKA 1HEJC 3D08A 4P23D 3KWTA 3U48A 2C3GA 5EO0B 1WVZA 1KV3A 4H4NA 2PN5A 4DW2H 2ZAGA 5LAPA 2B4CH 1ORSB 3JTSA 4HUKB 3C09B 1H15A 4W68A 4KJWD 4QRTB 1KJ2B 2K0RA 2AMUA 3C75A 3BUQA 5ICYB 4OD2A 1GAFL 3U4BH 2PCFA 1ZT1B 2YKKA 4N0CC 4NENB 2IMMA 3MRGA 3BWUC 4N0YH 4MCZA 1EERB 1U9KA 4E9VA 5FK9A 4HJJL 1B0WA 4YO0B 2P5EB 1QUNA 1OF2B 3K6FA 4AMWA 1HHJA 1KOAA 4GIPD 2CJUL 2XG5A 4BQ6A 1KB5L 4R4FH 4TVSa 4G6JH 5I6XC 4I5BB 4HX1A 1NINA 1OAUL 2F7QA 5JOPD 3B5HA 2ZCKL 3GUTA 2CALA 2MHAB 4D0BB 3B9EA 1D3CA 4KGJA 3SYOA 4RMUA 1A6VH 1MJJB 4ZUVB 5T3XL 3RI5F 5JXAL 1YC7A 3MNZA 1UD5A 3L4TA 1UM5L 2P5EE 3GSOA 1GGYA 1DP0A 1OAQL 3QH3B 4JFFA 2ETWA 2GJ6B 2XWDA 4F33B 3EYUH 4YHMH 3EJJX 5HDLA 1HZHH 3KAAA 4A7GF 2XN9D 4MQXD 4BFIB 4HKJB 1A9VA 4HBCL 4XPBL 1KIPB 2JNZA 2GYSA 3LXUX 3NCMA 4KTEL 4DK6A 3BZEA 3BPLB 2HYMA 1ACCA 1UXLA 2EIDA 3MUUA 2WO2B 1W9XA 2WLJA 4QOKB 4U0RC 4X5LA 3S7GA 4Y88A 3SO5A 2HSIA 2A74C 4A6YL 4K3JH 5IFJB 2MPAH 4PGCA 3G5WA 3TBSB 1H9DA 3IJYA 4Z3EA 4I4WB 2P48B 4G42B 2BWIA 4BKLB 1URLA 4KO9A 1DQQB 3IJ8A 2HJFA 3WXWL 3UABA 1QHPA 2JB6A 2Q7YA 2DEWX 2V9RA 1I3GH 1MY5A 5F96H 4CC4C 1FORH 4L4TD 3WMPA 3MRQA 4X80H 4X6BB 3K72B 4DUVA 2MOQA 2OAAA 2LU3A 1ETA1 1FVEB 2CLVB 2H1XA 4OZHA 1JHLL 2JI3A 2NW2B 4M5YL 3QIBC 3L6FA 2J1YA 1EBPA 4S1DD 4JRLA 1L7TH 3KPTA 4J3OG 4F24A 1BPVA 4N5EC 1OP4A 1ZGLB 3DRQA 3BHBB 1QQDA 3K91A 3N43B 1BXXA 1FQ9C 5DD0L 3GMMB 4IM8A 3US9A 4XOAA 2WC7A 4YSCA 2E47A 1SF3A 5ACLA 2VXVL 4X6CE 4ZS6C 4FTVA 2NY2B 1G7LA 4P9HH 3RWFB 1NKOA 5HI5C 2XN1A 4XMZA 3SPJA 3VD4A 2CIIA 1MRDL 5E6YA 3VXNB 5C0CD 4QHLA 4LRNL 2YQ2A 4O5LL 5DSCB 1TTAA 1XIWA 2FT7A 3VFOA 5JPMB 3NJLA 4EUPB 3SPCA 1DJGA 3RL1B 3MBWA 4DUWA 3UTSB 4I3RH 4OV5A 5KAQG 2GC4C 4PRBA 5HDRA 3WUWG 2W95A 3KPLA 3CFQA 1E8XA 3TX4A 3ZDWA 2AEQH 4DAGL 3TT3H 2KLSA 1MFVA 2NQCA 4OR1A 4G80B 4BQ8A 3WDHA 5GSVB 4L5FL 1K8DB 4D9LL 1WFNA 5GGQL 3CZFA 1EQWA 4WK4B 4BUGA 3V6FA 1AJ7L 5CN3A 5GS0D 2BHZA 2YEZA 2ZOKB 1ZDQA 3H9HB 2CO2A 3SKJH 3HOGA 3UTSE 3DA0A 5MENA 1E2WA 5LJYH 3BUIA 1S7UA 3RIFK 1B9ZA 1Y18B 4UTCA 4LU5H 3D69A 3O2WH 2ID5A 4JB9H 2O93L 3TBBA 4JRXB 1MIMH 2NXYD 2PWFA 4V11A 5DK0B 3BESR 4XWOC 3SGDI 2WBKA 2Z93A 1KDJA 1JPFB 4GRWH 3ML8A 4IEFA 4GOSA 1U6AH 5BPPA 4I13B 3BT0A 1PLBA 3RNQA 3P0YL 4BUQA 3HZKB 1FL6B 2I5YH 1LYQA 2VC2H 3FZUD 3EOTL 1N18A 1FO0H 4IRZL 4JCMA 1HILA 4LSQL 2G9HB 1PLGL 4H0LC 2AJ3B 1KTLA 4UQ2B 5DDHA 4JRXE 2F5BL 1I8KA 1TQCC 4E41D 4I77L 3DUUA 3IGAA 2Y7LA 2ZWYA 3MJ9H 1XMWA 2B16A 4JGUA 3FJTA 4G8FB 4HKBB 2VLKB 1QI5A 4LCYA 1OB1B 1PKOA 3U0WH 2VW7A 4O58L 1I8AA 4XNQA 2E9GA 3H2QA 3ILQD 3FCSA 3QEUB 3ZRSA 1BVNT 4J1UA 2LW3A 3TXAA 3LV3A 5BS0E 2ZIDA 3F8UB 2IAMD 3MV7D 3VI4B 4JPVL 2VLKE 3ARZA 1D2PA 2DZEA 3TN0C 5KW9L 3HA0A 4K3DL 3R0NA 4D94A 1JPGB 1RK1B 3ESMA 3RKDC 1A3RL 3NK3A 5GZOD 2X1XR 5B39B 3STLA 1F8TH 4LBEA 2OI9C 5DQDH 3PV7A 2GUOB 3V4PL 2OZ4L 3JUZA 3BKYH 4FYSA 2CR0A 3A24A 5TD4A 1UKTA 4OD1L 1MJ8L 1G7IA 3ZTEA 3MLRH 3RTQA 5GRVK 1CLYL 1A22B 4DESA 4N8VB 4R5VA 2AKRA 2HVKA 4OIIL 1RZKL 1X7TA 5FYLH 2LAGB 2R8SL 2MH4A 1IT9L 5EOQL 4PCSA 5FYKD 3T77A 5EFIB 5DR5H 4A2HA 5FDWB 5K9KB 1FL5A 4TSCL 4K5PA 5FPIA 5D7LB 4OZFA 4TNVK 5CP3H 2WXRA 1QFWI 2APSA 2JKRM 4KZCA 5ICXA 4MB1A 4H1LB 1XV8A 2BOCA 5FW7A 2W9LA 4RA3A 4PS8A 1JYVA 1AQDB 1T83A 3ZT7A 5BNXD 1DO6A 2BSRB 4R3SA 1AYRA 3LQAH 5INCB 3MRLA 2UY6A 5C08A 4XVTH 3HJ0A 4KI5D 3SEPA 1J9CT 4QHMB 4HP5A 4JZOA 4Y2NA 1IBFA 2I07B 2V7HB 2HWZH 1AZVA 3OC8A 3EYOB 4OGZA 1DQLH 3QUML 5D7LE 3ZDZF 1G7HB 3ZDYB 2K7PA 5G55A 4X5WB 3LEYL 1DO5A 5TE7L 4L8CA 4KUZH 4MZ2A 3WKQA 4BFEA 2E3VA 5DEGA 1X5LA 1BQHG 3INOA 1DL7L 3UO1H 2P80A 4Y16B 5AOJA 1AGDA 2H6UA 4NWUH 3DXAD 3L95A 3ZMNA 4K23H 3NZSA 1BX2B 1OP3H 5I28A 3N85L 5CCHE 4X6EA 3Q6GL 4NI6A 3VVWA 3ZDYE 5JDSA 3SZ6A 2ATKB 4XH2A 1J8RA 2Y9RT 3B1TA 4BINA 5EPMB 4HVBA 2OXGA 4TOYL 2QQKL 2VUYA 3SY6A 3GKZA 2EDFA 1A1OB 3K3QA 5CBAA 3N04A 4ENZA 1RZGA 2WOYA 2JJTC 4JW3A 4S1SH 4Z3GA 4GW1A 5ABAA 2J43A 3FCTB 1TNMA 2O5ZH 3SQBB 2EECA 3MMEA 4MRCA 3BXNB 4N86A 4L9LC 2OW6A 5ILTL 1O7DE 3VRJB 2OLDA 4ZSOA 4ERSL 5CO1A 5F6IB 1VFBB 5IQNA 1MAMH 5IESH 4WFHD 1BEYL 1M2OA 2R0KL 2CJSA 5JOFA 1YUHB 3UPCA 2MOVA 2VGLM 5GGTL 3U7YL 4HUUB 1RERA 3HE6B 3TBYB 4BCZA 3H42L 5E8NB 5A43C 5J57B 1WHPA 1HL5A 4HWZB 3CLWA 5E5MB 3N0AA 4FFYH 4X0NA 4AIZA 2BS71 2FH8A 4L3EA 2ZPKL 3WXVH 3RWJB 2OR9L 2AK1L 5I6KA 2E75C 4CL7A 4N8UA 3KG5A 5HHVH 5KSBB 2BVPA 4ANKA 1GJWA 4X99A 3ULUH 2AEOA 1YECL 2VISA 3V0IA 2ZKXA 4AC2A 4NZDA 2UYLA 3SGJA 4TNFA 3RDTB 1IGFH 3ZLQC 1MCWM 4FMVA 5ENWA 1EEQA 2DKUA 1IGCH 1GJUA 1MQKH 4WSKA 4OCNC 3T0AA 1DEEB 2YOCA 2E8ZA 3PQYD 4D0DA 5BOPA 4GO8A 1U8PA 2BNUA 1JNJA 5C6PB 2FWLB 1S9WA 4URKA 4JR9H 3RP1A 4YBQD 2AQRA 4AM0Q 3I75B 5I1KL 4PAZA 3HG4A 3EBAA 4KQ0A 2CGRH 5HPMA 4KRPB 2OMXA 3RAJL 2WAHA 5MI0B 3OPZH 5D1ZA 5IVXA 3FQ4A 2OJZH 4N2IA 1M7DA 1ZEAL 1WFMA 2H26A 1FZMA 1IC4H 1KPRB 2HVBA 4XCYB 5CR8A 5E2TH 3LSOA 2XQYK 1QOKA 5E4IA 3GI9H 1KYOK 1FFOB 5EUKA 2EXSA 3GSNL 4EPSA 1LE5B 4OFQA 2X09A 3KNBB 1UB5A 4XBPB 3K6SB 2Y6SC 3WD5L 2H3KA 1SEBA 4G7SB 3EO9L 3KL3A 3QQ9C 4Y4HC 3UC0L 1MJUL 1ROCA 4M03A 4B60A 1AFVL 5C9KA 4YDVA 3SPVB 4H20L 2ZICA 4FFZH 3HKFA 2XWZA 5A16A 2GFBA 5C0BD 4MCYA 1H3GA 3L3OC 2W0KA 4OFYA 4XVJH 4WSGA 4FZ8L 3RA7L 3P4MB 3KM1A 4OJYA 4OLWL 1JPTH 2Z92B 2SODB 3LNIA 5E6IC 1ZS8A 2E9BA 3DTDA 1FE8L 2WZAA 2F54B 1HVXA 5J89A 1C5CL 1HZKA 2GY7B 3IFLL 4QHNA 5DEFA 3PWPD 3Q5OA 4LCUA 3MBEB 4KX7A 5GSRB 3INUL 3TGXA 1ZLWH 3RBGA 4EZJA 2LTQC 3QYNA 4AGNA 5T5NG 2JSFA 3HW7A 3VFVB 3WENA 2HRGA 2Z3FA 5B1JA 3DO7A 4F8TA 5KSUB 2DH2A 1IFRA 2Q7AA 2QADC 1VKXA 3TVMB 2QSVA 4PRPD 1MHHB 3MXWH 4ZTEA 5I24A 2XG4A 1YAIA 2GJZB 4Z7QE 1SLVA 4KO5A 4QWWD 5TDOB 2AJUH 1P5UA 2WJ5A 3GMOB 5EZOH 2Q87A 3RFZC 1MRCL 3UIYA 3APNA 3ZZQA 4HG4J 3VWKB 1MCPH 3HPJA 4IHOB 4NKMB 1BOYA 1E5ZA 4KTDL 3DUSA 1IM3B 4EO5A 2H7WA 5LNDA 4ACTA 12E8L 1CFVH 1IAII 4G8GD 1M05A 2D2OA 3D2UB 3T1FB 1J7VR 5D70L 4YC2C 4XB8A 1X5YA 3L9RA 1LDPH 4DPBX 4XC3L 4JN2A 4HQQL 4D9RE 3RVTC 3W9DA 3BP6B 4CBZA 2QSCH 5EA0L 1KDIA 1WWCA 2NT1A 3ETBF 4PJ8D 3UGXA 5JORB 3LS5L 4HC1H 2D8KA 1AO7E 4OI9A 3ZX1A 5FCSH 3CLFH 1B0IA 5JYLA 2N7SA 3GB7A 1XZ0A 3O2DH 5GS3A 1CFBA 2H2SD 1ADQA 3FU8A 1JI1A 1DUZA 4H25A 1EA9C 1JV2B 3BKJL 4YHPB 1R24A 1UUNA 2BP8A 4HKZA 3O8XC 4XO5A 1A02N 2HH0L 3IETB 3C09C 1DQML 4R5TA 3EHBC 2FEDC 5J13C 4FDWA 2COVD 5A3ID 1W0VA 3QQDB 3VXUB 2WLZA 3O3BA 2MNJB 2Y22A 1NGXA 2OX5B 5I0XA 1MHPH 3HUJF 1B2WL 2UZPA 1MN4A 4U3CA 5F7AA 1M57B 4FQ1H 1EHAA 4FN0A 3GIVA 1JGLH 1I85A 1ACYH 4MD4B 1EDHA 4LL9A 4IU2A 4Y5YA 1UFGA 3T3PF 2BY3A 3KR3H 3IFOB 3MRFA 4KH9A 1FH2A 3U2JA 3QUYB 4P57B 5C6TH 3VXUE 5E2WH 2X3CA 3HI1B 2Z4TA 5C9JB 3FC8A 1V7MH 2NY0D 5DFVD 1J1PH 6PCYA 4ZX5A 5JA9A 1KENL 2HB0A 2NY6C 5IT2H 2GBUA 1VACA 2VDPL 3R1GL 1QPKA 3KGTA 4GQQA 3MCLL 2ITFA 3UEQA 1Z5LA 4D7BA 4YXKL 2QGEA 5B7EA 3VXMD 5CN1A 5JLZA 2Z8VC 3FW6A 1C12A 3OKDB 3QYMA 2E6QA 1T66C 3K4ZA 4PBWD 3NABL 3ROLB 3IN0A 3SKNA 4LSDA 5T3ZE 3W0WB 4F2MA 1QBBA 4D9QD 2F1AA 2VLJE 5IR1A 5FM4A 3BPLC 4M48H 5DFAA 3FTZA 1USQA 2H32B 1M9WA 2WMPA 3ISWA 4ESKA 1G9MC 3VQLA 4AVJA 1AQHA 4PJAF 1LGVA 4PRAB 2OK0L 3OKLB 3IXAB 2D4DA 3RUGB 1QTSA 4OTXH 1Q0YL 2YSTA 1U2YA 3KHOA 4JO8A 3D50A 3PWJA 4PJCB 3TYFB 1PZAA 3W0WE 4PJHB 5IB2A 4ELKB 2OTWA 3KW7A 2DQEH 4P2AA 1TZAA 3QCUH 5IW1B 4FFVC 2NSMA 3NH7H 1FV1B 3FPXA 4CVWA 2CNZA 3B6SA 3HZMB 5K1NA 4U3SB 2X88A 4IRJD 1PF3A 5FR3A 2PR4H 1CGSL 3KYOA 5C2BL 4OJAA 2FUQA 4NNXB 3ZTCC 2GAZB 2MCG1 3RUGE 4QNPE 5LQBH 1MVYA 3CFDB 3PDGA 5SV4A 3ZYZA 4JFED 4AENB 3AMLA 5ACZB 1XH3B 4L3FA 4PJCE 5D7SH 2P7TB 4PJHE 4KXBA 5G5DB 4I3SH 4WEEA 4AH2A 4PJ8A 5GGUB 2EDHA 4UMSA 1HWWA 5D4JA 2XWJB 1Z5YD 2TSAA 4LSRL 1ZOXA 3DBXA 1R3IL 5K9QG 3AREA 5LGHH 4YSEA 3RGVD 4LSPL 3ZQXA 4IRSA 4X7EC 5GRXG 1INQA 2HKHL 1U95A 3VM5A 1I1YA 3HNTH 4CKVX 4JUTA 4WJKB 2VJXA 1XGPA 1T1WA 5CIPA 3W1ZA 2JB5H 1ZANH 1YY9D 3ULAB 2PTTB 3CXHJ 4CGTA 2WO4A 3FO2A 4PLJC 2BSTA 4MJIA 2QQNL 4TKWA 2GQHA 2ZCHH 4L48A 1UA3A 1NKRA 5C86A 4QRRE 3QUZC 4YSTA 1P1ZA 1UD3A 2BZDA 1DVFD 1LO2H 4MD5B 5SWZA 2NYYC 4P2RB 4GXUN 3EIFA 1HOEA 4PPTA 5F88B 3TNNB 4HMEA 4PP2B 1T1XB 3KPSA 1MEXH 2J2ZA 2YPLD 3KVQA 3KPRB 1E40A 3O4LA 3FFCA 5D7JB 3WELA 4AUUA 3C8KB 5JIPA 3BWAA 3EKCA 1TTGA 3MXVL 1P4LA 5FFOA 4JO2L 4ZUSB 1TETL 4LGRB 2WVTA 4IIQB 1TCRA 1SEQH 4DP8X 2YFNA 4JM4H 5GGSA 3HB3C 3MRDB 1RK7A 3R7RA 3AQYA 1CXFA 1KN4L 1YEGH 1NCBL 1V3KA 3UZVA 4UQBA 4P2RE 1C5BH 4U1NB 1YPZF 1TJIL 3ULVH 4M6AA 3REVB 4BFOA 4K8RC 1FCCA 3KPRE 3NFSL 2B08A 5D2NB 5I19H 3UG4A 2WP3T 3ZHLA 4WFFE 3X11B 2BSBA 3T08A 1MCOL 3RIKA 1DN2A 2C3XA 2FJGA 3VFNA 3CCHA 1I82A 4X7TB 3BLBA 4LCVA 3ZKSD 2AV1B 2IVFC 3KL0A 4R7DB 3U30B 4WW2A 2HX7A 2AXJA 3BAEH 3DLQR 4ZK8A 3NFPA 3C08H 4MMZB 1MFAL 4PJFF 1JFHA 3DV6B 5D2NE 5I5IA 3BZ4A 3F05A 3FUMA 2BVQA 3GXFA 4Z95L 5I1IH 1YLBB 1JGUL 2FR4B 4ZD3L 3MJGX 2DQUH 4TVPL 1HTYA 4CGUB 4B3VA 3OJMB 4ZPTB 4OJCA 4UILL 3HI5H 3DJSA 4L3CB 5HGAA 3SE8L 5LGKA 1XGUB 4CADA 2G5RA 4XPTH 1SY6A 1MXGA 1QVOB 1SOXA 4FQXA 5IMLA 4J39A 3TPKA 1RIHH 1J5IA 4L8BA 3DWTA 4RDBA 2XNAA 3NT0A 4WEBH 4YSRA 1OCCB 3S35H 4R26L 1INEH 3MZGB 5M95B 3AW5A 2X10A 5C0JA 1ED3A 5FGBA 1PY9A 5FF6A 2WYIA 3MV01 2DD8L 1B0GB 5FGRA 1KG0A 2P8LA 2IPTL 3DOIA 3D07A 5TPWH 3L7FA 8PAZA 3B2XA 1T80A 1VFMA 1WS8A 2WCPA 2ATAA 3WGVB 5HHPA 1HCFX 2DYSB 5K33A 1HI6B 2EDOA 1LP9B 3WNKA 1GY2A 4R96B 1P69B 4WUUB 1S5HB 3QQ3A 3SYPA 5E03A 3DOSB 1G4MA 2H0PA 5BQ7B 5LBGA 2K70A 4WY7H 4H8PA 3ZUNC 3LPPA 3T2NH 5GGSY 3V2AR 1F6AA 2X7LA 3DIFB 2E7HA 3EBIA 3QIUC 3VI3F 3FQRA 3MQIA 1P53A 2X4QB 4NKIH 5HYJA 1SOKA 3B7SA 3NACH 1TJHH 2K6WA 2KLRA 1K3ZA 2E5EA 3CVHB 1LP9E 4I48A 4WUUE 3IJEA 2WVVA 2FVNA 3GK8L 3A0OA 3QIBD 3T4YA 4HOZA 1T5WA 2NR6C 4R5XA 5IHZB 5EZIH 4N5ED 4Y4FA 1WQVT 3G7TA 2AJXH 2RHEA 4HFUL 3CK0L 1I7TB 3C60B 1NFDA 3GJFA 3UTTD 2CKBL 1E27A 1K6QH 1TZGH 5E6UB 1ZLVH 4IK6A 4JREC 4ZMPA 1RH8A 1QFOA 3MYJA 1TO4A 1ZXQA 1IU1A 3VVVA 5HI5D 3Q2NA 2Y7NA 2WBXA 1AGBA 1HHHB 3QR2A 3FSOA 4MQ7B 5DF0A 2FBJH 3EG9A 1XF5A 5DEJA 3G5XA 4ZOBA 5GHWH 4XPGH 4LOEA 2JKTM 3U6XS 4QAMB 1JDAA 1F97A 4PGJA 4PM1A 3HLAB 4IOIA 3T65A 4MBRA 3JV6B 1QKZL 4XE0A 1JD9A 3IM1A 3N41B 2JELH 3QZMA 1O7DC 4OIFA 3BUBA 1XBRA 4JCWA 3W5MA 2Y5TB 4Y1AD 3WNMA 3FTUA 1WBYB 4RMVA 2H2PD 3V5KB 3I6GB 4NCC2 3ZR5A 4FA8A 3B7TA 3UJIL 5EV7A 2BM3A 3S8GB 2EE0A 2IDSA 2OL3A 4HV8B 1GAFH 2A38A 3F58L 4LEXL 5HBBA 5FUZL 1A8JH 5IVZB 2JCCB 1ZTXL 1LM8V 4XN1A 3GRBA 2IDTA 5F0LB 2JQZA 3KYNA 1KXQE 4PRID 2FD6H 5CLTA 5F6IC 3WE6A 4HJJH 4N9OB 3QXTA 4N9GA 4XWOD 1BFTA 1IM9B 4NQEE 4B95C 3NVQA 1GOGA 4G9FD 4LLWB 4ZPVA 2ADFL 1A65A 1U8KB 1XL6A 2ZAHA 4ATTA 2CJUH 3N3EA 3HE6C 4DZBA 1KB5H 3NCFB 2R2BA 5DEZA 1OAUH 5H4ZA 2ZCKH 3EOBB 4QCIA 1XXDC 2JCCE 4AYID 3P69A 4E36A 2ZNXA 3U7AA 3KW8A 1MWAH 5CEYA 4NQUA 5T3XH 1EANA 1JVKA 3EW3B 1UM5H 1CVSC 3ARTA 1OAQH 3BZFB 5KG9B 1I3VA 3BQUD 1BMWA 3C2AL 5IJVA 2YGPA 2VMCA 4U6TA 2PABA 3CVIL 5JIKA 4X6DF 3IMWA 3ZIYA 1JZ4A 4KNUA 3D06A 2OP4L 4CC4A 43CAB 2KMWA 1OM3L 2YUVA 2EDNA 4IHBA 2A6DB 4KTEH 1WT5C 4V1DB 3MRIB 2KZWA 4F1SA 1XF2A 1NGYA 1TNNA 3ZO9A 4XNDA 1RK0B 3OHXB 1JHTA 1L4IA 2IH9A 2WCGA 2HN7B 3FFDB 1A1NB 2DWYA 3HZYB 4M3KB 4Y2OB 4A6YH 1JGIA 3S88L 4ZOEA 2V2TA 1AP2B 3TN0D 4HKXA 5IG7A 3V0GA 1RZFL 2V8LA 4QXTA 3BH9A 2Y7QB 4XCNA 3RKDD 3EFFA 2YA2A 4V1DE 4S2SA 1DANT 1XEUA 4YIQB 3U9UB 3WXWH 3ZTJH 4EN2A 5KZCB 1OD7A 3IRPX 2Q10A 1IC5L 1PZ5A 4PBXA 1DJIA 5CJ5A 3A6OA 1D9KD 4PWFA 2H1PH 4UT9H 4Z7VB 4AWJC 4ANXA 5EUOA 4Z76A 3LN5B 1FFTB 1FNAA 3GHEH 2R2HB 2B39A 4U33A 1HWGB 4UDUB 5EU7E 4LLVB 4D8PA 1KBWA 3MN8A 4WHYH 5JUEL 1JHLH 1S3KL 2Z4QA 5IW6B 1GZHA 4M5YH 4XT1C 1LILA 1WF5A 1ERNA 1YYLL 1EEYB 1MLBB 2LFEA 5L4IA 2A3TA 3V0JA 3S3BB 2QVIA 4JFUA 1SOSA 2H6PB 3B2PA 1BFOA 2FHCA 2YPKB 4PFEA 1JP5A 5IMMA 4L2LA 4G9DA 4Z7VE 5DD0H 2F68X 2XXFA 5I1DB 2P26A 4KMLB 4UNVA 2VXVH 3SDXB 1KBVA 2IGFL 4ZJ9A 3GO1L 1M71A 4IBUA 4MAUL 2WGNB 4YFLF 1MRDH 1ZA3B 2FGWL 1SUHA 4LRNH 5L7XL 2I9TA 3KS0H 4O5LH 1H3PL 4ZYKB 5FYJL 5EU6E 2J3SA 4O2EB 4JGMA 3QJXA 4ODWA 2EE2A 3V0VA 3QXAB 5H94A 4A7QA 4MNGA 2QL1A 5DI8A 5ESAB 3MUJA 2PO6B 4G6AC 1MI5D 1G7QA 2YD3A 2DH3A 2NTFB 1IGIL 3SDXE 4NPJA 3GT6A 1BQLL 1T5XA 1OSZB 2WYZA 3PAUA 5TDPA 3TVMC 4DAGH 4YL9A 5KN5A 4G9FA 2BWDA 2BVEA 2FIKA 5D1QD 2KKQA 4PD4J 3DX1A 4JFHD 4L5FH 2AEIT 3AT8A 4D9LH 3ARDB 5HHXL 5BRZB 1Z66A 5GGQH 43C9A 4PWHA 5DYOB 2CAKA 4YHIA 2CJ3A 3VWKC 5LLIC 1RJYA 2B5IB 3QNXA 4J4PC 2W5PA 1NCNA 4XBMA 4PBDA 3TP4A 2RACA 4FQLL 5CXPA 2V7NA 3IT8D 2DIBA 4MTMA 4FI6A 1UXSB 5D1XB 3ASNB 1S7WB 1RU9H 1XH2A 5BRZE 4GAYA 1T0NA 2KBGA 4HUMB 3T0BA 1GXEA 2ZWKA 5ANME 4Y2DC 4KDTA 2K4WA 3BMWA 5F7YC 1KGYE 5DJ8A 4ZMLA 1HNYA 2WNWA 5DFTA 3F7VB 3FT2A 2YWYA 1LO5A 4RFEA 3P0YH 4U1SB 3T8XA 4M6NL 1QG3A 2P45B 4P3CL 3BP7A 4YDJB 3S8FB 5DUBB 4TXVB 4IRZH 4M6MH 3SPGA 1PX4A 4LSQH 5D1XE 4M00A 4L37A 1FLTX 1ZT7B 2ADIB 3DGCR 1S6NA 1PLGH 4N0FA 4Y19A 2Q6WB 3IDJA 4KY2A 2F5BH 1A7QL 3PAZA 2YD6A 2X4UA 3WY1A 4AQEB 3L5JA 2VIRA 3E1ZA 1YEIH 5DRXA 1YMMA 1UVQB 3PP3H 4AV5A 3KYKL 1A6AA 1I8MB 3QRGL 4X42A 2NYKA 4YZWA 1YJDC 2GK2A 4P3DB 3EJTA 4WWKB 4WGWB 5K9OA 3ELAT 4O58H 3HMWL 3WHE0 4M5ZL 1MVUB 1QRND 2VSMB 2GIXA 1LO3L 3SD5A 1G0XA 1FRGL 4M62L 2XWEA 1J9SA 1JXJA 4AYFB 3V55A 2QFPA 2N56A 3GXTA 3GLDA 4NO2A 1NCHA 3CG8A 3MJ7A 3CFBA 2NZ9C 4JPVH 1W16A 2H3NB 5FLVA 5KW9H 1GMIA 2D7OA 2HUHA 3DPBA 4LARL 1F41A 3FOMB 4EZLA 3ZDZB 1J86A 1MHEB 1O5DT 2C5DC 1L5GA 3W5NA 4L3AA 1TJXA 4MKTA 4XNUL 3LMJH 3UAEA 4G8EB 4HBQA 1BVZA 3V4PH 2CMRH 3O3DA 2OZ4H 3PIQB 3US1A 4ETQB 1THCA 1IC7L 1VIWA 3APDA 4NDMA 4OD1H 3ZYOA 2XVBA 1NC2D 5C0AD 2YGOA 1CLYH 1KGIA 1A7PL 4AQ1A 1ET7A 2JIXD 1ZS2A 4OIIH 1RZKH 2R7EB 2LQRA 5IV2B 2OV0A 1HAUA 3ZSSA 4XPFL 4IGBD 4Y4HD 2R8SH 1IT9H 3C12A 1OSYA 5EOQH 4GG6F 3O9WC 2J8OA 1FJ1B 4UIMB 1H6FA 5E6ZA 4TSCH 2HXAA 1A9EB 5L4JA 3V95A 4FADA 3L3DA 4PVMA 4I0PC 2QJDA 3FQUB 4C58B 2NY3B 5DQ9B 1CG9A 4CVXB 3U0PA 4OZGF 1IC0A 4XAKE 3FK3A 4U1MA 3CUPA 3CFMA 4L23A 3PFUA 4WHTB 4PWKA 1MHCA 4XZUA 4DCQA 4XNMB 3LKSA 3VXPB 3AS3A 4JM2B 5JHDA 4UOQA 3VG9B 4UOW1 3HG1D 3TBCA 1V8HA 4XBGA 4GKZA 1N9PA 4NYLB 2NX5A 1EJOL 2JJTA 3HS0C 4PJIE 3LEYH 2V2WA 2GG1A 5TE7H 2NDGA 1J0KA 2V4LA 4HUNB 3GSVB 4Y0GA 1D7FA 4H26B 3GIZL 2Z31C 4ADJA 2C4FT 2J1XA 3GSRB 1U91B 2Y1AA 1CF8L 3Q8BA 2QADD 4O51A 4W6WB 3GJEB 2RBLA 1OE3A 2V5YA 4UT7L 3FYEB 4LKCB 1B4TA 4HEMA 4MA1C 1NCOA 2A7BA 3N85H 1CJYA 3OLGA 5CKAA 3Q6GH 4KNQA 2X6CA 5KVFH 2PYFB 2QBWA 4NN7C 2VSDA 4TOYH 2QQKH 1QTPA 4WV1B 3V0DA 4FJZA 3UH8A 2AW2A 5CUSL 4QRPB 1DDHB 1MIEL 4M29A 3RNKA 2FO1A 2Q8AL 3O81A 3VRIB 1HE7A 3EJSA 3IBEA 5HDOA 3RWHA 3ARWA 1CS6A 5DVPA 2OMVB 4HIJB 4PP1D 2ZUWA 3IDGA 1J0IA 2ZSWA 2DQJH 2XPYA 3VH8B 1QR1B 1CICC 5I1LB 5EO1B 5ILTH 3CFUA 1JK9A 1QSEA 4ERSH 3L1OL 2NNRA 2FNBA 1F02I 1F11A 4M7KL 3ZQ9A 3VGAB 3MOBL 1BEYH 3N40P 3P2TA 2VABA 4HSAC 4LKXB 5E0QA 4JO4L 1WC7B 5L8LB 4DJMA 4QRPE 2FAUA 4J3SA 5GGTH 3U7YH 1UQSA 3IMRA 1LEGA 3V8CA 3VGHA 3H42H 2JFCA 3NTCL 3X12A 3PREA 5IFHH 2WGXA 5IB1A 3KPNA 3D6GA 1JK8B 3DSNA 4XN2A 2O1AA 3MYZA 3RWIA 2ZPKH 3PCYA 4DP0X 4IIQC 1EVUA 2OR9H 1ZK5A 1DN0A 2QPDB 4NJ9H 1BP3B 2AK1H 3II3A 4NQDB 2ICWB 4BA8A 1BMGA 4J2QA 2D7MA 4BJLA 2XBTA 5EC1B 2XA8L 5DVNA 2WINA 4HF5L 4N90E 3G04B 1CIDA 1O0VA 3Q8AA 5E5RB 1U8OA 5E08L 2A1WL 4CNIA 1T04B 3SDAB 1X9RA 1HHIB 2P5WE 5C0AA 4YH6A 1ZXKA 4UQCA 4CVZA 2CDFB 4NQDE 2J1WA 1EGJA 4KOCA 2P5ED 3QBTB 3MGAA 5FCUL 4LPTA 4OAWB 4M5SA 4EIZC 1QO3B 5I1KH 1E7VA 4RMRA 4MMZC 5DZAA 1P0SE 2IH1A 4MSWA 1TQUA 5KVEL 4X98B 2Y07L 4FLSA 4KY1L 3QDGE 1OPOA 2Z34A 3AXLB 2YPVA 5JQ6L 3RAJH 3UJTL 2X9WA 3L3OA 3IB4A 3LDBB 1AH1A 4ALAH 2HG0A 1ZEAH 2E46A 4GRWB 4ZAKA 2BX5A 1AACA 2R1XB 3HR5A 5C97A 4XWGL 5E6IA 4YAQA 2FH6A 3BUTA 5GJSL 2GJ6D 4A04A 1UT2A 2VC2B 3QNZA 1A7OL 3GSNH 2V6HA 3JT2A 2BY0A 1FO0B 2CUIA 5DK2A 3VFMB 3LKQA 2XTSA 1L6PA 2CHNA 3EO9H 3HS9A 3UC0H 3UP1A 1MJUH 3CNKA 3TA3B 1TXKA 2VJ0A 1AFVH 4GP4B 2NZIA 4HIPA 4QXWA 2LV4A 2OMYB 1R3JB 3H3KA 1FIEA 4GRWE 3VQMA 5JW4M 4H20H 4AJWA 5D8JH 1HH6A 1VPOL 3CH8A 1V10A 1TJGL 2YA1A 4QOKD 3ILDA 4ACPA 3FO9B 4FZ8H 1NIAA 1I3RA 4KHTL 4LHUA 3OKOA 4XNYL 3RA7H 3SOTA 5MEOB 4BK5C 4OLWH 1U2CA 2L8AA 1AQMA 4FZEL 2X1QA 1AHKA 4OB5L 5I1HL 1D5BB 5L88L 3A22A 1FE8H 2K7QA 3TO4C 2B9AA 4LL1A 1C5CH 2OMNA 3EAKA 1TZHA 2X6AA 3NFNA 3IFLH 1OE2A 3TV3L 3NRFA 2OCCB 2VXUL 3INUH 3PABA 4WDIA 3WMQA 1CK0H 3TPUA 2KQMA 3LX9A 4WI6A 2G75B 2ESVB 4XO8A 3MCG1 1S9KC 3EO1A 1E4XL 4R90L 5CBEA 5F72S 1Q94A 4FFWC 4PV9B 5AOKA 4TLKA 3AMKA 4UV4L 1BVLB 2G4GA 1QFUL 4IKJA 1T22A 3BPNB 2X1PA 1YCSA 1II4E 3BVXA 3S96B 3SDDA 3W9EA 4PLOB 4HPYL 5T1LB 3OKEA 3RJOA 3P4NB 1U8NA 2EINB 1IUZA 3P0GB 3MLXL 4M02A 3C60C 2CLZB 3GQFA 1CQYA 2XKNB 2WVUA 1JI2A 5KANI 4U6HA 5HJ3B 1LJMA 3QK0A 3HUJB 4EE2A 2NY2D 1DZBA 4NM8H 4ONFL 3O8XA 12E8H 4GH7B 5IHWA 2DEYX 2A6JA 2X42A 2JK5A 4HPOL 5D70H 2M83A 1U3YA 4PLJD 1ONQB 3FXIC 3U36B 1KEGL 4XC3H 2OXHA 5IBLC 1BLIA 4HWEL 4NO5B 3ZGIA 1S5IL 3GNMH 2WTPA 3EDEA 1WO2A 4HQQH 3DVIA 3UTSD 3QIWC 1JF5A 4PCKA 3QDJB 4NCDA 5EA0H 3GMQB 2NYYD 4ETYA 5FYLE 3ZKQD 3RG1C 1OF2A 1VFAA 3CQQA 1JS4A 1M1XA 5E2UL 3NJGA 4G82A 1P4IL 1IVLA 4JQVA 2BOBB 4J6RL 1JGVL 1XH1A 5T1KB 1MH5B 3FHAA 3BKJH 5KSVB 3FRUA 4FYQA 1UCBL 3DROA 3O45A 1UWXK 5H8DA 3G6JB 3IKCA 1DQMH 3F6JA 3D4YA 3QDJE 3RILA 2HG5B 4YVNA 2APBA 5ID1A 3D2TA 4BBWA 4JFPB 2V9TA 1KT2A 3C6SB 4FOMA 3FN0L 4FS0A 2X87A 1QI3A 1BFVH 4U05A 3FT3A 4XC1L 4YHNA 1BXAA 1WDAA 3CZEA 2V17H 2X28A 3Q2CA 2PXYC 4NN6B 3KPQB 4LHJB 4JRXD 3ARGB 3M6DA 1O9VA 2D0FA 4IDLA 1KIPA 4OQTA 3E0GA 3JWOC 1S7TA 3G6JE 5C09B 3WEBA 3EH2A 3RURA 4F9PC 2HPTA 4BK4A 1KENH 3GXIA 4JHUA 1EHNA 2IDCA 1O9ZA 4A1RA 3DTXA 2VDPH 3R1GH 1AZBA 4JRYB 5DXWA 2ZSVA 2UXGA 1MOEA 3MCLH 3AGVA 2DS4A 2X44D 2G5BB 4QI3A 3WKYA 4OGAD 2PCPA 3BT2L 2EYRB 4YXKH 3SBQA 2DYPD 4KDVA 4WWID 1WJ3A 5C09E 5LKNA 2VLKD 5IQ7L 2X4RB 5BZZA 2VKWA 3ML9A 4B96A 1ZMYA 2A6IA 3OQRA 1M3IA 3NABH 1WIUA 2F9BT 3NESA 1S7XB 3H4FA 4XMWA 4JRYE 4X6CA 2XXMB 3CSBA 1BOGA 5I73B 2EO7A 1UZ8B 4HIXL 4TUJA 2OK0H 2IWGA 3E8UL 4I1PA 3D48R 3OD3A 4HAKA 3FOLA 4YZFF 2LLGA 4XNZB 4UNTA 4PGDA 1Q0YH 4F3FA 3KYMB 3BJLA 1NTDA 4E9RA 3SYCA 1C7SA 5BV7B 2HVJB 5DMKA 2HCZX 2IADB 1J0HA 2CBMA 7TAAA 1PEWA 3ULUE 1MCEA 2PWGA 2YAQA 1J05B 1WCQA 2Y0SA 3EJYC 1BECA 3V0AC 5E8PA 4FEMA 1CDGA 5B1AB 3FPYA 3P11L 4YPGA 2XX0A 3QUZA 4RGNB 1D6VH 4UIKL 2RIKA 1BBDL 4FD0A 1IGJB 3QO0B 2Q7NA 4ZMOA 2C3VA 2WXNA 1T89A 2ICCA 2NR6D 1ZCRA 3VXQA 2Q3ZA 4LSRH 1JHKL 3BWZA 5D7LD 5I0DA 1R3IH 5C0FB 2VCOA 2PYEB 4JE4B 4MJ6B 5ESQA 1ADQL 5BVPL 2R23A 4LSPH 3VD9A 2HKHH 5J0BA 2BP0A 4JG1L 1VGKA 1U8JA 3IPFA 3G08B 3K46A 4Z7WB 4NPYA 4RGNE 3ECWA 4KRLB 4B5ZA 3OZ9L 2AGJL 3MUGB 5LDUA 2VQUA 4NUPA 4KJQC 3P02A 3QW9A 4J3OH 2PNDA 4G8IA 4BM7A 4KROC 2PYEE 2CK2A 3LRSA 5C7XL 3LNHA 1QFWM 3MFFA 5JNYA 2E7DA 3QJFA 5IF0B 4OZ4B 1XD1A 3HE7C 4Y16D 4P8QA 1NCGA 4Z7WE 4F9LC 4IOSA 1J18A 1OD9A 1U93A 5DLMH 5AYUL 3S5LA 1J1XL 1QWHA 2PP7A 3EOYG 3ARQA 5ALCL 3WYRA 4JO2H 4E42B 4G71B 5AFAA 2VXTH 3QR0A 3ALPA 2Z91A 3SOBL 3PP4L 2B5IC 3P4OB 4PJAA 4Q2ZB 3NZ8B 2O30A 1MUJA 5JHLH 1KN4H 3CU1A 1AR1B 2F1EA 2GKIA 1NCBH 4TNEA 4G5ZL 2FRGP 3MLZL 4R8WL 1V7NL 3I6KB 5I6PA 4ELMB 5L4MA 3GKWH 5EN2A 4BFJA 1OVZA 3HHSB 4UQ3A 3NFSH 3OAYK 2DYPA 1H8OA 4DGVL 1SUJA 4HKBA 2G2NA 1MCOH 4ODVL 5L0QB 2VITB 4X0KB 5DUML 3ZE2F 4QDGA 3KEHA 2K3HA 3LVTA 1ETZB 4J5VA 3BN9C 2Z35A 2BO0A 4DOHB 4LLUB 2J88L 4ELME 2XKUA 3T6QC 3HE6D 1MFAH 2FECI 4G6KL 1K5NA 2FX9L 4GW5B 4Z95H 4OI7A 4U6YA 1M6OA 4NBZB 2CPUA 5A7BA 1JGUH 4ZD3H 1XO8A 3IRCA 4J8RB 5CHNA 3SQOH 4GO6B 1WG3A 3GSQB 4FLHA 4TVPH 1WD8A 4V2CB 4KK8C 5EBWA 2GSIA 1KUMA 4PGEA 4DOHE 1JVOA 4TQPA 3W82A 1OW0C 4UILH 5EIQA 4FNSA 4LAJH 1A64A 4WWKC 4H8WC 3RDTD 3SE8H 1F3JA 5E00B 1YAZA 1N3NB 2YQBA 2PW1A 2YSSA 5T1MB 3OJDA 4GY4A 4LLQB 3O6ML 5EZLB 2DLIA 1FNEA 1X7SA 1XAUA 2B4CC 3F7YA 3QIUA 4I18B 2R15A 4MWFB 4R26H 3P9LB 3PV6A 3VFPA 4P2OB 2D0GA 5JQHC 2Y24A 1G1YA 4WKZB 4EAEA 5I74B 4KKRA 2DD8H 5IBUB 5D7LA 5D6CB 2IPTH 4YPJA 4KRPD 4AVIA 1IARB 3CZNA 5CS7A 1UENA 2DOCA 2EICA 2NUTA 3BKML 2VUKA 4RZCA 3CAFA 3IGFA 1JZ7A 2BP3A 2FJHB 2BY2A 1SFDA 4NQSB 4UT6H 3FUJA 2V9QA 4P2QB 4DK3A 3F12B 2HLAB 2V7HA 1TYRA 1YPZA 4EJ1C 2ZOOA 1F3RB 1AGCA 4P46C 5AAWC 1ZV9A 7PCYA 1BZ7A 1E4WL 3U46B 1B4LA 2JKXA 4OM1L 3L81A 3GTVA 5JW4R 3PYCA 2NY3C 2WYTA 3V4VA 4P2QE 1EO8L 3DURA 3DX6A 1HXYB 3OF6D 4HFUH 5I82A 4PJ5E 5FB8A 1NC4A 2CKBH 3VD5A 1P84J 1VF5C 3BSZA 3DX0A 3NN8B 4HJGA 4PJFA 1T03L 3LIZA 5ICUA 3TTYA 5HHQB 1OLLA 1BQSA 3LNFA 4APQB 2F54D 2XETA 4JM2C 1X5XA 2VT0A 2H41A 4OJEH 3PWLA 2XZAL 1YEDB 3Q8EA 2WXPA 5CJQH 1I4FB 3C6LC 3E9UA 1A1OA 3MGTA 5E99L 2HX8A 4GAJH 1OLZA 3MBED 4NT6A 1NEPA 3MCKB 1BD2B 4QYAA 3IGUA 1PLCA 1GGUA 4NKOA 4Z3HA 4AQOA 3SQBA 3TBVB 4LVOB 1XTLA 4G6AD 1MZZA 3IU3B 3ZKXB 3FTYA 4WW1B 3CXDL 5IK3B 5JW5B 2BNRB 4LLAA 2BC4B 4ODXB 5D5MB 4ZW7A 3TVMD 1Y1UA 1QKZH 2K9UA 2VDLL 1KN2L 4TL4A 1CT8A 4L4JA 1BD2E 1AD9A 4I9XA 1G9NL 2UXFA 4KJPC 2EE6A 1CFTB 4FKEA 3AU1B 4D9RD 4A55A 4JY4A 4X6DB 3RWJA 2P8PA 3D4ZA 3VWKD 5KWYC 3FB5B 1O7VA 4B9IA 3B8YA 1Q0EA 4J4PD 3UJIH 2BNRE 3UBXA 1IM3D 3WNLA 4RETB 4AIEA 1FLRL 1SXNA 4GXVL 3ATDA 4LHUG 5D5ME 3F58H 1PDKA 2C1OA 3HFMH 4H88H 4HUWA 4LEXH 3D2UD 5FUZH 1ZTXH 8FABB 3ZE0B 1HS6A 1QNZL 2EJ1A 1Z9SA 5F9OL 3ATFA 3MACL 1JOIA 2M1KA 3VGAC 5F6HJ 4LIQL 3O11B 2GHWB 4XXWC 4P9HC 1ULVA 1HE8A 2ADFH 3VI3A 2X5PA 1WT5A 1GY1A 2D7QA 4P4KA 4DWHA 2CJTA 5HGHA 2IG2L 2E7MA 2VAAB 1T4KB 3QUXB 3ALWA 1PIFA 3ZE0E 2DQ6A 2L7QA 3HR6A 2FO4B 2CR6A 4Y9FA 1JJUA 3T2OA 3BOVA 3WAJA 5B3JE 1SBBA 1T1ZB 2KPNA 2D31B 3E6FB 3L9EA 2J56A 4HK0A 4MJ5B 1OHZA 4JDTL 4V2BA 3WIHA 1Q9KA 3C2AH 3D3VB 4G1EB 4Q89A 3ZT6A 5KYYA 3VXUD 3T1WA 5IK3A 2WBWB 1P2CB 1N70A 2XVLA 3AT0A 2RJMA 4LK4A 4C83A 2OP4H 2NY5L 4EI5B 3FQTB 1OM3H 4AKPA 5E2VL 3M17B 1RUAL 1TSRA 3QJUB 4LSVL 2B2XH 1FGNL 1S46A 2EEFA 1R1CA 4IK7A 4XVUD 3Q3GB 3LKRB 4XB3A 2DKMA 4GKLA 4ZDHA 1XX9C 4XNXH 4XMXA 4KZEL 4MX7A 2CM6A 2D4FA 3QUYD 4E9YA 3O3AB 3NSYA 3S88H 2NZ9D 2Q8BL 3LDBC 1RULL 3NZUA 4UQ9A 1RZFH 1EHXA 4K5MA 3LQMA 1ZLUH 5T3ZD 1CDBA 2A73A 3L5WB 2Z92A 3CPUA 3FT0A 3NJIA 2GSMB 4Q6IB 4MHHI 4B97A 5AD0B 1FZKB 1IC5H 4YXLL 4PB9L 4Q52A 3WI9A 1SJXA 4W9IC 3ULVE 2IBBA 3MRJB 4DVRL 3VSUA 1YEKL 7FABL 1BAGA 5H35B 1MW1A 2Q86A 3EDDA 4A7VA 3F00A 1YZZA 1JFQL 3O6KL 1FDLL 2GITA 2RQ8A 3VA2C 3PNWA 4N5UA 1EEZB 1P1VA 1MFCH 1S3KH 3W0WD 3HC0B 3LRKA 4AGQA 1OOAA 1YYLH 3DVGB 1PCXA 5F93C 4LFHG 1HHKA 1AD0B 3U9PL 1EAPB 3TVMA 5JW4Q 1RUQH 1IKNC 2I27N 1TVHA 4HLZG 2BNQB 5IROD 2OR8A 5GZND 3D9AH 3MRMB 2VQ1B 4XN5A 2XRAL 4YFDB 3GMOA 5KAQF 1FFPB 3DO3A 5H2BB 3T71A 4PJ7A 2CSPA 4MAUH 4NKMA 4WO4C 3SYQA 2FGWH 4KHXL 1H3PH 2E6JA 1IM3A 2CHXA 1AO7A 5FYJH 3TJPA 2YOAA 2H6OA 4OGQC 5CSBA 5EEYA 4HISA 3LYRA 3P9MB 3SGEH 2KHAA 3PGCB 4M1GH 1EZVX 5LXGL 5DD6B 3GSXA 3GMLB 3HBPA 1IGIH 5K69A 1T1YA 1BQLH 4Z5RB 4ZX4A 2C7UB 3A21A 3LRLA 4YXHL 1I1RA 2L4OA 4Y2DA 5LBVA 4MA7L 1D5XB 2BDNH 3GGWA 2I9LB 3BP6A 1JCKA 1AOHA 2X6MA 3TO2B 3BPNC 1NBQA 2XWCA 5JORA 4G83A 1CL7L 5HHXH 2VXQA 3T6XA 3Q48A 4NHUB 3IU4L 4M4RA 5BZWB 1YHPA 1XF3A 4MLIA 2W07B 2BVYA 3FONA 2LOEA 5A2FA 2AXGB 4LASL 2WBJA 4YHPA 3MOAL 4Z7UF 5GRZA 3ZDXF 5DJXB 5FFLA 1MRFL 1XGYL 4LSSL 1ZSDA 4LVNC 5CJXC 4CRPA 1AVAA 1F5WA 2P8MB 4ES9A 4OKVA 4JZNB 1MWOA 2EKSB 4DEPC 4FQCL 1SJEA 4K7FB 3LQAC 3KXFA 5J5EA 5IB3A 3ARXA 3SE4C 4RNRA 4P2RD 2OM5A 4MD4A 3ESVF 4GI6A 4LGPB 1UB6B 4NNPL 1SMAA 4P3CH 3KPRD 4ZFFA 5D7JD 1F4WL 4X8JB 2F19H 3IF1B 4MXWL 3V5DA 4RIRB 1JGEA 4FXKC 4P57A 1YA5A 1SLXA 1A7QH 4N28A 2IQ9L 4PJEF 4PJGA 3WNIA 2V5TA 3ARBB 4E0RA 4J3WA 2VLJA 2CZNA 1WITA 1U4FA 3CSFA 1UUSA 3DETC 4PJ9A 2K45A 3QZWB 2DL9A 2YBGA 4ZW5A 3VE0A 1CBVL 4KO6A 5JHMA 3IXTA 4HG4K 3EGSB 3CDCA 1BWWA 3N9GL 4I0KA 4NN6C 4NI3A 3ARGC 1H9VA 4M5ZH 4Q7DA 2W8CA 3OKDA 3VO0A 1Q9LB 3QORC 5DCCA 2ZWLT 5HDWA 3WTTA 4OZIB 1LO3H 1ZVHA 1HJBC 4HUVB 1FRGH 4WEUD 4M62H 4OZGB 3WNPA 2EC8A 1YEJH 2VW6A 2IH3A 4V33A 4NRYA 2ICES 4U1IB 2BCMA 4CMMB 1Z3RA 5AENA 4A68A 5CD3A 1E9OB 3O9WA 1G6VK 5DHDA 4PG9A 1CE6A 1H5BB 4LCCC 1S7RA 2R1WB 2XQBL 1NAML 2VW4A 4LARH 4ZX3A 5BS0A 4I0PA 1AHWB 5E94A 2A9AA 2ZTBA 3RUGA 2CO1A 2ISDA 2AVGA 3S5LG 1OWRM 3GBLA 5JIDA 4OZIE 1WCBB 4KDWA 4HCIA 2AZUA 4G11A 5I15H 5FC9A 1IC7H 2WV3A 1KB5B 5CM1A 2DLEA 3OB8A 5IW1A 1ZAGA 2VKXA 1FV1A 3K2MC 4EN3B 2JXMA 2VN3A 1KBGL 2MFNA 4JDVB 1KSRA 2DJMA 4GI9A 3HS0A 4AL8H 4XPFH 4YSOA 4DFIA 2GTZB 3ULUC 2DPKA 2Z31A 4XCEB 1EFXB 3PHQA 3IMVA 4S0SD 3ES6A 5I73C 3ESOA 5AWNL 1R3KA 4K7PY 4Z7OF 5DD1L 1U21A 4UBDC 5GGUA 5GQBA 5J3HC 3N1QC 4XNZC 1NGWB 3TNMA 3MRBA 4GRLB 2EIMB 4QRRA 1R5IB 5AAMC 5IP4A 3B7YA 2EUWA 4QJ4B 5BV7C 3LEXA 3S2CA 3TTSA 5T3XE 2NY7L 3SGKA 2XWTB 3TZVB 4WUUD 4UAOB 5AB0A 3IDMA 2VM9A 4N0UA 4IYKA 1KF9B 5A2AA 3F7LA 4LOVA 3L5HA 1JZJA 2YKLL 3FL7A 4WI9A 4X7CC 3NQIA 5AW5B 4A6YB 2EXYD 5M94B 4W93A 1IB5A 2JE8A 3GIZH 1CICA 3KJ4B 3SSGA 3MR9A 5F7NC 2BVTA 3D25B 3HCVB 2XHNA 4RGNC 1FG2A 3CLEL 2J71A 4B9GA 5JPNB 1GZQB 3HS8A 1N2RB 2OBGA 3MV8A 4UT7H 3WKML 3QC5X 2YA0A 1N6VA 4U1JA 2X4SB 1N10A 5B4MC 5BO0D 2ORBL 1CLOL 1ORQB 3C8KA 2EYSB 2VM4A 4LLDB 1OL0A 2DM3A 3EO0B 4G6ML 3PWUA 3C60D 5DHVA 5DZVA 1WBXB 4GKOA 1DUYB 1JNLL 3N6YA 2R9HC 4UTAA 5AW2B 5SV3A 3B3BA 5EF1A 2J8UF 1MIEH 1QLFA 2DJSA 4HSQA 2R2CA 2F53A 2YGQA 4Z7NF 2QTVA 4U1NA 5ERWA 1YN6B 4AM0A 3BAWA 1NBCA 2FX8L 4RWHA 4RZKA 5IKCA 2ED7A 1SHMA 1G7PA 3N40F 5IBLD 3L1OH 4M7KH 3R7QA 2GABA 3FTGB 3L3JA 3WN5C 1C1EH 2XWBB 2XVKA 1AE6L 1AZCA 3KPMB 3O6FA 4JO4H 4DP2X 2JJWA 2ICWJ 4W6XB 4YX2L 5C6WH 2AQQA 2XY2A 2GTWA 3SCMB 2QFRA 3NSFA 3NTCH 3T09A 3UG3A 4XXDA 1JSYA 2UUDH 4K9EL 4H5SA 3ZO0A 1KLFB 4GG6A 1HWHB 4PRNA 3MLVL 4MMZA 4YR6B 4ZUWA 4C8XA 1NMCB 4RVBA 1L0XA 3JTBA 4UM9B 3PJSA 5I0VA 1AR1C 1Y0LB 1NLDL 4YBLB 1BGXL 2VLRA 3IE4A 5E7BA 5IB4A 3TFBA 1L9NA 1FFNA 1HSBB 5E08H 3U1PA 2A1WH 5FDYA 1VEOA 3MRNA 2VUOA 1XCWA 3CVCA 4YDZA 2PTUA 1PZUB 4ISVB 4BZ2A 4KO7A 4L3CA 3QAQA 4PREB 1AKJB 1X7QA 1WFOA 4L1SA 1XVSA 1OAXL 5BXFA 2DBLL 3CXHK 3H4HA 1IM9D 3CC1A 2FQDA 2XU9A 3JV0A 5FCUH 4DP9X 4C56A 4JFTA 1I9IL 5KYXA 5AYTA 3ARFB 1KCUH 5KVEH 2DYRB 2Y07H 2CH8A 4OFPA 3B34A 1DZ0A 4L8SC 4L5FE 2X89A 4JL2A 1QFPA 5AL0A 5E8OB 3UJTH 3DBSA 4CMHC 5JQ6H 2YD1A 2HA1A 4X4XA 1L9OA 4C4KT 1XSKA 4F15B 3KBPA 4FHJA 2UZYA 2E74C 5FA4A 4BK5A 2CO6A 4HGMA 1I7ZA 3DSFH 1RI8A 2JJSC 1D5ZB 4XOCA 2UVEA 3TO4A 3KCPA 3KWWB 1JRHL 1A7OH 1PNCA 4P5TA 4XCCL 5DO8A 3P3SA 4Z23A 2YN3A 2ZKHL 2OQJB 2N4IA 1ZJBA 1UZ6F 4BKSC 2LU4A 4EVNA 1BF8A 4Z78B 1SHSA 1KLUA 4PH8A 2KZ1B 3CFTA 3KLKA 4XHJC 2OSLA 3UBXG 2HLFD 4V1DD 4I18C 1THAA 3T2QA 3DHMA 1SLWA 4P2OC 3H9SA 4ZUUA 5L9DL 2V2XA 4F8QA 3FH7A 3Q8FA 5DZ9A 1TJGH 1FL3A 3CSYB 5INDA 4HETA 1FAIH 4KHTH 4N2KA 4XNYH 5JDJA 2EYTB 1IBHA 2XCMC 4BHUI 1BJ8A 3CSGA 1W0WA 4FZEH 4LPUA 3ETBJ 4OB5H 1BAFL 5C0EA 4P5MA 2KZKA 3FQWA 2ERJC 5AG9A 5KZCD 3DXAE 1KZYA 4OLXL 1D7CA 1JN6A 3FTWA 4N2BA 2ENYA 3LHPL 1HHHA 1CIUA 2DWEB 3MO1B 5F9JA 1S78D 3NPZB 2UXVA 3K4DA 2N3JA 4R90H 1N4XL 3BLKA 1CBJA 2D7PA 2WXHA 3FB8B 4NAQA 4TM9A 1NCIA 4H0IA 3QDMB 2DI9A 2ZP0T 3V4PB 1QFUH 5FOBB 5F3HB 4ZMXA 3SDCB 3QIWA 4LCIL 1UOLA 2BS8A 1TFPA 1EZSA 4GXUM 4WFGD 3VTAA 4HPYH 1CD1A 3S36X 4BGLA 2H45A 2QTEA 3N1MC 5HDQL 3VWJA 3VQ1C 4X4KA 1A4CA 1XMEB 3PAYA 2BHYA 2EILB 3PXJA 1KXQA 3M7FB 3OWRA 1TTCA 2M2DA 1A1MA 5I66B 3B9KC 1UXWB 4ONFH 4NQEA 4AY0A 2ENSA 1GIGL 3H7BA 4BE5A 1R9FA 3TCLA 1IEBB 3I6GA 3P77A 3F04A 1ZA6B 5E23A 5JIQA 1KEGH 3U4BL 3UGUA 2FE0A 2IBGA 2J7LA 1MCNA 1S5IH 4N0YL 1PVHA 4LVOC 2ZOLA 5JO5A 1SN0A 1EGJL 2PO6D 1SJMA 2GCYA 2OULB 2PXYA 3ZKXC 2QKIA 2V0AA 5KBMA 4DVBB 4KX9A 4HAGA 5ANHA 4HFWB 2Y2WA 5E2UH 4GP5B 2ATPB 5DQJB 1J87A 2A9CA 4QEGA 2YPVL 5BRZD 1P4IH 1FSKB 3ARDD 3QFJA 1JNHA 1JGVH 1U3HB 2WXMA 4J6RH 1LLAA 1GYUA 2NW3B 4Q0XL 1ZPUA 1B0RA 4AEHL 4F9PA 1NBYA 2P5PA 1SHWA 2PPFA 1OALA 4JG0L 3KLLA 4W9EC 1JXFA 5AYQA 5DJ6B 3OKMB 5CZVL 3RX7A 1NDMA 4GW4A 3VFTA 5ICZB 3BZFA 4RH4A 4DPCX 3DVNB 1NOLA 2F8XC 1MKFA 3EYUL 1Q9OA 4M8QB 4R2GB 3FN0H 4XC1H 5D1XD 5HGDA 3GLAA 2X41A 1VFOA 1R3HB 1FZJB 3QJHA 5ADOH 5JTWA 1IBDA 1QLRA 5J1TC 4JPIB 4GBXC 1RZIA 2VZ1A 4Z3TA 25C8H 2JI2A 4V1DA 4HIHA 2G3NA 2NY1B 1PU0A 1I3UA 4N1HB 3J7HA 5K59F 2G0LA 4U6VL 3FYIB 3QUXC 3E6HA 3SN6N 2X4OB 2VQ4A 1J0JA 2WIIB 1PQZB 1WA1X 1XSIA 1HXMB 3NSCA 1KTRL 1N67A 1U0QA 2W0FB 1XGTB 1CU4L 4YQXH 3TU6A 5ABDE 4YZFE 1NCAL 2A5UA 1WGVA 3X1BA 3N42F 3CZLA 1HT6A 3S97C 3QUKB 5ID0B 4YE4H 1LEKA 5EEXA 2A77H 5IQ7H 2VR5A 4WWKD 3ZHDA 1L9RA 4Z7VA 2MRYA 2WQWA 4OFIA 3L54A 4X6FB 3KMDA 3LKPA 5KS9B 3PHOB 2CDEA 1CFSA 4AUJA 5MEQA 2EVGA 4UDUA 4R0LB 3SBWC 3DRTB 3CU7A 5IW6A 3X14B 1ZK9A 2BMKA 4F7CA 3PWPE 1EEYA 2CCLA 2LR4A 4HIXH 2FT6A 3PY9A 3E8UH 3MA9L 5EU6A 1CYWA 1PAZA 1F13A 2YBRB 1EXUB 4HH9A 4DKTA 5HJDA 1DCEA 1KPVA 1QABA 1E6JH 1J8HB 3HHMA 5EU5B 5I1DA 5KS9E 1X5MA 4KKZA 1YY8B 1XCQA 2VE6B 3K1KC 4Q6IC 1G1KA 2Y6TE 3VTTA 2E56A 3AACA 3VXTB 1E4HA 2MEJB 2RD0A 4BQBA 2IV9A 2NNAB 3QRFM 1YG9A 5DJ2A 5E9DA 3GXPA 4BCYA 3WKPA 3ZPDA 1Z9PA 4XAKD 3GSUB 3NRPA 4XI5C 3AVEA 1LO4L 3OKKB 3B2UD 3P11H 1OV8A 3WE1A 3ZRFC 1J8HE 3QZPA 1HK6A 1BBDH 2XZQL 1JUFB 2XV6B 4ODUB 2EQDA 5I1AA 1N8ZB 3HE7A 6CGTA 1I1AC 4EDWL 4G8GE 1JHKH 3GSNB 4KKCC 4L0PB 4H0GA 5AKSA 5CP7A 4F9LA 5GS1B 5BVPH 3RWEB 1S7SB 1ADQH 4HIIA 2NY3D 3PGDA 4HS6A 4DKFL 5J6GB 4PJDE 4AXWB 5I9QB 5AL8A 2UWEF 2WZ0A 3V9EA 3ENEA 3MRHA 5ANMA 3RIAF 4BSVB 2YD8A 3VDCA 2PPCA 4BH7A 1X6LA 3ZE2B 4KJWC 3O4OB 2P46B 4R7NB 4JM2D 5MERB 3W81A 4RAHA 4HXBL 1MW0A 2YC1A 2AGJH 1OIOA 1PZSA 2HX9A 3TH4T 2FUTA 2UUDK 1AXSB 4I7ZC 3UYOD 4XN7A 3A6BH 3MA7A 4F91B 2X9YA 3BKCL 2E9JA 1S7WA 3CMGA 1MIML 1NGZA 3BGMB 1PKQA 3C5ZA 4OQTL 2ARJB 1RPQA 5DJAB 5CSZB 5E1HB 1NFIA 5AYUH 4MCNA 1J1XH 5E95B 3EGXB 5F1KC 3EFOB 5ALCH 2K6ZA 2TAAA 1MFUA 3RGBA 1NFKA 1ES0A 3B4NA 4I0CC 4KJPD 1ZT7A 3PP4H 3O2VL 4G5ZH 5I6MA 1TEYA 2PP9A 3CHSA 1V7NH 1KPUB 2BSCA 4LDCA 4QRPD 4R8WH 5EU4A 2EVHA 4F8NA 3NIGF 4WO0A 1G1CA 3STZA 1OHQA 5KOMC 3MRRB 4KVCL 3V8OA 2OYPA 1OW0A 4FQHB 2GBVA 4IMLB 1BF5A 4ODVH 4GFTB 2AHIA 1JGDB 4RMBA 4HS8L 4P3DA 2RTTA 5DUMH 1BV8A 4PY7A 3MRCA 4ZW6A 1BSIA 2DQFB 4YNYA 1X5HA 4N1EA 3IJHB 1HNFA 4N90D 2ZJSL 1NCUA 2Q3AA 2J88H 5IMOB 2ZT9C 1MJ7L 4LEOB 3G5VB 1T2QL 2YAMA 1KCVL 4L8DB 3X13B 4N22A 4FF9A 3WO3B 4L05A 4XP4L 1BQRA 3T04D 3K5SA 4JVWA 1GVIA 3UBHA 3K4AA 2NQDA 4K5OA 4K3GA 4NQDD 2BERA 1HESA 4FX5A 2GT9B 3RTLA 3F6IA 1GJIA 2AZAA 2OMUA 4EI6A 1PSKL 3ARBC 1F8TL 1JXKA 2EH7L 4OUUB 4D9QE 1MHEA 2R4SL 5DQDL 1IGTB 4NB7A 5FECB 5AVUB 3BKYL 1P7QA 4WJ5A 3CN4A 4E5XG 3SDAD 2R29A 5IVNA 4N2AA 4BCXA 2DWDB 2VZUA 2QPFA 3JWNC 1TU2A 1DLHB 2DWSA 3O6MH 4X4YB 4G2AA 3U7WH 4WK2B 1RHHB 2DI8A 4JHZA 4DKDC 4DN3L 1AIFB 1ICTA 1RZ8B 1TCMA 4P46A 5AAWA 1SYSA 1AZNA 1IKFL 5DR5L 3BH8A 3MREB 1SBSL 2GIYA 3I3BA 4ONOA 2UZXB 5JXEA 3EXJA 1T0MA 3QQ4B 1DSWA 4PJIA 1W72A 5ISZB 2BIIA 3HMXA 4U1KA 3T3MB 2ALWA 5CIPH 3RPIB 1WWAX 3BKMH 5DRWB 4XVTL 1HHGB 3BAXA 2ADJA 1BF2A 1EJ6A 2O61B 1M2VB 1QFWH 2YAHA 5FUCE 3VXPA 4Z77A 1Q72L 4EN3C 3L8QA 3C6LA 4K8RL 3QFDB 1RJZB 4NGHL 2AJVL 1LDSA 4KUZL 4D3CL 5ISZE 2LE9A 1TPXB 2VDPB 1OP5K 1X44A 3BYTA 4Z0XB 3TA3D 3UO1L 1E4WH 1DBBH 3T3ME 4PJXE 1UH4A 1TQWA 1SPDA 1U91A 4N2LA 3GI8L 1DR9A 4OM1H 1PW3A 5DUPL 5IVXF 2AC0A 4K23L 2C9XA 3ASWA 2OMZB 3CZKA 3RBSA 1HQ4A 1EO8H 1URZA 3TASA 2NLJB 1FBIL 2WXKA 4OT1L 4G43A 4CW1B 4ABUA 4A2LA 5GS0C 1LD9A 4KI5F 4NKQB 1T03H 2CDGB 4YHOL 2PYFA 1KLGA 2WXFA 4UAOC 4MDJB 5D9SA 3TT1L 2XZAH 4KKAD 4UU9B 5E99H 1U41A 1DDHA 2B15A 3RL2B 2NNFA 2DLGA 2O5YL 1C9SA 3L9YA 2XQYA 4BH8A 1BDYA 4AYEC 4W9LC 1DQJB 1CTMA 4BZ1A 1KTDB 2ESVD 1A2YB 4BHUA 2NXYC 2R56L 4DTGL 1QR1A 4K73A 2RCSH 3UACA 5HYQA 1LK2A 1IAOB 5EO1A 4QLWA 4Y8DC 3CXDH 4JPWL 4HJ1A 5IESL 5JPNC 1AMXA 3EOAA 1XF1A 2C4XA 4J3XA 1GGIH 2BVOA 4X5XA 4F5CA 1AS8A 3FZUC 4XXWA 3BJ91 3QUHA 1MCFA 2KZBA 2VDLH 3DX4A 5TDNB 5T1LD 2YRBA 2YWZA 3DX8A 2IANB 2FIRT 1HEZA 1JK8A 4JLRA 1QACA 2P5WA 3AB0B 3C5JB 5IW3A 5EB9A 1S9YB 3QYCA 5ESVB 1HDMA 5HHVL 4D8OA 5FYLD 2J6EA 3REWA 5BVJA 5EC1A 2IALB 3N44B 1U3NA 1FLRH 2R2EA 4GXVH 4YE0A 2PPAA 5DVMA 3ZE1B 1L6ZA 3CN3A 2H9GB 1QNZH 5BW7C 4TLUA 1SY6H 4E68A 3ZTNH 5F9OH 3WEXA 1QWNA 3BP4B 2XYBA 3MACH 3QDGA 4HSCX 2IANE 3VMPA 1UATA 2XIBA 4Z1PA 1OSPH 1G43A 4LIQH 2VOTA 4PWGA 2PP8A 4K0OA 3QDJD 4QT5B 3OB0K 3ZK0A 3V6OE 5E8EB 4IJTA 2IAMC 2AXFB 3MAWA 3MJ6A 4XRCA 3ZE1E 3QG6B 1JV5B 4HUXB 1U3ZA 4C57C 4JG9A 2CGRL 2VTFA 1NMCC 3W56A 1EXHA 5T1KD 5GZOC 2A4EA 5F7DA 4BDVB 3OPZL 3TBWB 4MHHG 4YBLC 1NEZA 3UX9B 4GI8A 2HMID 1FVCA 3V52L 1J5CA 4X4MA 1CGUA 4JDTH 1MPAL 1IC4L 5E2TL 4K2UL 5FUOL 3QJTB 1IFGA 4PW3A 4JY5L 1TFHA 2QLVB 5HVWA 4QRSB 2NT0A 1INDL 1CTNA 4MAYB 3DC0A 2NY5H 3GSWA 3HC4L 1SDAB 1F6LL 1H19A 3AU0A 1RUAH 4KXAA 3ARGD 4WJG3 3GD1C 1FGNH 2V5SA 3KLDA 3BO8A 4WAFA 4YHKH 3OKYA 2IBZY 3WUWB 5DTFA 1IBZA 1R3JA 3ARFC 5C09D 4KZEH 2KDGA 3VW3L 5LGJB 1YQ2A 3WOVA 1PX3A 2CUHA 3V4VL 1YEWA 4P4RB 4XVJL 5EZJB 2W88A 2Q8BH 1RULH 1WFTA 3GJFH 1IKNA 1OTSD 1LVEA 3QQXA 2ZXAA 4JDEA 2XPGB 3BSZL 3LIZL 3GMNA 3TFKC 4B0MB 2XWRA 4I89A 4JRYD 1Z9MA 2YXWA 1L9SA 2BCKA 3BFOA 3C9NB 5C0IB 4POZD 4YXLH 4TLSA 4PB9H 4F7TB 3BZDA 4WO4A 5SWSB 2YD5A 3V5HA 5TQ2L 3Q5TA 5L2KB 3DX7A 4DVRH 5LG6A 3ZN6A 1U8IB 1YEKH 3DDFA 7FABH 3IPBA 3VD2A 4S10A 1M7XA 5ITFB 3NCBB 3O6KH 4Y5XB 1JFQH 1TSHA 1FDLH 3BP5A 3WMSA 4YGVB 2X0UA 2XDHA 1XHHA 1KEML 5L8JB 3QXWA 3EYFB 3SY0B 3RZCB 3ULUD 2B7DT 1ND0A 5I17A 2O6FA 3Q0HA 3U9PH 4ZMVA 5I1EL 1ZWIB 4OU3A 3S96A 2VLME 5L2KE 4MB4A 2XRAH 2AJYH 1F58H 3II1A 5EZOL 1NBZB 2AV7B 1WGOA 5G4OA 4HT1H 2UXTA 4NBXB 2FX7L 4N2EA 1ZVSB 2X4PA 5HGGS 4TVPE 5DMIL 2HFGL 2OL3H 2VO8A 4KHXH 3TBTA 2DRUA 3VFRB 5TF1L 5AW1B 4ZNCD 5CEZL 2FHFA 2HJLB 1CFVL 1KJVB 3CDZB 3ZZLA 4G6FB 3OX8B 4YDMA 5DJCB 1UTDA 4TQIA 4XX1G 1G0YR 5CJXA 3LH8A 1LDPL 1W15A 1JXGA 3IFPA 4M43L 3MNVA 1MCQA 1TVBA 1MCWW 4RGND 4FG6C 1MCKA 1OGTB 3OXRB 3SE4A 1RIVL 1U33A 2VRAA 4Y4KB 1CL7H 1IO4C 1T21B 1VERA 5I76B 2PYED 5HI4D 5HPOA 1PJWA 3CN2A 3O2DL 4ODTL 4A7SA 5IY5B 3FU0A 3SE9L 4LF3B 4FXKA 1IQWH 4C54A 2NQ3A 3I3DA 3P3TA 1K2DA 4LASH 1PGRB 4AEEA 3MOAH 1Z0MA 4MMXB 3WIHL 4GXFA 3L3IA 1MRFH 5AW8B 3VJ6A 4F58L 1DCLA 4JDZA 3VUAA 1NDGA 2W38A 4FNPA 5F9AC 5DS8A 4CAGA 4FNTA 5HY9A 4FQCH 5BZDB 3MNWB 2CKBB 5DRNB 4LPVA 1JG9A 5CR1A 1JGLL 3V6ZA 3ARGA 4J3VA 2J5LB 3QORA 3P73B 3FBQA 1ZDSA 2EIZB 1YNLH 4NSKA 1F4WH 4HHAA 3BRGC 4MXWH 1FSKC 2NMSA 4BSWB 2X3AA 4LCCA 2IQ9H 3EGDA 5FV1L 1KWGA 4XP1L 1A6UL 1AR1D 5DZPA 1R3LB 5LCVA 1A47A 1A0QL 3QXDB 1CBVH 3ABLB 3LPWA 5DZOA 3N9GH 2Y7SA 1UT1A 2B3RA 1QLEL 1HFUA 4XP9L 3WHXA 3T8MA 3E3QE 3HRZB 3LKOA 4F27A 5CCJA 5CNHA 2R51A 1BQHB 5B3NA 1B88A 2NY1C 1CD9B 3FTSA 4Z3JA 3PF2A 3IYLW 4L29A 5AVZB 2IPKB 2ZUYA 5D7IF 4ATWA 3R18A 1CGVA 4OKDA 2ZCLL 1VADB 1MG3C 1I1CA 2RFXA 4HA1A 3BEVB 1QSFB 2A9MH 4Y9EA 4E9QA 2P49B 1Q4NX 4XPAL 4H8QA 1FFQA 2BPBA 4M5TA 4OTXL 2C3HA 2GEEA 4F57H 4L4VA 4FJYA 4KAQH 1XEDA 5A40E 4FABH 2HFFA 3MUY1 3U2SB 4LPWA 4JFOA 5FW6A 9CGTA 1DJWA 2IADA 4ODSL 4PHZA 1JWSA 1KYAA 5J12B 1J12A 4LBAA 3D85B 3ISRA 4Z7UA 5CCKL 1ZTXE 4M1DH 3FSZA 2PR4L 4JK0D 2Y25A 1QSFE 3NIFB 4WW2F 4PR5B 3UAJC 5KVDL 2YEVB 4DHLA 5I2IB 3ROOA 2EDMA 5DJDA 4YK4B 4XHJD 1GH7A 3MKKA 3D12B 5JOEA 4R0LC 3OR7B 1Q9WA 3O41A 3OVUB 4JFXA 3M46A 5D7SL 4P2OD 4WTZA 4K07A 4CN4A 1IC1A 5AWNH 1U8LA 1NBVL 1TEFA 2VXQL 3PWVB 1UD2A 5DD1H 2H0FA 1H0DA 3IJSB 1FNGA 4PV8A 4YHYC 2WQUA 3QRBA 4MZ3A 2PYEA 3LXAA 1NH6A 3NIFE 3BVNB 1GW6A 1EV2E 3RY5A 1JTTA 1UWFA 3D0LA 3CTTA 2NY7H 3HNTL 1SXSA 1E9QB 1SZNA 4HHWA 4JFDA 3VFSA 5KVGH 5KYWB 3G08A 4R9HA 2JB5L 1E2VA 4Z7WA 3UC2A 2CO4A 4JL1A 4PJEA 2BSSA 2C1PA 2AF2A 4JFHE 4ZNEE 3K5RA 4P2QD 4Q9CA 3FO0L 1HCYA 5DHYA 5AUMB 1CGYA 4K7PL 5DK3A 5A7EA 1U2HA 5C07B 3W37A 3CLEH 4D0CA 1WAAE 1QW9A 4JAMB 4NRXB 1CN4A 3WN5A 4PU2A 3L1FA 3WKMH 2YN5A 1MEXL 5GS1C 5IHLB 1FYTA 2EDKA 2R1YB 4ZUTB 3BE1L 1F0LA 3X3FL 2ZYSA 4E42A 5KYNA 3EYVA 1UKSA 4TQ8A 4G6MH 1SMOA 1SEQL 3T0EB 4XOBA 1JNLH 3EF7A 4JM4L 5LDSA 3DK0A 2F0CA 2VR3A 5C07E 3CDGB 5IWLC 3U6RB 3NEXA 2CHZA 5LAXB 3V6BR 2EKJA 4APQD 4XO3A 4KH2A 5A3IC 4W9ZA 2VDOL 2F15A 2CUAA 4UZGA 4JN1L 4W9DC 4WNJA 3MV9B 1BD2D 4FJ6A 1LMKA 1IZKA 2DICA 5B38A 1CPUA 3IN2A 4M93B 4NZFA 4DP1X 1CYXA 1A6TA 3T0EE 4RMQA 3JTSB 1FN4A 1LWJA 1H15B 1AE6H 4AJ0A 4BYHA 4JVPA 4Z3IA 2F08A 2BNRD 4OD2B 2VL5A 2PCFB 1NFDF 4K9EH 4TNWF 1BVNP 4FI7A 3C08L 3IE9A 3Q9QA 2NY0C 3MLVH 3FB7A 3MV9E 3MRGB 5DFVC 1DSYA 3L2NA 4MCZB 3S48A 1L7IL 3Q1EA 2EP6A 4L8SA 3WIFB 5FK9B 5IHUL 1QUNB 1NLDH 1BGXH 1HHJB 4ODHL 4FAAB 4J8RA 4KKBD 1SVZA 2XG5B 1U8MB 3EH1A 4K3EL 4KU1A 1P5VA 4HX1B 3GLEA 1FH5L 1G7JA 2JJSA 3VD3A 4UDTA 3GBEA 5FYJE 3GUTB 3BWUF 2AXHA 1IE4A 5CMAA 3P2BA 1UOWA 4NQCA 4XPTL 1AHMA 1OAXH 4IBWA 3MODL 1BXVA 4LLQA 2BS9A 3JTTA 1FZOB 3MNZB 3GSOB 4JFFB 1E5CA 3E1F1 2CLRA 2EADA 4UNUA 4Q9QL 3MOQA 1VESA 3H53A 5CEXA 1J1OL 4M6OL 3KJ6L 5F1OB 4P2OA 2V3EA 4RESB 3QUXD 2KPWA 3RQ3A 1H3VA 4F8LA 4FHBD 5C1MB 2W1NA 1U58A 3BZEB 1QP1A 2YMOA 5EH1A 1MELA 4JFFE 4B9KC 3SKUD 5DRZB 4XCCH 2WB7A 3ZYJA 3D3VD 2ZKHH 2IH8A 2FJHA 4R6UA 2J8UA 3ZVVA 1PY4A 4PGCB 1HSAA 4JGJA 3T6VA 3N1GC 4EI5D 3IJYB 4JJHA 4AIXA 2D7NA 2ZQKA 3PE9A 3POCA 4PJ5A 4MJJA 1DVUA 4NKIL 5AW0B 5FHAL 4F37K 1TJHL 2AK4A 4RA0C 2HJFB 5L9DH 3ULVL 2IAAC 4LRIA 2JB6B 2Q7YB 3WU1A 5IGXL 3T4AC 3BCFA 3NYKA 1F56A 1WPCA 2LFGA 2OPCA 3ULVD 4JJ5A 3RGVC 3D33A 1IQDA 3CHRA 2EH8L 1BAFH 2C9UA 2ZUQB 4YVUA 3I3EA 3CFEB 1HXYA 3QPXL 3NG5A 4OZHB 2J5WA 1K6QL 3L6FB 4YDKL 5DUJA 2XACC 4OCWH 1T7VA 3N1FC 5D2LA 1PS3A 5HYEA 4UMGA 3B9KA 4ZFQA 1ETB1 1GS8A 2XFXA 1QQDB 1VB9A 3DRQB 3LHPH 1GYWA 1QD0A 2KL6A 2N7BA 2CPCA 1M7UA 1NEZG 3PWNA 1TQBB 2HFEA 5C0GA 2FBJL 3B43A 4XI5D 2EACA 4FTVB 1YO4A 3VU2A 1HEHC 1G7LB 1YN7B 4P59L 4OZHE 3IWUA 4FXGA 2F5AH 1TQTA 3EBGA 1KB3A 4LCIH 4QHLB 3QZBA 4WW1A 1QBAA 2MQ3A 4QKXB 1XIWB 3TEUA 2J1KA 3VFOB 4FG4A 1P6WA 2C9RA 4FNLL 2BNQD 5HDQH 3ABGA 3MBWB 3ZJAA 3MPCA 4OV5B 2CA3A 2MPVA 4LCWA 4PRBB 1L9TA 1W6WA 2W60A 3KPLB 4FTVE 5EUOF 1GIGH 1I1FA 3KBHE 4K5NA 3CZFB 5IFJA 3ZTDC 4BZ2L 1C8PA 4N3UA 3WL9A 1ZLSH 4KI1A 4NOFA 3AS1A 3OLEA 1TZIA 3QC6X 1JTOA 2ZX8A 4DETA 1SJVA 1B6DA 1EGJH 1F42A 2FD6L 2YEZB 4U3XA 5GGRA 5C3TA 3WKNA 5MENB 1CUOA 4WTWA 1KGUA