2AF2A

Solution structure of disulfide reduced and copper depleted human superoxide dismutase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human SOD1 before harboring the catalytic metal: solution structure of copper-depleted, disulfide-reduced form
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 37
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2af2A00
2SODB 4L05A 4A7SA 3T5WA 1Q0EA 1P1VA 2AQPA 1F1GA 1DSWA 1XSOA 2WKOF 3HOGA 2AQSA 2Q2LA 2V0AA 2C9UA 2XJKA 2Z7WA 3ECUA 3K91A 2AQNA 2ZKYA 1JK9A 3KBFA 2VR6A 1Z9PA 3CQQA 4U4IA 3S0PA 1L3NA 2Z7YA 2LU5A 2GBVA 2Z7ZA 2Z7UA 2XJLA 3HFFA 1IBDA 1YAZA 4BCYA 2ZOWA 4BCZA 3ECVA 3L9YA 1OZTG 2WWNA 1XTLA 3H2PA 2C9VA 1HL4A 4OJAA 1F18A 2AEOA 2C9SA 1B4TA 1IB5A 1IBBA 1HL5A 2R27A 3KM2A 3L9EA 3GTTA 3PU7A 2JLPA 4N3UA 1YAIA 3QQDA 3H2QA 3KH4A 4A7QA 2GBTA 1E9PB 3GZPA 3LTVA 4N3TA 3ECWA 4A7TA 3MNDA 1E9OB 1JCVA 1BA9A 2AQRA 1KMGA 1SDYA 2JCWA 1IBHA 2E46A 2WZ0A 3CE1A 3MKGA 1F1AA 1CBJA 5CU9A 1SXZA 3CQPA 1SPDA 1SXNA 4B3EA 1PZSA 1OAJA 2ZKWA 1RK7A 2WZ6A 3KH3A 1E9PA 1E9QA 4OH2A 5KBLA 1OALA 2AF2A 2AQTA 2K4WA 4A7UA 1XTMA 2AQQA 2WYTA 1Z9NA 4A7VA 4BD4A 2WZ5A 2VR7A 4A7GA 3QQDB 1N18A 1IBFA 1OZUA 1SXAA 1DO5A 1UXMA 5KBKA 5KBMA 1AZVA 1OEZW 1S4IA 4FF9A 3F7KA 2WWOA 2ZKXA 1SOSA 1SXCA 1EJ8A 1MFMA 4MCMA 1CB4A 3KM1A 1EQWA 1BZOA 1SXBA 1F1DA 1QUPA 1YSOA 4MCNA 4A7GF 2E47A 2VR8A 3GQFA 1TO5A 2NNXA 1JK9B 3GTVA 3GZOA 3GZQA 3SODB 2WKOA 1B4LA 1SDAB 1SRDA 3HW7A 1PU0A 1FUNA 1E9QB 1TO4A 2GBUA 1SXSA 2WYZA 2APSA 1U3NA 3KBEA 1N19A 1PTZA 3RE0A 1UXLA 3F7LA 1E9OA 1ESOA 1COBA
chains in the Genus database with same CATH superfamily
4JFZH 4PI0A 3D39E 2CO2A 5JNYB 4OGYH 4HEMA 4WK0B 4Z7OB 5F7HA 5AWNH 4RDBA 4XWOD 2H6PA 3Q43A 1XF5B 5C0BB 3UZVA 1T0MB 5T1DL 5DYOA 4OCXH 4JJHA 4QTFA 3OKEA 4UQIM 4JFFD 4LSSL 3HTLX 4FL4B 5CEXB 1OQOA 3QPXH 5BW7C 5HYJA 1URIA 5L9DL 2YPVA 3TL5A 4KAQL 1CLOH 4WHDA 5EOQH 1MFAL 5IW3A 1UEMA 3W2DL 3RWEB 1QHOA 3V10A 4LL9A 5AB1A 3D0LB 3PXHA 5DYFA 4UDUB 1UA3A 4KRMB 5FFGA 3C12A 2QDWA 1BSIA 1DQDH 1Q9KA 3BUPA 3M1CA 5F7YC 4K3DH 4P07A 1H3VA 2IQAA 3FC8A 4PY8J 4XODA 5FUCE 1MFBH 5EEYA 1CK0H 4UQEA 4L8CB 3DUUB 3M7OA 3O2DL 4CMMA 2YARA 3QDMD 1BVLB 5DVLA 3SDXE 1G7PA 1SHXA 1BZ7A 3MV11 1SDYA 2P80A 3U7WL 3NSYA 3NG5A 5J6HB 2HVBA 1KZQA 4MRCA 1OP3H 3H9SE 1QI5A 1SJMA 4TNGA 2DQGL 2GY5A 1NCJA 1M05A 2C4FU 5IGXL 3V5KB 1QSFA 5SWQB 1IC7L 2GKIA 4CL7A 4BQ6A 4Y5YC 4F24A 3TH3T 4MCZA 3EFDH 4HFWB 3ZU8A 3OKNA 4ZXBA 1DQLL 3RIFK 3SE9H 4L8BA 4IKKA 4BFEA 5E6UB 5F93C 4IMLA 4HUCA 3Q2NA 2AJVL 4AMKL 3JV6A 3ZO9A 3VXME 3BZFA 2OJEB 3KPRE 2AJVH 2XETA 4XMXA 4ZMWA 3VRLF 1OAKL 4I5BB 2D3LA 3BSGA 3D85D 5E8DL 1EGJH 1C8QA 1FO0B 1O7VA 3DJTA 4R0LA 5JDSA 4DWHA 4Z76A 3V0HA 5GRWA 2N01B 4TLSA 3FN0L 5KVEE 3VQMA 4P5MA 3RTQB 1CF8H 2GJRA 5K9JH 3IDMA 5J11B 2WVUA 1KTKE 1KF9B 1MCCA 1MY7A 1HHHA 2JMRA 3GSOA 4JRYE 3WFHA 4WQOA 5F7LB 3OKNB 5BV7L 5AUMB 5I66B 3VXUD 5HYQB 3L08A 2HWZH 4KHTH 3STBA 3MUZ1 4LOFA 4XC1L 5DVNA 3GSVA 1F90H 2NNCA 3BPNB 3CIAA 4KGJA 1A2YB 3FO0L 4QD2E 5CCGE 5J6HA 2N7AA 1T21A 1RIUH 1E5CA 1QKZL 1GPOL 3K0YA 4KOBA 3UGXA 4ZZKA 1S7TA 2RBLA 3UAJC 3VNZA 4MHHI 2NLJB 4NBYB 5EU5B 3TJEL 2Q2LA 2TAAA 1UUNA 4Y1AB 1A25A 4Y2DD 3MODL 2EDFA 1MF2H 2W9DL 4XBMA 4IK7A 1XF2A 3NIFB 2JJTC 1RV6X 1RUKH 3PWPE 5FO8B 2WANA 4KHXH 1JNHA 3EXJA 1Y1UA 1ACXA 1FC1A 2O5ZL 2P5ED 5HGDA 3L7EA 1F4WL 2CUIA 3N1PC 4GS7C 2UY7B 5I28A 1D5ZB 1R46A 4XAWL 4E41B 3EOAA 3ABKB 3QHZH 3ZDXB 4P3DB 3ZTDC 4XAWH 5ICZA 5JW3H 3U36A 4RRPG 3FF7A 2IFGA 5K1NA 2ITCA 3KGSA 1AZRA 1FF5A 4UMGA 2AS5M 1NLBL 5LQBL 1KXVA 2GTQA 5D70H 1TETL 3OWRA 3NIGE 4YO0B 4S2SB 4CSZA 5FYJH 4YHNB 2MSPA 1XR8B 1OSZB 3SZ6A 3NSDA 1TNMA 1KXQE 3NT0A 1G6VK 3U6XS 4XMKH 2APBA 3M88A 1P7QD 1S9WB 1RK7A 2AEPH 2UZIH 1G6RA 5JLZB 3EO0A 4ODBD 4O58H 2LLLA 1J8KA 1U8PA 5ETUB 3M8OH 3WFEL 4MJ2A 1GC1C 1OTUD 4XXWC 1UB5B 4DOHE 1SBSL 2W0FA 4DCQB 4X6DA 4BK8A 3T6XA 2WGNB 3KBHE 4AE1A 5D1XB 5BOJA 4BKLB 1PZUB 1UH3A 2D2CC 3FOMA 1QFWL 1HCFX 5EF2A 2EC8A 4MJID 3LRGA 4OCWH 2R1WB 3ATDA 3GI9H 2WINA 2DQEL 2ERJB 4DZ8A 1SQMA 3TP4A 2Z31B 5J89A 2CO3A 2IDSA 4PJCF 1QMUA 4UV7H 5ACZB 4OLVH 1TTCA 3IN0A 3OMNB 4PJDA 2X9WA 3HS9A 1KNOA 3GSNH 1EZSA 1JZ6A 4H20L 4NQCB 5DK3A 1CBVH 3RQ3A 2Q20A 5DEFA 3ZHDA 3LXAA 1Y1DA 1QSFB 2YPLD 5LBVA 5A3ID 4L3FA 3DURB 2ZPKH 4AEHL 5DO2D 4UV7L 3N3EA 1AGDA 5SX5H 3AMLA 4P3CH 3ZTJH 3AS3A 4PMEA 4BCXA 2OZ4A 3K81A 2X6VA 4R4NC 5KVGL 1Y0LB 3EJSA 3ZDXE 2NZIA 3P0VH 1U58A 1OLZA 4I2XE 4LCIL 3QJXA 4BH7B 3X3GL 3HAEB 3DXAB 3RDTB 1RULH 1ZLUK 4BWWA 5E4EB 2WLNA 2EINB 5FEBA 5J6SA 4XBPA 4FOMA 3RNKB 1GYVA 1OTUC 1UFUA 3GMLB 4WWKD 1KIUA 4NQDA 4XVUC 2QKSA 3BP6A 3FO0H 1R5IA 2FBJL 4X6DB 4P2RB 5B1JC 5TQ2H 1IGYB 1I8UA 3SKNA 2HFEB 4JM2C 1S8DB 2FZ3A 4N1HB 2KERA 1YEKH 3B7YA 3UZVB 3ZKQD 1ZGLB 4UOZA 3J2PA 2D7NA 1RURH 5KW9L 2WWKO 5GGQL 3ZHKA 1GA2A 3P2BA 2AK4B 2VN7A 5EZLB 1KIRB 1WAAA 2XWBB 4J6IA 3W3BA 3F6IA 1A6VH 2NX5A 4O02H 3WO4B 4JFPB 3LIZA 2EYSA 4FXKC 2XVGA 4NHUB 1CL7I 4RFEB 2PR4H 3WHE0 4U1IB 3T1WA 1FLTX 4NLAA 3WD5L 3DRTB 4X6FB 5AL8A 5EU4A 2WYIA 1DCLA 2X9YA 3X1BA 3Q2WA 3LZOA 2W0PA 4LVOC 2CLRA 3LH8A 1RZGA 1SLVA 1VFBA 1PJWA 2NTSP 2H2PD 3FAWA 3OJDB 4IJ3B 1ZS8A 2OP4L 4K3JH 4KV5E 4ECNA 4GRLA 1BX2A 1JERA 3KXFE 1A66A 1ZV5A 4HWZA 4MNHA 1K3IA 2E8ZA 2VZOA 1IAMA 3HRZB 3COOA 4LEOB 4GAFB 5M94B 4FTVE 3MCKB 3HVNA 2XWJB 5K9KB 4PRHE 3QQ3A 3Q5OA 4P48A 4P4RB 1MY5A 1KCUL 3WTSA 1HJBC 1P7QB 5LNEA 1OCZB 2VLJB 4A7GF 1S7UA 5F7AA 1SEBB 3Q2LA 3GKWH 1PKQE 1CK0L 4NO3B 3BH8A 4TULH 3T6WA 5BV7B 1Z66A 3MTXA 4HFUL 2ICEC 5F1NB 4AQEA 3LSOB 1T5KA 3RFRA 3R7RA 2J6EA 4UDTA 2XZAH 3TFKC 4DERA 2ICEB 5JYMA 3RUGF 3GSNA 2IDTA 2AJ3B 5KVDH 1W15A 3H2WA 4Y88A 3BSZL 1DQML 2WKLA 2HJKA 1J0YA 2ICEA 3MXWL 1JYNA 3ZZ1A 1FLRL 1MKFA 4IMKA 5I0YA 3PDOB 5HHNA 4M7KL 5FFOA 1NUNB 4IGBD 5BMFL 2JKJA 2WKOF 4WSKA 43C9B 5IB2B 1OK0A 3IBEA 4LOVA 2ZXQA 4XRCB 4JPIA 1G4MA 3IDMB 5DC2A 1TZ8A 1C7SA 2AZUA 3K91A 4N2KA 1EFXB 4AQ1C 4QRBA 5JQIB 3O9WB 2YPVL 3CN2A 1PGRB 4OTXH 1X7SA 4Z7OF 4NQUA 4P2QA 3G5YA 1EHAA 1YECH 3VFOB 2ZNXA 4I5BA 4HWZB 4MNHB 1ES0A 4Y7MA 1MNNA 5HI4C 2R2CA 2ZF9A 3ROLB 1AIZA 4GBXA 1ZS8B 3OMZA 3DETD 4C4KO 1V7ML 5EOCH 5EEUA 3EHBB 1HVXA 1J8HD 4KY2A 1UACL 1MG2C 2JI2A 1CL7L 4KKAD 1VERA 1NA8A 1UH4A 4GUCA 4X6FA 4K3EH 2HJLB 3X17A 2ZX9A 3QYNA 4AZ8A 5INCA 3A4EA 2R0ZH 1TTAA 2CK0L 4GH7B 3MV9D 1V3JA 1UT9A 3D7PA 3C09B 4KK6C 4OQTH 3L5WA 5CU9A 3HC0B 4D94A 4FI8A 4PJFA 3ZTEA 3GMNA 3VXTA 2CRZA 3NH7H 1E9PA 3RWFA 1S7QA 4OKVB 4L8CA 3LEYL 2IWEA 2FIRT 4PV9A 5DD5L 4M8VA 2L7UA 3HE7D 4WCYH 3GXDA 3T3PF 5A2JH 4JRYB 1DN2A 2BSRB 3MLPA 5F1SA 3E1ZA 2MPAH 2G3MA 3GRWH 3F7KA 3OHMB 4XT1C 3UX9B 2KUTA 2JCCB 3ZE2B 5CD3A 1NEZA 3AY4A 2AABL 3BP6B 3VW3H 1EEZB 1DE4A 3ILPA 3QORC 5ID0A 4RGOL 4JO1L 1ZT7A 4MVBC 1QUPA 2GITA 5D5ME 3PS6A 3MROB 4OIIH 4OUUB 5CINH 4HKJB 4EIGB 1JWMB 1MJUL 1NGXB 3IXTA 3OJMB 3MBEB 4AX3A 1NCBH 3WG7B 2H6PB 3DARA 2ESVD 4OV6F 4OIAA 1OWRM 3L2LA 3BZDA 3QWRA 1NLBH 2FJUB 4JKNA 5CMAB 4Y0GA 4U2ZA 1KJ2A 1T20B 3CN4A 1N19A 2B0SH 4YBLC 1A0QH 1I1FB 1EGJA 2BC4B 2QT6A 3HI6H 1ND0A 3IJ9A 4ZK8A 4EN3B 1JF5A 4NKIH 1QFPA 4J3SA 3I85A 4BQ9A 2IGFL 3V0WH 4YBLB 3L95A 3CH8A 2DMHA 4XZUB 2LVCA 2V5YA 4MQXC 4TL4A 5IMMB 5C0AE 2OJ1A 5FKAA 1QLEB 1KBGL 4M1DH 5EF3A 2G9KA 4DW2H 4M1GH 5LBGA 1FNGB 1CD9B 2UWEF 5HHMB 4F7CA 4E9YA 4JO2H 2WLLA 1MLBB 4N0UB 3BAXA 3BWUC 3MREB 5E2JA 4EI5A 2AQ1A 3AU1B 3W38A 3MU3A 5C9JB 4IKLA 3MYJA 3I75B 1KIQA 3GMMA 1QABA 3MA9L 4XNYH 5TDOA 2QHRH 4PJEB 4ZTOH 2VQUA 5INDB 5HDWA 1JMZA 2XNAB 4IGBB 4WKZB 2X6CA 5DJ6A 3U79A 4L1TA 4IBVA 3VYPA 5I74B 3GIVB 4M5YH 1PCXA 4RMVA 4UT9A 1ETJA 4UQ9A 2HFFB 1L9NA 4HJJL 2YAMA 5AVYB 1QO3A 3UTTE 4GUPA 3KDPB 2OKMA 2CA3A 3B5GA 1S46A 2W94A 3JTSB 3TJHD 3VRIB 1RMFL 3HHSB 4GFXA 3LXCA 4QRPE 3QNFA 1EA9C 3KPMA 2J8UB 4FC3E 5E8EB 3T4YA 4GSDH 4CW1A 1OAJA 3K6DA 5BQDA 4K23H 4M48L 3ARGA 2QVIA 4LLDB 4P5KB 4EN3D 2D7QA 1IVTA 4HZLA 2C4FT 4OI9A 3U7AA 2GJZB 4WU7A 4QJ5B 1NDMA 2RH0A 3VG0H 2OYMA 4HKJA 3FH8A 3CZFA 5KUMA 4TNVK 1I7UB 3CMOH 3LKRA 4H5SA 5IVXE 3EDJA 5DC4B 1SZNA 2GQHA 1VZGA 2CKBA 4IU2B 3S5LG 3L9RB 1EVTC 1GGUA 1I4FA 4LLQA 4YXLH 5F0MB 5TQ2L 5BRZD 1U2HA 3NABH 1VA9A 3C8DA 4MA1C 5B8CC 4ELME 1DBJH 3DNKA 3VH8B 1U3ZA 1J1PH 2Y72A 2P8LA 1QBBA 5EU5A 1LE9B 3PV6A 1TTGA 2F2HA 3SKMB 1J5CA 4IBUA 3IFPB 2DLHA 4JVPA 4ODWB 3GMNB 4HX1A 1P4IL 4MD0A 2G5BB 1ZT1A 3NN8B 3MLYL 1OP5H 3RU8L 2FR4A 1U3NA 5C09B 2X4QA 4ESKA 4UAOB 5KN5B 4NHCL 1XCTB 2JJUA 4YPGA 4OGXL 5IROA 4ADJA 2ATPA 3NPZB 4IM8A 1T6WA 5BRZB 2LV4A 1F1GA 4PYGA 4Y4HC 2V2WA 3LZQA 3IRCA 2G60L 1EEUA 1UD8A 2VXUH 4WY7L 2DQFA 3SYOA 3EO9L 2K7QA 5IROC 4P5MB 3B4NA 4NC2B 2A9NL 1S78C 1KG0B 1KYOK 2KDYA 3QXTA 4PGCB 2J1YA 5DD0L 1ZHBB 3SOBL 1RPUA 2O6EA 4JUSA 5E1GA 1KZYA 3UGUA 2CO4A 4J3BA 1I8AA 4XVTL 4FFYA 1EO8H 3W81A 5GRVK 1EXUB 3U2JA 3TURA 2NMSA 1OZTG 5E9DA 1U3HB 1K6QL 2F58L 2ITDA 2MCPH 3H6AA 4BZ2L 1LP9F 2F5AL 1B0WA 1I1AD 2BNUB 2CBPA 3TCXA 1J86A 2ZXEB 3MRCB 4OFVA 4Y4KC 4HC1A 4QTIL 3UDWA 4IHOA 3UP1A 3ZXAC 3BGAA 5LHDA 2VR5A 1BXXA 3SCMB 3PNWB 1RJZB 4DP8X 2IPKB 4HIEA 5ESAA 3Q9QA 2A6JA 4YHLH 2XBDA 1KLFA 5I23A 3CZSA 1HT6A 5AZ2H 4PRNA 3U4BH 3K80A 1NOLA 15C8L 2PCXA 3SKOB 2M26A 2HN7B 4JANB 2J1ZA 1J05A 2JKLA 4YLQT 1LO2H 1LK3L 5CSZA 3T2PA 3LKSA 1S2EA 4OH2A 2YUWA 4CMMB 3W11C 1NAMB 1XH3B 2DLFH 3MLWH 4RQQB 1JPST 3H3PH 2J72A 1KOAA 3CU1A 1B90A 1MELA 4A7GA 1N18A 2K9FB 3QO0B 4LLWB 3QFJD 4AQAB 4N5UA 3OLDA 5IFHL 4LHUG 4WEBL 4D0BB 2ZKXA 2QV2A 2CCWA 1DQIA 1KIQB 1ORSA 5TDOB 3WKPA 2ZKHH 3Q9PA 3VXRE 4JKPH 1IGIH 1S7RA 4IOFC 4IBWA 1GGCH 5FXCH 2GHZA 3SKJH 3DGCR 4KI5C 2GEEA 3BT0A 3UXFA 2ISDA 5ABZA 2E6PA 4B9IA 1C8PA 3GZQA 2AJSL 1ZSDA 4RETB 5JZ7D 2NY5H 3ML9A 2R69H 5IOKA 1LK2A 1L0QA 3KE0A 4HMEA 3ARFC 4FJZA 1U8JA 1MRCH 2EO7A 2VM4A 1AKJA 2GUYA 3DC0A 2MCPL 3OXSA 3QUZD 2B16A 2APSA 5B3SB 4JY4B 3TNNA 2ALWA 3RVVC 1F4WH 3EH2A 3T8XA 4JFPA 2N0MA 1ETZB 1FVEB 1PKQA 5EF1A 3TU6A 3L3KB 3L81A 5DD6A 5FHBH 3VJ6A 4A2HA 3RGVA 1NJ9A 2P4AB 2ADIA 1QPKA 1GZHC 3ZDXF 2Y5QA 1JHKH 1N4XL 2WXLA 5F7DB 1JXDA 4L0ZA 3I9AA 3D09A 5E4AA 3VU1A 4DK3A 2B1AH 3ZYJA 5K69A 4KTYA 5C0ND 1NGQH 4OUUA 1MDTA 3MJ7B 5C6PB 3FK3A 5FYJD 5HI5C 1EIBA 4UYPA 2EIKB 3K8KA 1BZEA 3L3OA 2FD6L 4I2XB 5E1QA 4NQDB 3HG3A 2A9ML 1QASA 4XCEA 3MLYH 3C5ZB 2BHFA 4MBOA 5EBLB 3BZ5A 4YHIB 5TE6L 1E2ZA 1WA2X 4KK5C 1EMTH 1YVLA 2XX1A 1ZXQA 3T1FB 5DD3L 2W0LA 4FJ6A 5AOMA 4R9HA 2PXYB 4OF6A 3D25B 3WLBB 3LRMA 4UQCA 1CD0A 3IDYC 1E9PB 5T3ZH 4N3TA 4HETA 2BCKA 3HAEG 5DRXA 2AGJH 5IEKB 4X4YA 1MIEL 2ADFL 3NDZE 2WB7A 3QVAA 5EV7A 1CU4L 3EFOA 5J1SC 4NYLB 1KLUA 4E9QA 4JZOA 3L4WA 5JHBA 5KWYC 1SXNA 1NLDH 3S36L 5F9JA 1E9QA 3EH5B 3WY2A 4B0MM 5I19H 3GMQB 3WAKA 4LSPL 5HDBE 3FQNB 4QHKI 2F74A 3QEQB 2EE0A 3KWUA 3VXPB 2YD6A 5DFWH 2J5LC 2V2XA 3WY1A 3O3BA 5AKTA 1C5BL 3RFZB 2ZX5A 3HI1B 1EBPA 4TLKA 5DI8B 4J4PA 4FXGB 2X0WA 2P26A 5SWSE 1JHTB 2Y5TA 4ETYA 1A6UL 3MRIB 1BVZA 1DBMH 1C12A 1LXMA 2BSTB 5GJSL 4RFNC 5IZ7A 2Q7AA 3PP3H 3MNVB 4U3SB 3VXSA 3VD0A 2IFFH 5KOMC 1MAML 3BVTA 2H3KA 2DJUA 2PETA 4NJ9H 5MEOB 1YYLH 3FCBA 3EBHA 4KX8A 4DZBB 2XPYA 3HZKA 1I8MB 5HYFA 2XT1B 1Q72L 1HFUA 1S6NA 2ZXBA 4HWEH 1GCYA 4K7PL 4KMLB 4PJEF 4UNUA 1P5UA 4N0RA 1TEYA 5DHVB 4E41E 1ID2A 4FCHA 1NC2D 2IDCA 1TQSA 2Y9RT 4PQXA 3U6XA 1SF5A 2NQCA 1AGFB 1N5AA 2UWEB 3CDZA 4Z7OE 1VF5C 5DJ8A 4LRIA 2DW5A 2IC2A 2X9XA 2EE2A 4H0IA 3OG4B 1YJDC 3S97C 4DQOH 2QKIC 3J8F7 2APVA 4ZS6C 1SEBA 1P7QA 5JXAL 4YSPA 3TH2T 3NJNA 5L8LB 1X5MA 3IJ7A 1KXTB 3LZPA 3VWJA 3L7EB 2L7QA 3DXAE 3HRZC 3FT1A 3FCSB 3OKMA 4JE4B 1T7WA 2BOLA 3BJLA 1G1CA 3CH1A 3E8UL 5DHMC 1BEYH 4H88H 1Y7VA 2ATAA 1EANA 2F54A 3GTTA 1FIEA 4H8UA 3P11H 3PP4L 1RLBA 4HPOH 3DRTA 4F8OA 1RK0A 2ZSWB 4OFYD 4Y4KA 3UDWC 4N2GA 1PG7H 2D4FA 3CFQA 2F7OA 4EBQH 4Y9GA 4KQ3H 4OUOA 1TITA 3MLSL 5HVFB 2Z4TA 1MCPL 3VB8A 4HISA 3PWLB 3HUJF 3FPXA 4PP1C 4AZUA 1DCEA 2MPAL 2ZX6A 1A1NB 2CLZB 2HRGA 3Q6FB 4NOBA 3BUQA 4OSUH 1XGYH 3PIQA 1TQWA 3DJ9A 1SDDB 3FQUB 4ZS7H 1IGTB 3VXQB 3MNVA 4IDLA 3Q48A 1EO7A 1VGKB 4ODVH 2HG0A 3VDBA 2DN7A 2IV8A 3T77B 5IJDC 3OGOE 5PCYA 4ZUWB 3BEWA 3NCYP 4YDIH 4YX2H 1GMEA 4OBRA 1ZHNA 1J5IA 4AH2A 4ZOAA 5TFSL 3P02A 1PAMA 1RUQL 4MAYD 5BXFA 2R39A 2WM0A 3UIZA 4OZIF 3TIEA 1Y18B 4MFHA 5IBUG 4CN4A 1FGNL 3QUXC 3VM7A 4FFZH 4QRTA 2V2XB 1HXMA 1UACH 1DDHB 1GC1H 1U8MA 4A55A 1ZK9A 3IEAA 2FX8H 3B3BA 3UACA 3LRLA 1RP9A 4LCWD 2WNKA 3WJMB 3SO3C 4KQ0A 1DFBH 2JQMA 4GKSB 1YPZE 1FFNB 5IQ9A 3CUPA 3WDJA 3K71A 3U0TB 3KGTA 3T0WA 3GXPA 1A3LL 1AE6L 4UNIA 1YEJH 4HS3A 4J2QA 3VFRA 2B9AA 2MQ3A 3ECBA 5E5MB 3U0TA 4HZAA 2AC0A 3MTRA 3RDJA 4BSWB 4NBZB 4YBQC 1NBYA 2IXQB 5B8CA 1D5IL 2EDDA 1RVFH 2L3BA 1KCBA 2IOMA 4R7DA 2DMKA 5E00A 3BFQG 2VDLB 2CK2A 2DH2A 5C07E 5H94A 4NQCD 1JUFA 2NSQA 3ME0B 1QA9A 5BMFH 4JS7A 3PREA 5TTRA 2J4WH 4FEIA 3BAWA 3W9EB 5FOBA 1Z9LA 3BAEL 1QNZH 3QUML 3KJ6H 1U8NA 2GBVA 3T6ZA 4YHZH 5DEGA 4XCEB 1BG9A 2XQYA 3PNRB 1U6AL 3REWA 3VE0A 3KCWA 5CNHA 1IB5A 1YHPA 3MLRH 4B9JA 3DJRA 2Q6WB 3QWOB 1F2QA 3E8VA 2QQNH 3WO3B 2J73A 2JV6A 3UTSD 3KYMA 2W60A 1RUPL 4JO3H 4YMPA 2QFRA 5GGVY 2L0DA 2XKUA 4A1RA 2C9XA 1OB1B 2BS8A 3DRQB 1SLXA 3NRFA 4YC2C 3PWLA 2WQ8A 2A74B 3OG6B 1KIPB 5IFAH 4UIKH 3OQ3B 4JFHE 4PJXA 4JDVB 1BMGA 4BFNA 4N20A 4N0YL 2XHNA 4PJ9D 1TKWA 3N1GC 3EJYD 3KLAA 2JQZA 2VC2L 1GTFA 1ZXKA 2GHWB 3QWOA 2VDOB 2X4RB 1HI6A 4Z95L 5H8DA 3F5WA 2W5PA 4J1UA 3S37X 3WD5H 1H3TA 3SQOL 3OKYA 1UOWA 2GCYB 3QJFB 4OGXH 4TYUA 1BAWA 1LVEA 2JKTM 4I0KA 3VXOA 1MUJB 2X3BA 5DEGB 2COQA 4X5QA 5ALCL 5CHNB 5GS0L 1F11A 3L4TA 1BIIA 3DX7A 4GYBA 4P23C 1DVFD 2HH0H 5HJBA 4PR5A 3T3MF 1OP9A 4N9OB 3W9DA 2VDPH 3VXUB 4HWEL 2CE6A 4C56A 3RI5F 4JKPL 4WF7A 1I3VA 4WZ9A 3QULA 3T08A 1SDAB 3V79C 1QNIA 1QI3A 4C54A 1U8HA 1XBDA 3AG4B 5I74C 2HTKC 4WUUA 1KN4H 4A39A 2BERA 3P30H 5FGBA 1BQUA 2DF3A 3ECBB 3IMTA 3INUH 1S5IL 1MCOH 5E6YA 4CKVX 1P5UB 1Q9LA 4PCTA 1U2CA 3BVXA 5I6XC 4PJBB 5IIEB 1XWVA 4LIQH 4F93B 3EFFA 5EO9A 2VXTH 3MOAL 3CFTA 5C0AA 2P28B 4R6UA 5E2VL 1G1OA 2XZCL 4GAJH 4IIQA 2ZCKL 2Z7WA 4JO5A 3KDMA 1NM9A 1AIFA 1FBIL 4I9XA 1C5BH 4UT9L 4EDWH 2Y0SA 2FHBA 3TBSB 1W72H 3UBXG 1KT2A 1MCLA 2P5EB 3B7TA 2ENJA 3GZKA 4KDTC 2EIZB 4CNIB 3HR6A 1ZTXE 4LZKA 4NAMA 5GISH 3L6FB 4H8WL 2BWDA 2ZPKL 1HYSC 4TUOA 1PLBA 5T1KD 3G08A 3KPPA 4KNQA 1YEDB 2QR0A 4TSCH 4A2FA 5KYYA 1MI5D 5J0BA 5CD5C 1Q8MA 3OD3A 1DVZA 4GMSH 4WFFE 1D2OA 5HP5A 3CVHL 3DMMC 5F89B 5L4FA 4OCRH 2CXKA 5DTFA 4G7RB 3KPSE 5F9JB 3ZE1F 5F70A 4ZW7A 3FU3A 3KHOA 3OAZK 1IGCH 1E5ZA 1I9EA 1FRGH 2Z35B 5DD3H 4JY5L 3CCHB 4XC3L 5D5MF 3IKKA 1OTTD 3GT6A 2QELA 1IM3D 1MIML 5CR8A 1P5VA 4I4WB 5EF0A 4TVPL 4XX1G 3DOSA 4FQQB 2JF1A 5TFSH 1N6QL 2EDYA 1TEGA 3JSSA 4PR5B 3W9DB 1WLHA 2PXYD 3DHJA 1KBKA 2Y22A 5JA8B 2YA0A 4I18C 1LO2L 4ZQKA 4LLQB 1FYTA 1DO6A 1MVYA 3MJ6A 4FNLH 5CHNA 4IOIA 3G5VB 3K6IA 3BRDA 3H9HA 1X9RA 3IN2A 4LCCA 1FH5L 4AQ1A 3ATEA 1GIGH 2Y69B 4P2RE 1W91A 2HCZX 3TVMB 2MQCA 5I1DB 2DJMA 4QF1A 4IOSD 3W0WE 4GKLA 3ZQ9A 3HNSL 4K7PY 4ZNEE 1UEYA 4JG9A 4WV1A 5EC2A 4PVNA 5DWPA 6CGTA 2JTYA 5LJYH 2ICWI 2G9HB 1F4YL 5DFVC 2FH8A 2E27L 2XN9E 3KYAA 2Y1AA 1SY6A 5JNYA 1CGUA 2QL1A 1F4YH 1KTLB 2V9TA 3OBAA 3QIWC 3OMAB 2ARJA 3CK0L 3G6JE 4POUB 1HN1A 1OCOB 1O6SA 1EZVY 3RA7H 3L2NA 1CFBA 3E80A 3EYOA 4QI3A 4XZ4A 1DYZA 1TJXA 4PBWD 3MVSA 1OF0A 3QXDB 3RPBA 4K94H 5I76A 3CFEA 3DTXA 3D3VA 3EYQC 3OPZL 1GSKA 1TQVA 3FYIB 3V7MA 4GP5B 3L5XL 4GUOA 4K0OA 4XMVA 3HG5A 1CE6B 1ZLSH 4J23A 3BO8B 1AQKH 2Z8WC 5JHLH 3ZHFA 3GLEA 3EF4A 1JF1A 2C8NA 2WUCH 1MZYA 4IRSA 4Y9FA 5I1JL 5EZJA 5SWSB 4Y16B 4M61B 1JHTA 2X3AA 1MLBA 1BQHA 2DLGA 2RJMA 4N0UA 4NJAH 4WJKB 3EYSL 1ORSB 1MCOL 2PCPB 2N3JA 5AEAA 4KITB 3UJJH 5CLYA 5H35A 4UV4H 2SEBA 3ARZA 5I8OL 4AV0A 2V8LA 1S7XA 3U1SH 1G5GA 1YMHA 1R6VA 5F1KC 1Q4NX 2DD8L 4MQ7A 3DDFA 4E5XB 3DTDA 1UJTA 4G7SB 1UJ3A 4HIXL 3O3AB 4R0LC 4UQ3B 3ZTCC 4O00A 5TD4A 5HHMD 3PPEA 1ACYL 1DUZA 5GRXG 3LAFA 3VI3B 1FVDB 1OSEA 1K5NB 4V11A 1B2WH 3V2AR 3HEIB 3IETB 3HI5H 4E5XG 2F53E 4XCNA 1XXFC 1KWGA 2DYRB 1UM6H 2YEZA 3JV4B 3QUXB 4D8PA 3EJPA 2VQ1A 4O2CB 3RL1A 3K71B 3EGDB 3MV8E 3E6HA 5DRXB 4G59C 2G2PA 1I9JL 1PY4A 2BRQA 2GC7C 1RJZA 3IK2A 5TE4H 5FO2A 5C6WH 4MDJB 1F4HA 1PLGL 4MMZC 5FC9A 1T83A 2XTJD 5I2IB 2ZX8A 1KY6A 2R83A 2XG5A 1HEZB 3ZKSD 2ADJA 4J28A 1N59A 1UWXH 4DP9X 5IVZA 1Q9OA 1CTOA 4QXUL 1RIUL 3SDXF 3EXLA 4UTBL 1EXUA 1PBYA 4I3RL 3T4AA 5DRNB 4JKMA 1CMOA 1RZIB 2IPUK 4KZDH 1XIWA 1UWXK 4QHUA 2Q0ZX 2DM4A 4L1LA 4L0PB 5D1QA 3QBTB 4MZIA 1VEPA 1MFBL 4GAAA 1WZKA 5FDWB 4Q97A 2DQFB 3VTTA 1QPXA 3MRFA 4S0HA 1KEGL 1CLCA 3Q5TA 2C9RA 1AP2A 2AGJL 2VH5L 3MRMB 4LEXH 1D7FA 2FWOB 3ZYZA 3QS2A 2DQEH 5FW6A 5FPIA 3P77B 2WVVB 2HKFL 4OGAD 5F96L 3RGVB 2YKLL 1Z32X 4PRDB 3L1FA 3OMIB 4L4VD 1KEMH 2VAJA 1DBJL 1QFHA 4ODTL 1A7NH 2NUTB 3Q3GA 4LEBA 1X5KA 1BYPA 4B9KC 2C1PB 1ROWA 5IKCA 1NGPL 3FQWA 1QSEB 3MAWA 1AKJB 3ARUA 4JG5A 5A1AA 1PAZA 1FNEB 1MWAA 3FT0A 1NGYA 2CDFB 2XIDA 3EGSA 2H41A 2P5WA 2LVEA 2O6CA 4FXTA 5F7WC 3KCPA 4X8CA 4Y89A 1UM6L 4YLCA 5DRWB 4ACTA 2F54B 1J5HA 1JK9A 2CUMA 3L48A 4K9EH 2BVOB 5D1QB 5BS0E 3LB6D 3I9GH 3EO1B 3NQIA 1OOWA 4XMKL 2AXFB 4ZBJA 2Q8BL 3NK3A 1QEWA 4JN1L 3TT1H 4ZW6A 1YEJL 2X4TB 5LAPA 4UANA 4UF7C 4X9IA 5D7IE 3MV7A 1Z2KA 1SFDA 5TF1H 5DFAA 2EXSA 5GSRB 2O61A 3AS1A 3QQ9D 5D2NB 1P7HL 4JG1H 5F7NC 5AD0A 4BA8A 2FQGA 4A2GA 3V0FA 5LVEA 3CDGB 4J3VA 3WOVA 1GC1L 2ZOTA 4OGAC 1DQDL 2E9IA 4JPVL 1OGAD 1JSYA 2OS7A 4M7LH 2EUVA 4YHMH 2J57A 2UUDK 3BQVA 3GYRA 1AQKL 4QOKA 4HHGA 3QXAB 3LRSB 1U91B 4FG6C 4G8GA 4L2YA 3WEBA 1NC2A 1NCAH 4JJ5B 1F1AA 4G80B 5L88L 3LQAL 3FU7B 3ARDC 3CQPA 5JUEH 5E8OA 2EH7H 3U9UB 5FECA 1IC1A 1IGJB 5T5NG 1U93B 3A67H 4PJCB 4Q2ZA 5I8CA 1SJHB 1T1ZB 3V4UL 4JFYA 4W9LC 3LYRA 4GRWF 3PHQB 1ZDSA 3AWGA 4OM0L 1SEQH 2FIKB 4XPAH 2OSLA 1BIIB 2VLJA 4JRLA 4HK0A 3HUJA 2EYRB 5B38B 4YL4A 3LKPB 1TZIB 4KY1H 4HD9A 5L7XH 2MKWA 5BS0B 1LK3H 2FO8A 5HSFA 4LCCC 1IGFL 1MWAH 5EEZA 5J13C 1UQSA 4NQDE 4F9PA 5EO1B 1JPTH 2Z1PA 3M86A 5I9QC 3DSFL 4JREB 1BF2A 4ZT1A 3EGSB 4ZUSB 1FFRA 2EYTA 5FUZL 3H42H 4Q9RH 5KSVA 3CHSA 4PV8A 2C1PA 3CDFA 3H56A 5C07D 2E59A 5I16A 1N7ML 4UTBA 3KR3H 1VCAA 3PV7A 4FQLH 1JNLL 5ADOL 3UC2A 4L05A 2C9QA 1AZCA 1L9SA 2N56A 1XSOA 3HOGA 1LE9A 3PWJB 3V6BR 5HY9A 3T1FA 4G5ZH 3W39A 4OFQA 3TBTA 2JI3A 1JGEB 2N7SA 3P2DA 3B2VL 3TWCL 4O5LL 1ZT7B 3ZIYA 1NANI 2E3VA 4PGJA 4M6NH 3UYRL 5FM5M 2XV6B 3L3GB 4NNYB 3MRNB 2B7DT 3HCVA 4PRBA 2QQKL 1CFVH 4LB8A 1IARB 2NOYA 4QRRD 2R7EA 4AGMA 5JOFA 3OR7B 3F04A 4ILDA 2W88A 5DWUH 4G82A 3Q1SH 3QCTL 2MEJB 4PJGE 3PWJA 4QOKE 1NKOA 4KC3B 1NZRA 4FFVD 1MPAL 1NJ9B 3KLHD 3BYTA 1BM3L 2WXFA 4M6OH 3O9WC 2J2ZA 3JV4A 5TGBB 3NDYE 3WN5C 2WZ0A 1HILA 4I3SH 2IF7A 5AOJA 2P24B 5KSVB 1YNTB 2F68X 5LGJA 3VSVA 2EUZA 3WN5B 4OD3H 4LOUC 1LO4L 1OALA 2F8OA 5KVGH 1XZ0A 3M1OA 1FL6A 2BFVH 1KC5L 5D1XE 3DX8A 4EZMA 1H3XA 1MRFL 4JFQB 1IC4H 3EYUL 1ZD6A 1GYWA 5FYKL 4TTDD 3HLAB 1BVKB 4HALA 3R18A 1OEZW 4U33A 3UFIA 3RWCB 4ICXA 4KKCD 3SDXB 1OXYA 3E0GA 1TZIA 1T4WA 3FONB 2C3XA 4JFDB 4P5SA 5GS1C 2IEPA 1LWHA 4HKXA 1EJOL 4MNQE 1FNGA 4WLCA 2CGRL 4M43L 3U1SL 3BH9B 3AWEA 3NFNA 1IL1A 5F96H 3BZ4A 4CBZA 3GQFA 3U9PL 2OR8A 3DX6A 5CILL 1RHHB 3U4BL 2RCSH 4JPIB 4HUWA 4N6QA 4M6ML 2E74C 1UB6A 1S7VB 4JN2B 1VEOA 2FD6H 3VFGL 4NC1E 2ZD0A 1B0GA 1WWWX 1W8OA 2VJXA 1KJ2L 1MCRA 4FTDA 3KZ8A 4DGYH 3BVUA 2VN6A 4OZHE 3WNOA 3P69A 1AGBB 3LD8B 1JNNH 3EF7A 4F92B 1DVTA 4LFHD 2EKSB 1J0JA 3UPRA 3FB6A 3PGDB 2G9HA 3O11A 3LIUA 3F7VB 2Y3AA 3Q8EA 4I1NB 3U36B 5HHPA 3WHXA 3EDDA 3NIFE 1JGIA 2IADA 4HULB 4P4KA 3S7GA 1JDDA 4FE9A 4OZ4B 2AI0L 1DLFL 4M1CC 4GS7B 4NKOA 4I3SL 1D7BA 4JE0A 2XJLA 5HTSA 4AJWA 1JGDB 2H1LM 3LMJL 4FA7B 1HYSD 5EU6A 4BFKA 2EZ0D 1DE4B 3ILPB 3DGDA 2FUQA 3H8NA 3HS8A 3TV8A 2IGTA 3B8SA 3C5SA 3APFA 5HHOE 2AJUL 2KH2B 1KG0A 3BFOA 1VFBB 3KWWA 1PMYA 1MFVA 4P46C 2CHXA 2DBJA 2WLHA 4PB9H 3EIFA 1P53A 1KFGA 5DJ8B 3WELA 1ZANL 1FNEA 1MWAB 3MDJA 3MXVL 3N50A 2KZBA 3NEEA 4W93A 1HHIB 2GFBB 4Q7DA 3QIUA 3ATFA 5F8QC 5ID1B 1PEWA 3FO2B 4HCIA 5GZNC 1OPOA 3GJFA 3IJEB 1GOHA 2HVKA 2UX7A 4OIIL 1ETB1 2Q3ZA 5CINL 1N26A 3OAUL 1ZT4B 5K9QI 3AQDA 4P49A 2M1KA 1NCDL 1CE1H 1QFOA 4W70A 1X5AA 3POHA 2HVJB 3BUDA 2E75C 2YEQA 1ZGLA 3WFHB 3BKCL 3OB8A 3TZVD 3LCYA 1T1XA 1PNDA 3MBED 5AYUH 3RGVC 1AE6H 4JCMA 5I1GL 1NKGA 1NCDH 1WBZA 5CJ8A 4N5EC 2VXQL 2Y2TA 4Q9QL 1TSRA 1YY9C 4HSQA 5FLVA 2CRYA 1R24A 4M6OL 5FYLH 4G72B 3QCUH 3QH3A 3P3TA 1GAFL 4B3VA 1JZ3A 3V4PA 1QFUH 1RCYA 2Q87A 1G0YR 4PRIB 1HEZA 3CZFB 4BZ2H 2CHWA 5K33A 3UJIL 1TQBB 3TBBA 2F74B 5CXPA 4X4KA 2YD5A 2HUHA 4WNSA 4RX4D 4MCZB 2BY1A 5CUSL 2VW4A 1PF3A 4JZNB 1S9YA 2AJUH 3MLXH 4OM1H 4B0MB 4ICWA 3WMQA 2XA8L 2Y1VA 2WYZA 3KG5A 3JWNG 3V8OA 2QQLH 2ZXGA 5E6SB 3A4FA 3AXHA 3QI9A 4XAKD 4AYGA 1FSKB 5ECJE 4O5LH 4DKAA 1G9NL 4HH8A 1S7SB 3ARVA 2CJSA 4RBPK 1OAUH 4H8VA 2AQSA 4I9WE 3NZHH 1BXVA 1F42A 3RJQB 2VZ1A 2EVIA 4G70B 4KQ3L 4QRTB 3LKNB 5INDA 3LNGA 5IJVB 1SUJA 2Z6FA 2FJGA 3PY9A 3DDGA 2IAMB 2GJ6E 1XB6A 4PN6A 1TFHA 1Z3GH 3LV3B 3ARDB 5BW7A 5ICUA 2X53A 1L4IA 4OT1L 5DQ9B 3ECVA 4F7CB 1IM3B 5E99L 1OCWH 3F6LA 2QZ5A 4HIHB 2UY6A 2VR4A 4TF4A 3UG5A 4EI5D 5T3XE 5HYJB 3QFDB 4KDWA 4XNXL 1KACB 5CCHE 3OKEB 2R9HD 3QIWA 2ITFA 2ZCLH 4LCWE 4EUPH 3QDGD 1X3DA 2WXQA 4Y4HB 5A16B 1R5VA 1KB5A 3VCLA 5CZXD 3D3VB 1EHNA 1M71A 4LEEA 2HLAB 3CHQA 2YQBA 1A1NA 2CLZA 2PMZA 4FQXC 3TO4D 2BNRD 4NN6C 2D03H 1Y07A 1E9OB 4I3GA 3JWOH 4HQQH 4QRAA 5B4MC 2DI8A 2Q5BA 1ZLVK 4M7LT 5DS8B 1MCNA 1IEAB 1Z9SB 2CQVA 2G5UA 4LHUD 3WE1A 4HEME 1K6QH 4U1HB 4W68A 4KXCA 3ZSTA 4MLIA 1W0VB 3RY6A 3MZTA 5GRJL 4WUUD 4NWUH 1ZLVH 3FO1A 1MCKA 3P4NA 3I6KB 3KL3A 2NYZA 3QIWB 3FHEA 2V6HA 4MB1A 3HMXL 4JZJC 4Z3GA 3DVGB 1G9MH 3FXIC 3A67L 4HKZB 2DQHH 4QF1B 4UT6H 3MO1A 4JFFB 4Y4FD 1S7RB 2OZ4H 1YNLH 4Y5XB 3ZDWA 3WAJA 4HCGA 3V95A 4Q89A 2DL2A 1BD2A 3ARDA 1USZA 2VABB 5EIIB 4P2OB 1MAMH 4NRZA 5FOBB 3ULUF 5E6IB 3DGGB 3PXJA 2O6PA 3FFCE 4NI3A 3T6VA 5I71C 1LLAA 3HNVH 1WZMA 5DUMH 2W07B 4HIJB 2WKOA 1P4IH 3GRWA 3KYOA 2YXWA 3F8UB 1AQMA 3QGVA 4PRAB 1AY1L 5D6CB 1KLGA 4Q56A 5E1AB 4DTGH 4LNVA 1TT6A 1F0LA 1OTSC 3RY5A 4ERSL 5FX3A 4U1KB 2FWUA 5IBTH 3NJGA 1RFDH 4OFDA 4W6XB 1OD9A 4ZPVB 1TMQA 2XBTA 3FU8A 3IDGA 2GSMB 3G5WA 4ZD3L 3DK0A 2X1PA 4I18A 1IM9D 5H2BA 4ONFH 4CDGC 3FSAA 3VXMD 5F6HI 3AG1B 1VIWA 2IO5A 3P0YH 3C60A 2NY6C 3C9NA 3NQKA 2VAAA 1DN0A 1PFCA 3MHZA 4GBXB 4F7PA 3CFIC 2DWYA 3B34A 2X12A 3ARFB 2GSGB 5D7JD 4CMHC 3MBXL 4RZCB 2ZUVA 4K5LA 5IB3A 4KKNA 3NRQA 3A3YB 4ELDA 2EEAA 3L6FA 3V4LA 3GSQA 1IQWL 3RUGA 3AAZB 2VLRE 2UVEA 1LMIA 3OSVA 3Q8CA 2CA4A 2PWHA 2P47B 4G71B 4RZCA 5CBEA 3UCQA 4PGCA 2CSPA 5I0XA 1WUNT 1UWFA 4AVHA 3AUVA 2DYPB 3N55A 5JHDA 3AB0B 3TEYA 3BSZH 4FDWA 5F7EL 4IMLB 1CXIA 5D71H 3TO4C 2W1NA 1ZVNA 4PY8I 2NY1D 3MJ9H 3PQYE 4GW4A 3VW3L 4X5RA 5EN2A 4KNTA 3VG9B 4DFIA 1ADQL 3UROR 1X5GA 2D7TL 2NX5D 4NZTH 5AW3B 4X7SL 1XBRA 5DJDB 4DP7X 1HCYA 3IMRA 4NYLA 1Z3GL 3BCFA 1EAQA 4YHNA 4OLUH 3OLGA 3AABA 2MCG1 1I7TA 4XXDB 1WA1X 3LXBA 1M7XA 3VH8G 5HYJD 3LSOA 4K5PA 4EAEA 1JI2A 5D7EA 4LRIC 4MJHA 1EZLA 3CVHB 1TTUA 5EBMB 1XSJA 3C8HA 1BPLB 3QDGB 5LXGH 4FULA 1RXLA 4LLYB 4JX0A 5EUKB 3DGGA 1OP4A 5CZVH 1WYJA 4L4VB 3F64A 4MAYB 3OC5A 1MFCL 4P2OA 2BO0A 4U6YA 4Y19E 4OLZH 3GM0A 4IU2A 1F58L 4XPFH 1B9KA 3S9DB 4Z1PA 1OPGL 5I1KL 2NW2B 2IGFH 1F6LL 4S0SD 3V0WL 4A2DA 3NJVA 4X80H 5D7JC 1UTDA 4BGLA 2H8PB 2VZ3A 2VN5A 2A77L 2NY6D 3DVGA 3JQOB 1DL7H 1ZOXA 2XN1A 4ISVB 3LNDA 4OCSH 2D9QB 1JYVA 2CDGA 1JWSB 1A7PH 4U6XA 5C0BD 5EU4B 3MJGX 4LPYA 4DO4A 3CXDH 4HUMB 1FWXA 1A6AA 4XXDA 5TK2A 4LL4A 3TASA 2J1WA 3ZE0F 5DK0A 3LPWA 4LO9A 5IM7B 1JYXA 3L1OL 3QO1B 4JHAH 5TE7L 1HQRB 2H3XC 2E9GA 3FQYA 3LEVH 5DS8A 1NPUA 1JZ2A 1F3DJ 4Y4FB 1A7PL 2OMXB 2A73A 4PJ8B 1JMXA 1AR1D 3IJHB 2P44B 3JTSA 4X7FC 1INQB 3CD4A 1VPOL 1HINL 1Q9WA 2DLFL 2QGEA 3ROOB 5AYUL 4F3FA 1KB5B 4WEMB 3IMWA 1VZHA 1AOZA 2O5ZH 5ENWB 3QDJD 2FZ3B 3L8QA 3OKKA 4PI2A 4N68A 3I2CH 3J07A 4X4ME 1NMAL 1KPRA 5ESQB 2W80C 3IDNB 1BF8A 1XF4B 1ZEAL 2Y5EA 3NJFA 3QUGA 4BZ1L 4FG4A 2LAGB 4KO5A 2C5DC 4L3EE 1O0VA 3N6YA 4EZLA 1FO0A 4GW5A 5AFAA 3RFZA 1OW0A 2HKFH 4FQCL 4ZNCD 5HHOA 4F7PB 5J5EA 2GW5A 3HAEA 4HCRL 2CO6A 4FZ8L 1HZHH 2Z91B 2GT9B 6PAZA 2R8SL 3SE3C 5AW8B 4MXQC 4I0PD 3WLWC 5SWQA 2OMZA 3FT3B 1T2QL 1EDYA 2JELL 3MV7D 5D1XD 2BC4A 2ZP0T 1GIGL 4X98A 1UGKA 4DKEH 2ETWA 3O3EA 4HIIA 2IAND 4FFTA 4I8DA 1MW3A 5F97E 3S5YA 4LSPH 4UQAA 4DGUA 1NFIA 1PZSA 1A3QA 2NT0A 2DWDA 3HG1D 1JZ5A 4JREC 5E9NA 3EUUA 3RZWA 3OKOB 2VR9A 1JPGA 1A3ZA 1H3PL 4IHOB 4BUQA 1CFTB 1T7YA 2GT9A 1OT2A 2NDFA 2V4LA 4WU5B 2YN3A 5B4MD 5I15L 2V17H 3BWAA 4YHIA 5IW6A 3QEQD 1I9JH 2CBOA 2MQGA 2A83A 2YRBA 4UB0L 5D96B 3DMMB 3ENEA 4K55A 4TV3A 5AW2B 2F61A 5GGQH 1AI1H 1EUTA 3VWKC 5BXFB 3VXUE 1C9SA 2ZUSA 1G4RA 1MJ7H 2VKXA 4O58L 4P59L 3DV4B 2Q7YB 1SVCP 1U8QA 3FRPB 4HT1H 5ESQA 2H6OA 4LL1A 2V5MA 4MMYA 4NWTL 3T3ME 2XWDA 3TYGL 1JZGA 4ERSH 2VH5H 3S4SB 3TV3H 1LQBC 4N2HA 3EBIA 5E7FA 4HOXA 2IPTL 5AQ0A 2LTQC 1KELL 4GRWH 1E27A 4RSYA 1W0VA 2XIBA 3MV7E 2BZCA 1H9DA 2LHAA 2A6KB 4HWBA 4PREA 3VJ6B 3JZYA 4YSAA 2FDBP 4FRWA 3VDCA 2AK4D 2X2HA 3U4KA 5FCUH 3IJEA 1K9TA 1P4LA 1UJ3C 3FO9B 4BHUI 5LGHL 4PJHE 4OCYL 4QRRE 1XGPA 3OZKA 4JM0A 1OARH 5A2BA 1A6AB 1OAXH 2Z64C 2PWGA 3OKLB 3HZYB 4HGWA 4KKQA 1LDPL 1QR4A 4QHNA 4UT9H 5FHBL 4LSUL 2WQVA 4JFEB 1UZGA 4L3ED 3AT9A 4F37K 3QNZA 4AEHH 4BYHA 3AUWB 3ATAA 4G8FB 4JGUA 4Q58C 2H8PA 3N85H 4HIHA 5HI3D 4WI8A 2ZAIA 1OIOA 3Q2VA 2FJFA 3KNBB 2R59A 4G7QB 5C0CD 4UT6A 4HUVA 1RJLA 2FJHA 3DHMA 4J8QA 3K2KA 1XCQB 3HG2A 1OT4A 4MXVF 5T1MB 4BFOA 3MPCA 1XF2B 1WS8A 1XGUB 2Y23A 4HV8B 3S88H 2FO4A 4RMSA 3IVKA 1J9CT 2GTZA 1SVZA 1X5YA 3PE9A 3IGLA 3WY3A 1BBDL 1QSFD 4K9JA 2AXGA 2OL3B 1Y6NR 1HQ4A 5LKNA 1AJ7L 1KPUB 2EP6A 1MJ7L 5DHEA 5DK2B 2ZCLL 5DQDH 5IHUL 2J5WA 1NGZA 3RGVD 4NZRH 3ZPDA 1AXSA 4PP2A 5GZND 1KXQA 4LLMA 4QR7A 1DP0A 2FBRA 3HZKB 1BECA 3N41B 3SCMA 3ORJA 2NY4D 1K4CB 3WL9B 3PHOB 4F2ME 3KYKL 4FN0A 3S35X 1JFQH 4BQBA 3T65B 5H4ZA 1DSYA 4XNZB 4UQ2B 3NIFF 4LARL 3TA3A 4M7JH 2DYPA 2VO5A 3BZ4B 4AEIH 2J71A 3C75A 4X9HA 4CSTA 4ZMPA 5JHDB 2BMKB 3D2UA 2YQGA 4FQLL 1KGCE 3ZDYB 4XBGA 2W91A 3B9KC 2FWSA 4B97A 2IG2L 5GGRA 3AU1A 5EIVA 1OCRB 2X2UA 5HYEA 3OC8A 5EFIA 2PYEA 5FW7A 1DFBL 3TBWA 3CNKA 3QORA 2EDLA 3G6JF 3QHZL 4F2MB 1FZOA 3N1QC 3U46B 3GHEL 3MOBH 3TJHC 2HKHL 3NP4A 2PW2B 4DKDC 4BFBD 4E9VA 4KK8D 2ZQKA 3A47A 4MVBD 1NC4A 3P73B 2D3VA 3F84A 4GEJA 4WTWA 2CKBL 3QJTB 4LF3B 4Z7QF 5C09E 1FNHA 5KYNA 3EFOB 1DBKH 2EABA 1JJUA 4AKPA 5JR1L 4X5PA 4JJOA 5ID1A 2D0FA 2G60H 4X4YB 4LPTA 3NEOA 1FH2A 1VGEH 3W0WB 2QJDA 2R4RL 2ZG2A 2R0KH 2CUAA 2AJXH 2AQ3A 1NBZA 1JD7A 2FUTA 3O2VL 2ENQA 4YUEH 3AITA 2M83A 2OZNA 3HUJE 3I6SA 1X5XA 3D34A 1DJSA 5EBLA 1MCJA 2KZKA 2FNWA 5TPWL 3NCMA 1CXLA 4Y16D 3DYPA 3EBGA 4GG8A 2Y7LA 5A40E 2BHUA 5L88H 4IRZL 2AHIA 4Q6IA 4G9FE 4S0TD 3B6SB 2BZ7A 3FSWA 1O7SA 3ISRA 3L9YA 3TIDA 3HBPA 5SX4H 3W0WD 3CFKA 4Y4KD 2VW7A 2QVMA 2YWZA 4IBSA 4B6ZA 3AQXA 2BSRA 4YXLL 3WXVL 3OB0H 3WHXB 3N40F 4JRYA 4Y9EA 3FQ2A 4JCWA 4JFHD 4QTHA 3DPBA 4HZLB 3E7JA 5CGTA 3EYVA 1TZOA 1TQBC 1BEYL 3F85A 3FTUA 1QG3A 3E8UH 5IOPA 2PCFA 5F9DC 1WS7A 5BUAA 3ZKXB 1XO8A 1LE5B 3B5TA 5D4JA 5HBBA 1AXIB 5DD6B 3HC0A 2EZ0C 1BVNP 2YRZA 3Q5YA 4N87A 4LKCB 2YAFA 4QCIA 4DEPC 1FVDA 4R4ND 2P7TB 2KMWA 5ANME 4ADIA 1QO3B 4Y5VA 3FT9A 1K4DB 4XXCA 4OF0A 5I26A 4Z95H 1U8JB 3T3MB 3BKMH 5GXBB 1KFAH 2D4DA 2K3HA 2R4SH 3LMJH 3LZFH 4HUWB 1SN2A 2DEYX 5IBUB 1FPTH 5TJWK 3X3FL 4Z3TA 1A21A 4NQTA 4BJLA 1RERA 1WIPA 3VFTA 1XZWA 1JCKA 2XC8A 4GQ9L 4PJEA 5K59E 3DOIA 4LIQL 2HX8A 3KHQA 1VFAA 3MLTA 3FOMB 3QWQB 1CB4A 3FONA 2OCCB 1SJEB 4WI6A 1ZTXL 3DSNA 1IMHC 2CBQA 2UXVA 1U3JA 1JGVL 4KH9A 2VISA 4LEXL 5FA4B 3KPLB 3SY0A 1CE6A 5AAWC 2QQNL 5IJKC 4JM2B 4AI7A 1FL6B 2ICWA 4MWFB 5AOKA 2F08A 1K4DA 3G7TA 3PDOA 5HHNB 3V0GA 2J8OA 3WS3B 3EYOB 1I1FA 3ARGD 4EN3A 2RCSL 4HUNB 3II3A 4LSUH 2ICCA 5IR1A 3UP6A 4HS8H 4MKMA 2K7PA 1NCIA 2BOCB 4GIPD 4KVCH 1I9RL 2F8VA 3QHFL 4XBEL 5AENA 1P0SE 2PP7A 5G5DA 2I27N 2RD0A 3MBEA 2FHCA 3JV5A 4LVEA 4XN5A 1VCBC 5I6MA 1QP1A 2KQNA 4JVWA 5DJXA 4GRWE 4LVOB 3EOAB 4KVCL 5BCAA 5IQ7H 1F97A 4P4RA 1E4JA 1U0QA 3NPSC 1TZGH 2UY7A 3QH3B 4N5ED 1MG3C 4PRBB 4XCCH 4EIZC 1I3RB 1LD9B 5KW9H 3M45A 4GY4A 4YZFE 3ULAB 3KNBA 4AGNA 5HHQA 4L3AA 3HN3A 1A6WL 1LO4H 2AXFA 1ZHBA 5KJ4A 3TYGH 2XRAH 4KRPC 2VDKH 2V3FA 2ITEA 3FQXA 4QIRA 5DD1H 2VKWA 4KX9A 3UMTA 5LCVA 1RZFH 3QCVH 5HY9B 4KRPB 5DJCA 5KSBF 4MB4A 3VDAA 4QHNB 3LDBC 4FQQA 3GBNH 4ODSL 3NCCB 3QDJA 4R8WL 3PJNA 3VQLA 4JM2D 1TLKA 1RL1A 3MLRL 1J10A 1P5VB 3VFNA 4ODSH 2NR6C 2Q76B 2Z92A 1BXUA 1RUQH 2UZPA 3CFNA 3GJFB 2AANA 1OP3K 2W81C 5I16B 4IIZA 3S35L 1CDJA 5CFHA 4FFZA 3VD5A 3HJEA 4A7UA 3WE6B 2OV0A 3SOTA 2Q86B 2NR6A 2PNDA 4M6NL 2C3HA 4G42B 5CN2A 3KW8A 1AZUA 1S8DA 2HT3C 1T0PB 5DZJA 3BGMA 3SKNB 3AXLA 1S4IA 4CKQA 3FUKA 3GDCA 2L7JA 4IBLT 4PSRA 2ZAGA 4R0LB 4DN4H 3KEDA 3MLSH 2CKBB 2CPUA 2X1QA 4X9BA 4QXGL 4AVKA 4H25A 5F6IB 1I9RH 1B2YA 3WUZA 4XBPB 5F7EH 1A47A 1A6TA 4NKDA 1QW8A 4YOKA 2CDEB 1PQZA 3I6GB 4LCWA 4BE6A 1HH6B 2VDOL 1CQYA 3D18A 3NEXA 2BNQB 4KRNA 4M5ZH 5CS7A 2VC2B 2IQ9H 2E4FA 4G6ML 4MDJA 4G43B 1MAJA 4Q2ZB 3QORD 3RAJL 3NTCH 4D3CL 5CN3A 3EFFB 5D7SH 1FAIL 5K5YA 2VQ1B 3BDYL 3QDJE 1HXKA 1LWRA 3FYEB 4H0HB 5BVJB 1HSBA 4XCNB 2PO6B 4WHYH 4HH9A 4WWKB 1BZ7B 1A14L 3KVDD 5F9OL 3CC1A 1DUZB 4YX2L 3V4PL 4A7SA 1BVLA 1IU1A 4UM8B 5TPWH 3MUGA 3TO2B 4TOYL 3VVVA 3CDGA 3QULB 4HJSA 4ZMTA 4PJDB 1N6QH 2WO3B 4XCFH 4XOEA 4ZS7L 1KGXA 3BLBA 4N8VG 1WT5C 5GGTL 4YIQB 4E9TA 3BPLC 4OZGB 2PPCA 4UUJA 1D5RA 1TJMA 4XPAL 2R1WA 3ARDD 1BD2D 3QYCA 3ARTA 2LAAA 3R19A 4PD4J 5DMGD 1DANT 3L4CA 3S35H 1BD2B 4FJYA 5EIIA 1IBDA 1BZ9A 5FA3B 5HJGA 5AKRA 4C4KT 3IWVA 4DP5X 1XCXA 5DGQA 1X4YA 2VTFA 2HRPL 3QUMB 1PX3A 2P8MB 5I18H 4KNSA 1M6OA 4OFYA 5IMMA 3KS0J 5KBNC 3IE4A 5EWIL 3EGXA 5BQ7B 1XVSA 2CAKA 3CV5A 4MS8C 4MSWB 3DTXB 5CGBA 4AV5A 2E27H 2FRGP 1TCMA 3QXDA 3ZN6A 5GJSH 3VFWA 2EDKA 2R2HA 4HUUA 4RFEA 4HDIB 1V7NL 3CFDB 1EAOA 2FECL 3E6FB 3HKFA 4QNPF 2J3SA 4J3XA 4HUXB 2G3NA 1CXEA 5F3HB 5FO7A 5C0CB 1RAMA 1OB1A 5GRJH 1B6DA 1HEHC 5JXAH 1EUUA 1L0XA 2DEWX 4ZSOB 2ZP8A 3QXUA 1JWUA 2V33A 4Y5VC 3WIFA 1NGXA 3QEGL 4KO6A 3F7YA 3OZ9H 4PGZA 2B2XH 4NXSA 4MMXC 2D31A 4M8QB 4P3DA 4ISVA 3ETBF 2R7EB 3QFDA 3U0WH 1LO5B 5T3ZE 2HRHA 1KCSL 3TVMA 4Z3EA 8PAZA 3MXWH 1ZJAA 5SWZD 4ZMVA 4UTAH 1AOHA 3CTTA 3HS0C 1CU4H 3MNMA 4W9FC 3MJ9L 4NZRL 4LHUB 2Y6TE 2HFGL 5EMYA 1Q94A 5IVZB 3N0AA 5IJVA 3DBSA 4LFHG 1SY6H 4QRUA 4L4VE 5KBDA 1C5DB 2IBGA 1T4KA 3U4EA 1CGXA 1TR7A 4ODTH 4X8JB 1L9MA 3N1MC 4YDNA 4BH7A 1CQKA 1I1CA 5F72S 3VI4A 2J56A 1E28A 3QDME 4PS7A 2Z0UA 3QPQC 1S7QB 4OKVA 3VXSD 4CJ0A 2R1XB 3US9A 3JTBA 4V1DE 1YRKA 4MJ5A 2UZYB 3PAUA 5G4NA 4DJMA 4Q4EA 4AMKH 1U8OB 4XHQA 1DEEB 2YPLA 1X6LA 3NBNA 3ECQA 1LEGA 3SKUD 1OVZA 2CPCA 4J4PD 4MJIB 4MB5A 2WZPD 1G5AA 2LFGA 3DBXA 4BZ2A 5BRQA 5T5FL 1BM7A 1IAII 5I66A 1M2VB 5SX4I 3EAKA 2QPDB 3SD2A 2JTDA 2Z1KA 1HXMB 5IHLB 1AQHA 3S37H 2FCBA 3QIWD 3ZIMA 3KPRB 1AY1H 1N8ZB 2BHZA 4Q74A 5D4QA 1R3JA 4N1CA 1CDHA 3LKPA 5E5LA 5EPMA 1TQCB 5FYKE 5DURB 4UU9B 4DGVL 1WISA 3E9UA 4HBQA 4TPRH 3V6OC 3WSQH 2K6YA 1UASA 1HNYA 1AD0A 4YPJA 2BXYA 1MIEH 2ADFH 4ZOCA 2VXTL 3MOAH 2W0FB 1UG9A 4DCQA 3LVTA 3PAZA 1OT1A 2N0KA 2P5EE 3BHBB 3DX9A 5BPPA 4XP5H 2AERT 4R8WH 2AAAA 1L6XA 3HPJA 4L8BB 5EZIH 1PX4A 4XN1A 1A7RL 3W5MA 3POCA 4MX7A 4PJCA 1KJ3L 2HVJA 1LILA 4JRYD 2AEWA 5JOEA 5DJ2B 1KUMA 4MA7H 4U49A 4ZPVA 2Y25A 1IGJA 1VHPA 5EORL 1SY6L 5C0AB 1S9WA 3BKJL 2L04A 4ZZFA 3MA9H 1INQA 2CCVA 4QKTA 4CILA 3GXFA 5K59F 2YSSA 3ARWA 2FL5A 1U91A 4G8GB 6FABL 3QQ9C 1F3JA 4UAOC 5D6CA 5FOJA 2J4WL 2D3NA 3HKZA 5AWNL 1GKEA 1DBAL 4W81A 2E6QA 3ZDYF 4LPVA 1X7QA 3QDAA 1UYWH 2GTZB 1D3CA 4CGTA 5CEYB 1JWSA 4WV1B 2X1XR 3MLWL 2H0FA 1NAMH 4XMPH 2X89D 5KBMA 4XPHL 2BIIA 1DSFH 3AVEA 2NUPB 3I3DA 4AM0Q 1BV8A 1A0QL 3HI6L 4W9CC 4WV1C 5LQBH 4H0LC 3BVVA 3AREA 3D0VA 5HJ3A 3VXOB 1G7LA 3B2UC 4FQXB 4N25A 4PRID 5C08E 3PWPB 2AMGA 4WFEE 2VL4A 3H0TA 4JPWH 2K6WA 1MFEL 1XL6A 2NT1A 4P4KB 5B3NA 4LKXB 1JK9B 2MH4A 1MRCL 5JW5A 3T71A 4P23A 5CEYA 3VGDA 1CZ8L 1DUYA 3QG7L 1X7QB 1SOKA 1B4LA 3STZA 3WFDH 4FZEH 2AJSH 5J06A 1JGVH 3PJSB 1LEKA 2DDQL 1M1XA 1NMBH 5I73C 4GAYB 3SCMC 2YR3A 3ASNB 3Q3GB 3UERA 4UWQB 2VW6A 4P5RA 1QFWH 4MXWL 4S1DC 2QBWA 2DLTA 5DD0H 2X5PA 3BPOC 3K0WA 4LT7A 4NFBA 3B2VH 1UKTA 1OAUL 2F9BT 2YAOA 4Y5XC 5EZLA 3SN6N 3VM5A 4U7KA 4JN2A 2X4OB 4G5ZL 2Y7QB 3II1A 2XXGA 2BP3A 4IBTA 4XPBH 3IGAA 5EUOF 3UYRH 5F89A 2GK0B 4XNMA 5IT2H 3FUEA 1JPEA 1RHHA 1NFAA 1ZJBA 2HYMA 2WTRA 1TXKA 1MCWM 4JDZA 1TIUA 1DVFC 2X2YA 1YNKL 4Y16C 3UO1H 4BA0A 4XGZA 1OTTC 4TUJB 3SDAD 3VFGH 3F7QA 1U8QB 3VNYA 5CBEB 3GXTA 1AFVL 5D7LD 3TWYA 4RIRA 1AC0A 4BBWA 1UURA 3IF1A 4AK2A 5C1MB 3PP3K 4GRMB 2AJYH 1HL4A 2PPEA 3I6LE 4EQ2A 4JQVC 4ZAKB 4H7VA 5JIPA 3QZBA 4KJQD 1QTPA 3C60B 4PU2A 3ME0A 4ZXBD 6TAAA 4N3UA 1NEZG 1YAIA 4ZFGL 2HJFA 5GGVH 4L1HA 1CFTA 3IFNL 3B5HA 4PJAB 3LS5L 4Q9RL 5F9AC 2FVNA 3F58H 3SBWC 3VAEA 1BZ8A 1R3HA 5KVFE 3WN5A 3V5KA 1BA9A 4NO0A 2WLIA 5I1GH 2YPLE 4PJ5D 3ARBA 3GBDA 1IIKA 3HHMA 4AIEA 3L9BA 1IQDB 1VFOA 2QSQA 5KVEH 4WUUB 3EJYC 1EO5A 4JFTA 4YDKH 1INDH 2PF6A 2OSWA 2PTUA 1AYRA 5GISL 4DQOL 4L3EA 4YUEL 3VRJB 4HIJA 3VXUA 1ITCA 1XIWC 1TZHB 2X4SA 3CN3A 3QHFH 5FHAL 2WBWB 2XX0A 3U30C 2DV6A 4N2AA 4PG9A 2APFA 4WGKA 3QZWG 1HS6A 4XO5A 4WO4D 1H0DB 2K8QA 4GW1A 3IU4H 4ZDHB 2XZCH 5DZLA 3EJZC 3HE6A 4M93B 4JFFA 3QA3A 1WAAE 3TONA 4HJGA 5DUML 2OL3H 2PLTA 4IJTA 3BLKA 1B0RA 2XXMB 2LABA 3L2MA 2C7UB 3FCUB 1HSAB 4PRHD 3WIIL 3BMVA 1JWUB 2A38A 3FO1B 1QAWA 2CR3A 2YXMA 4PVMA 1CR9H 2JLLA 1GHFH 1MFUA 3TOPA 1QATA 4OW6A 4YHKH 2K78A 4HT1L 2RTTA 2YN5A 3BVNB 2VIRB 4DN3L 1E5YA 1AGCB 2X10A 4UBDC 4H4NA 4JN1H 2JQAA 1L3WA 3FSZA 3LN4B 1XR9B 3ASWA 5DJAA 5BNXD 3BW9B 4X7EC 1WBXA 4YE0A 5DHDA 5TF1L 1EEYA 2ZCHL 2XI9A 2R2HB 3BFWA 4HUUB 3QIUB 1UD3A 5EOTB 3WHE1 4YO0A 1JV5A 1Q0EA 1R47A 4PBXA 2HLAA 4DEPB 1AQ8A 5I30L 4M4RA 4R96B 1F58H 3OF6D 1FFPA 1ANUA 4LDLB 4BFJA 1RZ7H 5DUJA 2VL5A 1QRNA 3HBZA 4ZMLA 5EG6C 5AB2A 4GO9A 2J6EH 3HG1A 4K5MA 3N44F 4MLSA 2Z7ZA 1IM3A 1ZHLB 2G0KA 3KS0H 4FQXA 3V4VL 5AKSA 4KROC 4AQ1B 2EYRA 2I25N 5D1ZI 5I82A 4DO6A 4G7YH 3OTTA 3HUJB 2C9VA 2YKLH 2XVKA 4Y5YB 2IOOA 4NNXB 5BZXA 4ZQKB 2J25A 3Q0HA 4R83A 1Y6KR 4UUJB 5AVVB 2KZ1B 2XIIA 4ZFOA 4NM8H 1J1XL 2DTSA 4IQHA 1KEGH 3OJVC 3QEHA 1QZ1A 4YXKH 2OX5A 1MH5B 3C8KB 1U93A 2WLJA 5KTEL 4P5TD 1ZGLP 1W0YT 4JO1H 3AJ7A 3H4HA 4QJ3B 4AGLA 3PQYA 4KXDA 5IQMA 4G9DA 2QPUA 4WWKA 5D2LE 4PBDA 1HSBB 4OZHB 5MERA 5KYXB 1B9ZA 1BXAA 2Y36H 5IQ9B 1E6JH 2OMTA 2XWEA 2BP8B 2ZKWA 1EAPA 5DCCA 4D0DB 4CVXA 4K94L 1UD5A 2YMTA 1TCRA 1UB6B 2RB8A 5AUMA 1MHEA 2OXGA 1EDQA 1KTDA 1WQVT 2AITA 5TE4L 4NQXA 3BHBA 3DX9B 2YGNA 3D69B 3QZNA 5DZOA 4LQFH 3G08B 1UM4L 4K2UL 1MW0A 1UWGL 4H25B 5BZDB 2JE8A 2Y5TB 3CSPA 4MCMA 3X14B 4Z23A 3HI1A 1CXHA 2QVTA 1N8ZA 1Z7JA 5DVPA 4D9RD 4HXBL 1FL3A 3KLLA 2ZIDA 2AW2A 1TENA 5C7ZA 1DN0B 1RUAH 1BYNA 1VGKA 2NY2C 1HE7A 1NDTA 2HKHH 5EHFA 3CXDL 1FFOA 3HI5L 2L4OA 3N43B 5I17A 4A68A 1DQQA 1YEKL 1MHEB 2EH8H 4G3YH 4HFWA 5CGYC 1OW0C 3V6FA 2VZTA 2Y6SD 4HIXH 3H54A 5E0FA 4CVXB 1UZ6E 1NL0L 2OI9B 5KZCD 4PIRF 3TWCH 2A0LD 3T0EC 3ULUC 1H3WM 1FZMB 3HS0A 5F7KC 1OCWL 5CJBA 2OR9H 5EA0H 1YZZA 3D4GA 3QJRB 3D51A 3TPKA 4Z6AT 2Q76A 1AI1L 2Z92B 4ZUTB 2AABH 4PGDB 1EWHA 5SWZA 2VDQB 4P2OD 3D30A 3FNKA 3IAGC 4GG6E 5JW4N 1FYHB 3V6ZB 1CE1L 3QDJB 4X5WA 2EDRA 3LQZB 5FYJE 3SYQA 2XWCA 3MNZA 3R1GH 3CXHK 3VH8A 1V05A 3GGWA 5GGTA 1CG9A 1LGVA 1KENH 3P0VL 4MAZA 4WFGD 3NIGB 5MP6L 3BP4A 4UDUA 2D7PA 3ZMEA 1Q1PA 1S9VB 1U42A 1P9MA 2BNRB 1TVBB 2VQTA 1OM3L 4MS6A 2MPVA 2QADD 3CVHH 3V5DB 1J7VR 4PWJA 5FYJL 2V2TB 2D7TH 1E4XH 2QMKA 1N59B 4EXKA 1MWAL 4IIQC 1MCPH 4M8QA 3WFDL 3GEFA 4GI6A 5DYOB 3WNMA 2H2SC 4JFOB 5JO5A 3GKWL 3IM1A 2F5AH 4KKBD 4N9GA 3GLZA 5C0EB 2ZONA 1BBJB 1N3NA 3FRUA 2YD2A 4ETQA 1FZKB 3E6HB 4CW1B 4R4BB 3CMGA 2WXMA 3BPCA 4E0RA 1IT9H 3HN8A 1G9MC 1WBXB 2DIEA 3NRPA 3OX8B 4D7BA 1E50A 4FNLL 3O3AA 2H32A 3IE9A 1A22B 2RACA 1CD1A 4Y19B 2OXHB 2JXMA 2ZYHA 1VADB 5I73B 3DX6B 4TUKL 1XAUA 2GC4C 1DBAH 4MMZA 2WSKA 2PABA 1FNSL 1CDBA 5JXED 2B15A 3REWB 3VE0B 1C12B 5DDHB 1J8HE 2UXGA 3ABLB 4UTCA 3VG9C 2BNRE 1N5YH 1ZCRA 3UEQA 1OLLA 3NFPB 4P2AA 1TZAA 3SDXA 1OAYH 3LHPH 4L8SB 1YSOA 1I31A 1IX2A 3SPVB 4I9WD 4K8RL 5EZOL 5AALA 5DZVA 3LHPL 1JUFB 2BHYA 1DVFB 2GTWA 2DQDH 1K3ZA 4R7DB 1SJHA 1T1ZA 5JPNC 1EFQA 2R0LL 3DTUB 3EH3B 4XP5L 4RQQA 2A77H 4WI2A 3G5XB 1AO7A 3WEOA 1YYLL 3GSUB 1MNUH 1W6LA 2WBJA 4X0NA 4TLUA 3PHAA 4U6VH 5HDBB 3MRHB 4KMTL 3LJ3A 3X13B 5IFJB 2MQ0A 3BWZA 4GLRI 4JGNA 4TRPH 3ZJAA 3I3EA 4HIEB 5ESAB 4J6RL 2C3VA 3F6JA 3MX0B 5C0EA 5IOPB 1E67A 4EDWL 4HLJA 2LOEA 4KXZH 1E2WA 3LOWA 3D18B 2O61B 3AQYA 4FNTA 4KV5F 4XNQA 2NZ1A 4C58B 4LVNC 3CK0H 4FNQA 2WQRA 1IT9L 1ZLWK 2GITB 4KKBC 2MFNA 1CD8A 4MMXB 4FXKB 4Z7UF 5ESVB 3TIDB 1D9KC 2Z7UA 1KPVA 3DV6A 3L3GA 3WNLA 2QSVA 3ARFD 2B4CC 3BUYB 4OF5A 1T5WB 3G5VA 1GYAA 3PFQA 3V0JA 4PRPE 4OZFH 2I7OA 4IW4C 3QFJE 1ADQH 3FUMA 5KTEH 3RVXC 3TO4A 1ZLUH 3ABMB 5FLUA 4GSXA 4YVUA 1QZNA 1TYEB 2I60L 1XMEB 4KFMA 1HOCB 2QQKH 2Z4QB 4YEEA 2VDPL 3T0EE 3ULUE 4Q0XL 2X6MA 3QNYA 4MCYA 5KS9A 1NH6A 3GIZL 2Y06L 1R75A 2WW8A 2VITA 3BUBA 3EUDA 4Q0XH 2VO8A 4JFXA 5CJOH 3EJZD 4NQDD 3T0DA 4FFYL 1I85A 3O4LE 5HI5D 5F71A 3OXSB 3CZGA 4LMQI 4WNQB 2A9AA 3V6FB 4L4TB 1AP2B 1Z9MA 2R2EA 2OMNA 4NRYB 4WRLA 2AZAA 3VMNA 4WHTB 4ONFL 4F2MA 4MQXD 1MNUL 5GIRA 1WDAA 2R0WL 4P9HL 1ZHKA 3EOBB 3P4LA 1B3JA 1L9TA 3EH1A 1YEEL 4LCUA 1ES0B 2VC2H 1UATA 1F8TL 2A4EA 3AQZA 2EH8L 4G3YL 4JMNA 4YHPA 4ALAC 1T89A 4P04A 3VD3A 3TYFA 2CLVB 3IFLL 5IMOB 1BAFL 5I8OH 1JZ8A 3VD9A 5G55A 4PJXF 3EYFA 4A2LA 1U8IA 3PHQA 4AGPA 1RLWA 4M8RA 5I75C 5CP3A 4BSVA 4LDCA 3KDMB 1KYOJ 2B1HH 2F5BH 5JMRA 1TCRB 3HNVL 5K9OA 2C3VB 3MX0A 4NZDA 1WRFA 2IBZX 3QIBC 2HRPH 4M5YL 5E8OB 3FH7A 5D7HA 5IFJA 4ODVL 1H19A 4JJ5A 3SKOA 4BRJA 3FN9A 3VXSE 1A7BA 4KXZI 4P99A 3SB3A 2J88H 3ZRSA 5E56A 3PQYB 3SKJL 4Z7WA 4P2RD 1NFDB 3ISYA 3TN0C 4U7MA 1NUDA 2ICWB 4MWFA 2QMJA 4TNWK 3R8QA 3WY4A 3UAJA 3O3DB 4ELKA 4H1LA 1FI8C 2EJ1A 3QZWA 2VLRB 4U3SA 1S5IH 4NZFA 1S7UB 4PS3A 1J8SA 3ZZQA 2LTQB 4LCYA 5H35B 4KNUA 1D6EA 4LGRB 3M6DA 2XWTB 4HUVB 3NFPA 3I75A 4DP2X 2D7MA 1D6VH 2WN2A 2N1TE 4FX5A 5HHVH 3X12B 4BCZA 1IFHL 3MJ9A 4RAVB 4X0KA 1E8WA 3GJFK 2ID5A 2DBLL 2GCYA 3QJFA 3FBQA 3FTGB 3Q8AA 4GP8B 4OZIB 5FKAB 4K3EL 1MFEH 3ZMRA 1QRNB 1JF6A 2BP0A 4MD5B 3A5VA 4TNFA 4GXFA 2X09A 4XR8C 4ZYKB 3RWHA 4OFKA 1L6ZA 2ARWA 3HZYA 3PDGA 4F20A 1MAKA 1M9SA 1FGNH 5EO0B 3RY6C 4NHUA 4Q9CA 3UYPA 1N68A 4PJGA 5JTWA 2YPLB 4A6YL 4E9SA 5D2LA 5BS0D 4FI7A 2FQEA 3RVWD 1I85C 4PRPD 2AI0H 4S1QL 5FYLD 1WP6A 3A6CL 4E68A 4NUGH 2ESVA 4QHKJ 4GIAA 3OLEA 1PCSA 3QQNA 2DOCA 2ZWYA 2W65A 3MROA 4FHBD 5DQJA 1KENL 3BIBX 1Q72H 2GG1A 4MNGE 4JFFE 3GIZH 5AZEH 1YN6B 4KTGA 3L9RA 1KIUB 3A6CH 3ZYIA 1TJHL 1H0DA 5DD5H 5JPMB 1OF2B 4GG8B 3CLEL 3DMMA 4M00A 5E2WL 4DP6X 2OLDA 3BP4B 3EJRA 4ONGH 3RDTC 2WQXA 3A6BL 1IUZA 3IRZA 3D9AL 4PRHA 3VFPB 3LRKA 3FAXA 3O41A 1CDYA 5F7DA 5LDSA 4ZSOA 3QNXA 1XGRB 3RWFB 5D7KE 3FU6A 3WXWL 1R3LB 1R3IL 1T3FB 3EGDA 2NY3B 1PG7W 4PJFB 2V5SA 4WVRA 5SWZB 3T4YB 2H2SD 4D8PB 5ACLA 3MRHA 3WCYA 3QJQB 5KSAD 4ZFFA 1WWAX 3C60C 1F8TH 4NO0B 5DEZA 5FIEA 4UT6L 5DMYA 4GKSA 1UWEL 2HTLC 2LE9A 5KVFL 4YFLF 4KI5D 4EN2A 3KPQB 3VX1A 3GIVA 4ABUA 4NENA 4IOFD 3RWDB 3VGBA 3DVNB 1N2RB 3MKKA 5EO1A 3KPRD 5AB9A 3UTTB 3T3PE 5BUPA 5KYYB 3ROLA 2KLSA 4YL9A 1NIDA 4O9HL 3O4OC 4YHYC 3EW3B 3GXNA 2CHNA 4PWFA 2PYEB 2FEJA 4M61A 3MREA 4NO0D 4KDVA 5B21A 2ZF8A 1UWYA 1ZHNB 4ZMNA 3GJEB 2EVGA 5AG8A 4ZUWA 3ZZLA 1PS3A 4XN2A 4M93C 4KKRA 1FV1A 4NQXB 3S3CB 3RJDA 2WQUA 4XP1H 4YXHL 1WC7B 2OXGB 1VACB 3D48R 3SJVA 2YUZA 2ZWKA 4CC4A 5I76B 3K6NA 4F15B 3NSXA 4WO4B 4AL8C 5DU7A 4TULL 1VDGA 1BFTA 3BD3A 3D4YA 3QWNA 1NMCB 4WGWB 1KYAA 4F9LC 3LRHA 4XP9L 2IPKA 3UO8B 4TTDC 5JMOC 2ZSWA 3GBMH 1NIEA 4BWTA 1X44A 4NQEA 4AYID 5ITBL 1CO1A 5D93B 5JO5B 3PL6A 4BSVB 1HH6A 4FL4C 4Z7NB 1G9EA 1A02N 2HT4D 5EC2B 3HAEH 2CDEA 4AT6B 5F0PB 1E2VA 3OHXC 2ATKB 3GS4A 3SDCB 2WZPA 1E6OL 2VLJE 3R0NA 1TOXA 5D1ZD 2C34A 1YLBB 2EE6A 4NSKB 2X4TA 2C7FA 4IEFB 2IMNA 4YHPB 4N28A 5IROD 25C8L 4X5XB 1FO0L 5KVFH 1DZ0A 1FJ1A 4MAYA 1FYTB 3T0VA 3DETC 5MEND 1NFDE 1RZJC 4L9DA 3KXFB 5I8EA 4U1MA 1PZ3A 3RNQA 5LDUA 3R4DA 1B3IA 1X5JA 1EEQA 4ZI8A 3KCPB 1GMIA 3LQZA 3HB3B 2ORBL 1P7BA 4YHZL 4OI8A 1PFOA 1RY7B 2RQ8A 4RMUA 1IILE 2VXSL 5D8JL 4FFVC 1DSFL 1X5HA 5GRYA 2BSSA 1I1RA 2X3CA 3ZQXA 4YH6A 5DJAB 1MJUH 1U3HC 1WK0A 1KGCD 2QPEB 5C86A 2VXVH 5J12B 3BSHA 3WXVH 1XAKA 2UUDH 1FYTD 3WKYA 1BG1A 2WXKA 1X5ZA 3BUIA 2A6DB 4C59B 3CN1A 4CU6A 1U33A 1O6TA 1DQVA 1KCKA 4BK5C 5DJ2A 7FABH 5E5UB 4GW4B 5C2BH 2IH1A 2YOAA 1AAJA 3VSTA 1KB3A 1IC4L 3L4ZA 1A8ZA 2G2NA 5AB0A 5I17B 1F6AB 1UZ8B 3L5XH 3RTQC 2A99A 4FFWC 2WO2B 4O2FB 4KKLD 5J1TC 4H44C 3TFKD 5FGCE 1A1MB 2BZDA 2W0KA 3QA3B 1R5IB 5B1AB 5G2NA 5C08A 3VVWA 4KK6D 1P2CA 3MRDB 4GIOA 5MEPA 3GMLA 3S3SA 2WIMA 3CVDA 5D1ZB 3SYAA 5DO8A 2D0GA 2ZWNA 1XGQB 4N0FB 4K4KA 2IAAC 1W0WB 3MXVH 1QBLH 2ADJB 3GPSA 5I1IL 3S4SG 3WEMA 1NPNA 5J1AA 4JCLA 4P3CL 3H3BC 4A6YH 4XO9A 2QTEA 4DSYA 2EILB 4HUKB 4ZUUB 5EULV 4ONOA 3CBJB 4B9FA 3KBPA 5DHVH 5G5DB 5A2KH 4M02A 1UT2A 5DWUL 2VMJA 2VXQA 3LTVA 4PJIF 3VMPA 1QBLL 2OMTB 1JXFA 2NDGA 4HJ0D 1BVOA 3Q8FA 2J8UA 1JCVA 2F0CA 5E5MA 3S37L 4WWOA 2YFOA 5AOZA 1YQVH 3T0EB 1UKQA