2AF5A

2.5a x-ray structure of engineered ospa protein
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
292
structure length
292
Chain Sequence
b'NSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLELKGTSDKNNGSGVLEGVKADKSKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKFNEKGELSEKKITRADKSSTEEKFNEKGELSEKKITRADKSSTEEKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTKENTITVQQYDSNGTKLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Engineered Outer Surface Protein A (OspA) with the inserted
publication title Atomic structures of peptide self-assembly mimics.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags De novo protein, immune system
total genus 56
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2005-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 2af5A01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2af5A02
3.90.930.30 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2af5A03
2OL7A 2OL6O 3EC5A 2OY1O 1RJLC 2OY8A 5B2AO 2OY7A 3CKFA 2I5ZO 3CKGA 2FKJA 3AUMO 2AF5A 2OYBO 2I5VO 1P4PA 2OL8O 1OSPO 5B11O 2OY5O 2PI3O 5B10O 2G8CO 2FKGA 1FJ1E 5B3MO 2HKDA
chains in the Genus database with same CATH superfamily
5B29A 4RUUA 2LBAA 1KT6A 1OEKA 5FQ6E 2JW1A 2GTFX 3SLTA 4I3DA 5HTDA 1JMXA 4ALOA 3DLLE 4FBRA 4JGLA 1QABE 1T0VA 3BLGA 3D95A 2RTFB 5HA0A 4AZPA 1KXOA 3HWDA 1LIBA 3I56E 4GUZA 4YFPA 5HZ8A 2GTLN 3VHHA 2JMBA 3S5XA 4HFOA 1SWEA 1N7YA 1XKIA 1NC9A 3I0AA 1EPAA 1MX8A 4GZVA 5IRAA 3RBYA 4M7MA 3RKGA 4YFQA 3AEHA 3WJCA 1WBIA 1TXLA 3VPJE 1HXLA 3FIQA 3HK1A 4GK9A 4YKMA 1YJ9E 3KVNA 1HY2A 1STSB 1N9MA 2NP1A 1ICMA 1QFVA 4QZUA 4QRLA 2GTLO 5H9AA 2LFOA 1P4PA 3BU9A 4NYQA 1SMPI 4RUNA 1BRPA 1HN2A 2A2UA 3VE2A 2QM9A 4YGHA 5GADG 4ORWA 4NV7A 1X89A 1I9HA 1D3SA 2ALLX 2GC9A 4KT5A 3D4RA 2R56A 4WFUA 2C4IA 2RTPB 1MVGA 4XMDA 2OTJE 1LDQA 1QQSA 2QEXE 1MEPA 1GGLA 1VWKB 1MUPA 4A1YA 1EIOA 1O1UA 3MVFA 1YIJE 1HQPA 4QNIA 4OEMA 3P6EA 2Q2MA 2RD7C 4BCSA 4U8UM 2HLVA 3PQUA 1VQKE 1EPBA 1B0OA 2IZFB 2W2AA 5F6BA 1EQDA 5AN9B 1DZMA 2F01A 1SWFA 1IKEA 4TLJA 3ZW2A 4IBAA 4Y5DA 2G78A 4HPDA 3OD9A 1JMZA 4XMCA 2ANSA 3P6HA 1RLBE 2R74A 1HMRA 1X8UA 3SLJA 1K8AG 2X34A 1B56A 1VWJB 1U0XA 3APXA 1K73G 4QYPA 5F1EA 3IG9A 1MDCA 3ELZA 4BGFA 4UU2A 5F7GA 3MBTA 4D6BA 4A60A 5BYPA 3EC5A 1SRIA 3UEVA 3UEXA 4ZR2A 1RAVA 1YUPA 4LQZA 2FWVA 1DF3A 1OEEA 1PM1X 1SXXA 1SWOA 5KIDA 3DSZA 1K3BA 5JR8A 1A3YA 1HQQA 4COTA 4GJVA 2A8GA 3C78X 2RTRB 1VYOA 5DG4A 4ZJ0A 3CKGA 3S60A 5LJBA 3VHMA 3T2XA 3PECA 2YMSA 3OW2E 2QA4E 4IAWA 3PH6A 2GJ5A 1JV4A 4ORYA 4XMFA 1KC8G 2IZDB 2WPUA 4PSQA 2RN4A 1N8RG 1CBIA 4GU8A 1Y0GA 1BJ7A 4YFRA 1SWHA 1VWLB 3Q34A 3RE5A 4GGTA 1GM6A 1NP4A 2CQLA 4ORRA 1AVDA 2L67A 4TKBA 1M90G 4ODDA 3NQ9A 3APUA 5BVQA 3UEUA 1VWQB 1VQ9E 1SY2A 4YVBA 2AT3X 1UZ2X 1D2UA 1LPJA 4Z27A 4I3CA 1CBQA 4IMOA 1X71A 4MVEA 4ORUA 1K9MG 4CV7A 3PDFA 4EFGA 2LA7A 3RDQA 1W4TA 2ZAIA 4IMNA 5K68A 3CF5E 4QGXA 2FR3A 3I55E 1O8VA 1ERXA 2ACPX 1S72E 1GX8A 3FEKA 2X8SA 1Q82G 4I9RA 2JU7A 1SLEB 1UYNX 3WJDA 4ORXA 1PMPA 1VWCB 1YWCA 5LKEA 3U9PC 4AZNA 3ZI8A 2WSJA 2PI3O 3NX1A 1GT3A 2X32A 1AVGI 1LELA 3TF6A 1PTSA 1VQ4E 3ZW1A 3RWXA 4ALBA 4OS3A 1SWUA 4ES7A 4GDAA 5CYBA 1KZXA 1FENA 1VWOB 1SY3A 2LB6A 4ML7B 2MM3A 1VQME 2IZKA 2OVSA 2JGSA 1DZJA 4GNYA 3ZQ3A 1A57A 4BX6A 1KGLA 2IZBA 3LHNA 2JU3A 1I05A 4YCEA 2QOSC 3B2JA 3RDXA 5HBSA 3CBSA 3CQRA 2Y32A 4GETA 5AQ6A 1R0UA 2HYSA 3EW1A 2MHDA 1RXJA 4BX7B 4Y0PA 1LNMA 3FW4A 4N7CA 3K3LA 5FQ8E 4QZTA 1BLRA 3B2HA 1LDOA 5AJCA 1EUOA 1ZNGA 3P02A 3UAQA 4HPCA 1YWBA 4QYNA 4OS0A 2ZJRE 5HWZA 1LUQA 2VFBA 1VWNB 3FR4A 1SLGB 4LZVA 2BS6A 2RA6A 4CPHA 4ARHA 2MO5A 5MLCH 1VWDB 5H9KA 1O1VA 5LJGA 3JQOA 5LJCA 4MVIA 4MIRA 3C76X 5EEEA 3WYQA 5JD2A 1GX3A 2OY7A 2RTNB 3CCUE 2A2GA 3P24A 2RTIB 1NGLA 1VQ8E 3WZOA 4TKJA 2OY5O 3PP6A 2XSTA 4IB8A 1I04A 4WCEE 1SLFB 1VWRB 2M4LA 1I4UA 1NBXA 1E02A 5L3YA 1W5RA 2FKJA 4TQ2A 3FEPA 3ZZVA 5HZ9A 5HZ6A 2QO6A 1GXAA 5AEOA 1QWDA 1SWPA 4O3WA 4Y59A 3BX8A 1HMTA 1LIDA 3CPWE 1JYDA 5D45A 5H1SI 2Q4NA 1YJNE 5D4AA 4ZHFA 4GE1A 1KQWA 3SAOA 3RY2A 4YBPA 4GD9A 2RTAA 5K06A 1QFTA 3IA8A 3NX2A 3IFBA 3KFIA 3CMAE 4HPAA 2A3FX 3DTQA 3I17A 1Z24A 1KT5A 1FJ1E 3O2YA 4UY8G 2OFAA 5GAGG 2G79A 1N0SA 1FDQA 3B2IA 1I78A 1SXYA 3P6DA 2OVEA 3MX7A 1IFBA 4TJZA 4GGRA 1EI5A 3F6ZB 3PPTA 2CM9A 1VQNE 4ZGUA 2DM5A 3T6FA 4YH0A 5HCDC 4ZH6A 2G8CO 1VQ5E 3CCQE 5D48A 1SWTA 1Y52X 2G5LA 3CCJE 3HTYA 1G74A 2BC3A 3JSQA 4Z28A 5C0NA 5KHPA 5D47A 4NNTA 1X8NA 3GAQA 3ZUIA 2QO4A 2AT5X 3FA6A 3ZWEA 1IIUA 4Y0QA 2CM4A 1SRFA 1FEMA 2X56A 1SWGA 2C1QA 4EXZA 3RDSA 1FE3A 4UU3A 4YCHA 1LFOA 4GKCA 4MVKA 4CK4A 2FR2A 5HAEA 4WF9E 4KH8A 2FT9A 2RTEB 1MOYA 3FELA 1CBRA 4YGGA 3VG3A 4GGZA 3IGEA 5IO5A 1VWFB 2L9CA 4KCAA 1HBPA 1QVFE 1A18A 3CBCA 3CXCE 4O3YA 2OL6O 3RE6A 3EMMA 4FBOA 1PBYA 4CDFA 2BS5A 5DPQA 3VU1A 1DZKA 3MM0A 2HZQA 1LIEA 1DFVA 2ZSCA 3EYCA 1S7DA 4YDBA 1P6PA 1PEEA 2RQ0A 4O9SA 3P6FA 4O49A 3CC4E 2IZHB 2K23A 4IB7A 4WFNE 1AELA 1KZWA 4OMXA 3NADA 2ACOA 4ZHCA 1BSOA 2KT4B 3O19A 4MISA 4TKHA 2KW1A 1SRJA 4TNNA 1DC9A 1ALBA 3FMZA 1HXZA 5K67A 3EM0A 5HCCC 2FS7A 2BLGA 4QQ1A 3BS2A 1SWSA 4AW8A 2FHLA 3ELXA 2OL7A 1SWDA 1RJLC 4JO6A 4NW4A 5DM7E 3TGCA 3RDMA 1EIIA 3BY0A 1VQOE 1PBOA 4KIIA 4ORSA 2CAMA 5LJKA 4IAXA 5BVTA 2HNXA 2L5PA 1VWPB 4IB6A 1SWLA 4U8UN 1ML7A 4YDAA 4I60A 3STMX 1SLDB 4FBVA 3P6GA 5B27A 5KICA 4INNA 3MG5A 1E06A 5IXGA 5FENA 1YITE 3RZYA 1B4MA 4KC7A 1KL3A 1E00A 4BQUA 1E2TA 4NYRA 4ZHGA 2WWPA 1RXKA 3FA7A 2WEXA 2CZUA 4ZFXA 2OVDA 4U8UO 2AH7X 3PH5A 4IRWA 4LKTA 4MEEA 5HA1A 2RTOB 5FQ7E 4CPEA 2IFBA 1OEJA 3WJGA 2JOZA 4AZMA 3APWA 1RBPA 4NLIA 2BT9A 3WZQA 2NNEA 1ACDA 1MK5A 4BVMA 1DV9A 3VG2A 2RTKA 3B2KA 4I6SA 3V8UA 1GX9A 1WUBA 1BEBA 1QY1A 5LKFA 1ADLA 3J7ZG 1BSQA 1UYOX 2Z4IA 2A0AA 1SRGA 1GKAB 2OTLE 3TGAA 3NR3A 2Z4HA 2I5ZO 3APVA 5HL7E 2NNDA 3OE3A 1NDJA 4DCBA 1TVQA 2WQAE 3EW2A 3WJFA 5L8OA 1EXSA 1W6FA 3D96A 4WFAE 4BJ8A 4FQBB 5L8NA 2IZLB 2X55A 1OBPA 1AQBA 5FAZA 2FLJA 2Q39A 2OF8A 5CSEA 3T1DA 5LJHA 2JU8A 4U46A 5EZ2A 3PIPE 3CCVE 3RDUA 4NLJA 5HZ5A 1K24A 2C1SA 1OPBA 4ZH9A 1GT4A 4BX7A 2W2FA 3AKMA 1VPRA 3KFHA 2CZTA 3D9WA 3FR5A 2HMBA 2PY1A 4AZRA 1G7NA 3D97A 2UZ2A 5CHKA 1LCWA 3PK2A 3L4RA 3FA8A 4OELA 1N4JA 3U03A 3NP1A 3OBLA 4K19A 3KFGA 1YHQE 4QGWA 1STRB 4JHQA 2FS6A 3S26A 2OFMX 2QO5A 2R73A 2Q9SA 4Z2OA 1NP1A 3JS1A 1G5WA 4OKAA 3VG5A 2OYBO 1JIWI 4GH7A 2AT6X 1JBHA 3FDCA 1SWKA 5IRWA 2P8GA 1KT3A 1HBQA 1SY0A 2RTLA 2RCQA 1KFFA 3P6CA 2POAA 2L68A 2X4MA 1BBPA 3ZW0B 2E4JA 3CC2E 3NQKA 1NQNA 1IKJA 2AT8X 1DF8A 3WJBA 3FENA 2N93A 3HWFA 1SWBA 3CR6A 4IABA 3F9DA 5BVSA 3N91A 2AF5A 1LIFA 2IZEB 4NP1A 1QG5A 1KQSE 1SWJA 3SOTA 3ZUOA 4YKOA 4CSBA 1NJIG 3SZIA 3RSWA 1JZUA 4BX5B 3PIOE 2RTCB 2BSZA 4IB9A 2QMIA 2RTBB 1MX7A 1OBQA 1TW4A 4NNSA 1GT1A 2A13A 1AVEA 1KL5A 1KT4A 4O3ZA 3STKA 3NQ3A 5F58A 3HWGA 3OJYC 3FIDA 4IOCE 5JVHE 4Z2VA 1ZRYA 1SWAA 1SRHA 4Z6JA 3G4SE 4YGZA 1FELA 1NQMA 3CKFA 1SWNA 1FTPA 4DQ4A 1ZNHA 2KTSA 4I9SA 4OMWA 2OL8O 5D8JA 3VE1A 2ZJQE 2VDFA 1Y53X 3HWEA 4KC8A 4ZCBA 1VQ6E 1X8QA 4AZOA 2EU7X 3S5VA 4U9CA 5EPQA 4EDEA 1OBUA 3C77X 1VWMB 1YWAA 1BM5A 2CBSA 3HOLA 4WHIA 1VWAB 2QOMA 5B5FA 1UREA 3CCSE 4CPIA 1AB0A 2YG2A 1YP7A 3CC7E 1KQXA 4WBKA 4BOEA 4BBOA 1X8OA 2UYWA 2FHNX 2RTJA 2WR6A 1YI2E 3FYFA 1OPAA 3BDRA 1SA8A 3VHIA 2HZRA 4O3XB 4GDZA 5HZQA 1IFCA 4XMGA 1TOWA 5HTEA 1VWGB 4LZUA 1Q81G 1ZNDA 1ERBA 2LKKA 4O4XA 1ZNLA 3VG6A 1LCZA 2FGSA 2F09A 4HWMA 1YWDA 4CDCA 1E5PA 3LV4A 4ON1A 4A8ZA 1VQLE 4QAEA 1HMSA 1Y9TA 3CMEE 3PQSA 3HPEA 4I95A 4DQ3A 1Q7YG 2WUTA 1LF7A 3RDOA 4ZHHA 3SZJA 4LKPA 2IZJA 4ZGFA 2A5CA 5L8IA 3VG4A 4AYHA 3G6EE 1T8VA 1BWYA 1SREA 3KQ0A 4FGIB 1VYFA 3TZSA 2I5VO 3LTWA 2FTBA 3WZNA 1CRBA 5B10O 4CPFA 2ZJPE 1N9YA 1EW3A 2DJGA 1T68X 1I06A 3WBGA 5JVGE 1S2PA 1YIVA 4YMYA 5EEDA 5AJBA 2QCBA 3PEDA 4PJ2A 4QGVA 4GRJA 2AT0X 3UEWA 4MVLA 1H91A 4NV8A 4JNJA 2RTMA 2ASNX 4R0BA 2OF9A 2WEWA 2VFCA 3CCLE 1JJJA 3BSZE 2X45A 5EDBA 1ZNEA 4I3BA 1B8EA 2RTDB 2NNQA 2HKDA 2Y3EA 1KD1G 2MF6A 3HOEA 2X8FA 2OY1O 4U3QA 4Y0RA 1DZPA 4U67E 1IJ8A 2WQ9A 2AMMX 2X46A 1M1KG 3FW5A 3CCRE 3RY1A 5IRUA 1MM9A 1JYJA 3VG7A 4WFBE 5HCEC 5F6ZA 3T6LA 1VYGA 1ZNKA 1ICNA 4XMHA 4AZQA 1G85A 1YP6A 1SWRA 1N43A 1IW2A 4EQAC 3AUMO 2BHVA 2F73A 2RCTA 1RXHA 3WOVA 3NPOA 5B2AO 1SWQA 4O4UA 3STNA 3CCEE 3BU1A 5GAEG 1GKAA 4HPBA 3B2LA 2MWHA 5DM6E 2Q2PA 3WYPA 4M6SA 5B11O 3KFFA 2KD2A 3AKNA 5B3MO 1CJ5A 3FR2A 5H8TA 3CCME 2RTHB 1KL4A 4EEJA 1TOUA 3WZPA 4N7DA 4EKVA 3G7XA 2AL0X 1LCVA 2OVAA 1LICA 1SXUA 2O62A 2RTQB 3T2WA 1VWBB 3O22A 3FLLA 2OY8A 5F2BA 3SZHA 1BRQA 1JJXA 5GAHG 3WVMA 4OS8A 4O4OA 2XKLA 1STPA 1KT7A 1X8PA 2A5BA 4B55A 1VQ7E 5EDCA 4CDEA 2Y3FA 2ZAGA 1VWEB 3CQNA 3BRNA 4A1HA 3EBWA 3WXQA 2FRSA 3BX7A 2OFBA 5LJDA 4ZHDA 1VWIB 2KTDA 3ZW1B 5IO6A 2RTGB 3EBKA 1VQPE 3VGWA 2IZGB 5B5GA 1U17A 3WJEA 1JJ2E 4GJSA 2GH7A 5IO7A 2GTLM 2IZIA 2MJIA 2W2BA 5LJEA 1QVGE 3NBXX 4BX6B 1Y9LA 2DJFA 4WFVA 4IOAE 1LKEA 3U0DA 3CMPA 2G7BA 4O4SA 5FFHA 2LBVA 3QKGA 1VWHB 3QQ2A 1JJUA 3CWKA 4Y0SA 1U18A 3TGBA 1SY1A 2AVIA 1W2BE 2FKGA 2OZQA 3F8AA 4YBUA 4C5PA 3SLOA 5CE4A 1JQPA 3ZW0A 2IZCB 3GE2A 1GT5A 2X8TA 1SWCA 1BSYA 2JN3A 1EALA 4DNEA 2CBRA 4L1NA 2OFRX 3H3IA 1OSPO 4CPHB 1RSTB 5H9LA 1XCAA 5H9NA 1QY0A 3G71E 1L6MA 1YJWE 1RSUB 3X00A 1Q86G 4IO9E 4ID2A 4XMEA 4L3RA 1QY2A 3E3CA 3Q6LA 3CD6E 1SXWA 3KZAA 1S44A 2K62A 3FA9A 4GNWA 1RL6A 4D6AA 4Z2PA 2IZAA 4CDDA 1KOIA 1CBSA 1Y55X 2AKQA 1A2DA 4BX5A
chains in the Genus database with same CATH topology
2OL7A 2OL6O 3EC5A 2OY1O 1RJLC 2OY8A 5B2AO 2OY7A 3CKFA 3IGEA 2I5ZO 3CKGA 2FKJA 3AUMO 2AF5A 2OYBO 3IG9A 2I5VO 1P4PA 2OL8O 1OSPO 5B11O 2OY5O 2PI3O 5B10O 2G8CO 2FKGA 1FJ1E 5B3MO 2HKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OL7 A;  2OL6 O;  3EC5 A;  2OY1 O;  1RJL C;  2OY8 A;  5B2A O;  2OY7 A;  3CKF A;  2I5Z O;  3CKG A;  2FKJ A;  3AUM O;  2AF5 A;  2OYB O;  2I5V O;  1P4P A;  2OL8 O;  1OSP O;  5B11 O;  2OY5 O;  2PI3 O;  5B10 O;  2G8C O;  2FKG A;  1FJ1 E;  5B3M O;  2HKD A; 
#chains in the Genus database with same CATH topology
 5B29 A;  4RUU A;  2LBA A;  1KT6 A;  1OEK A;  5FQ6 E;  2JW1 A;  2GTF X;  3SLT A;  4I3D A;  5HTD A;  1JMX A;  4ALO A;  3DLL E;  4FBR A;  4JGL A;  1QAB E;  1T0V A;  3BLG A;  3D95 A;  2RTF B;  5HA0 A;  4AZP A;  1KXO A;  3HWD A;  1LIB A;  3I56 E;  4GUZ A;  4YFP A;  5HZ8 A;  2GTL N;  3VHH A;  2JMB A;  3S5X A;  4HFO A;  1SWE A;  1N7Y A;  1XKI A;  1NC9 A;  3I0A A;  1EPA A;  1MX8 A;  4GZV A;  5IRA A;  3RBY A;  4M7M A;  3RKG A;  4YFQ A;  3AEH A;  3WJC A;  1WBI A;  1TXL A;  3VPJ E;  1HXL A;  3FIQ A;  3HK1 A;  4GK9 A;  4YKM A;  1YJ9 E;  3KVN A;  1HY2 A;  1STS B;  1N9M A;  2NP1 A;  1ICM A;  1QFV A;  4QZU A;  4QRL A;  2GTL O;  5H9A A;  2LFO A;  1P4P A;  3BU9 A;  4NYQ A;  1SMP I;  4RUN A;  1BRP A;  1HN2 A;  2A2U A;  3VE2 A;  2QM9 A;  4YGH A;  5GAD G;  4ORW A;  4NV7 A;  1X89 A;  1I9H A;  1D3S A;  2ALL X;  2GC9 A;  4KT5 A;  3D4R A;  2R56 A;  4WFU A;  2C4I A;  2RTP B;  1MVG A;  4XMD A;  2OTJ E;  1LDQ A;  1QQS A;  2QEX E;  1MEP A;  1GGL A;  1VWK B;  1MUP A;  4A1Y A;  1EIO A;  1O1U A;  3MVF A;  1YIJ E;  1HQP A;  4QNI A;  4OEM A;  3P6E A;  2Q2M A;  2RD7 C;  4BCS A;  4U8U M;  2HLV A;  3PQU A;  1VQK E;  1EPB A;  1B0O A;  2IZF B;  2W2A A;  5F6B A;  1EQD A;  5AN9 B;  1DZM A;  2F01 A;  1SWF A;  1IKE A;  4TLJ A;  3ZW2 A;  4IBA A;  4Y5D A;  2G78 A;  4HPD A;  3OD9 A;  1JMZ A;  4XMC A;  2ANS A;  3P6H A;  1RLB E;  2R74 A;  1HMR A;  1X8U A;  3SLJ A;  1K8A G;  2X34 A;  1B56 A;  1VWJ B;  1U0X A;  3APX A;  1K73 G;  4QYP A;  5F1E A;  3IG9 A;  1MDC A;  3ELZ A;  4BGF A;  4UU2 A;  5F7G A;  3MBT A;  4D6B A;  4A60 A;  5BYP A;  3EC5 A;  1SRI A;  3UEV A;  3UEX A;  4ZR2 A;  1RAV A;  1YUP A;  4LQZ A;  2FWV A;  1DF3 A;  1OEE A;  1PM1 X;  1SXX A;  1SWO A;  5KID A;  3DSZ A;  1K3B A;  5JR8 A;  1A3Y A;  1HQQ A;  4COT A;  4GJV A;  2A8G A;  3C78 X;  2RTR B;  1VYO A;  5DG4 A;  4ZJ0 A;  3CKG A;  3S60 A;  5LJB A;  3VHM A;  3T2X A;  3PEC A;  2YMS A;  3OW2 E;  2QA4 E;  4IAW A;  3PH6 A;  2GJ5 A;  1JV4 A;  4ORY A;  4XMF A;  1KC8 G;  2IZD B;  2WPU A;  4PSQ A;  2RN4 A;  1N8R G;  1CBI A;  4GU8 A;  1Y0G A;  1BJ7 A;  4YFR A;  1SWH A;  1VWL B;  3Q34 A;  3RE5 A;  4GGT A;  1GM6 A;  1NP4 A;  2CQL A;  4ORR A;  1AVD A;  2L67 A;  4TKB A;  1M90 G;  4ODD A;  3NQ9 A;  3APU A;  5BVQ A;  3UEU A;  1VWQ B;  1VQ9 E;  1SY2 A;  4YVB A;  2AT3 X;  1UZ2 X;  1D2U A;  1LPJ A;  4Z27 A;  4I3C A;  1CBQ A;  4IMO A;  1X71 A;  4MVE A;  4ORU A;  1K9M G;  4CV7 A;  3PDF A;  4EFG A;  2LA7 A;  3RDQ A;  1W4T A;  2ZAI A;  4IMN A;  5K68 A;  3CF5 E;  4QGX A;  2FR3 A;  3I55 E;  1O8V A;  1ERX A;  2ACP X;  1S72 E;  1GX8 A;  3FEK A;  2X8S A;  1Q82 G;  4I9R A;  2JU7 A;  1SLE B;  1UYN X;  3WJD A;  4ORX A;  1PMP A;  1VWC B;  1YWC A;  5LKE A;  3U9P C;  4AZN A;  3ZI8 A;  2WSJ A;  2PI3 O;  3NX1 A;  1GT3 A;  2X32 A;  1AVG I;  1LEL A;  3TF6 A;  1PTS A;  1VQ4 E;  3ZW1 A;  3RWX A;  4ALB A;  4OS3 A;  1SWU A;  4ES7 A;  4GDA A;  5CYB A;  1KZX A;  1FEN A;  1VWO B;  1SY3 A;  2LB6 A;  4ML7 B;  2MM3 A;  1VQM E;  2IZK A;  2OVS A;  2JGS A;  1DZJ A;  4GNY A;  3ZQ3 A;  1A57 A;  4BX6 A;  1KGL A;  2IZB A;  3LHN A;  2JU3 A;  1I05 A;  4YCE A;  2QOS C;  3B2J A;  3RDX A;  5HBS A;  3CBS A;  3CQR A;  2Y32 A;  4GET A;  5AQ6 A;  1R0U A;  2HYS A;  3EW1 A;  2MHD A;  1RXJ A;  4BX7 B;  4Y0P A;  1LNM A;  3FW4 A;  4N7C A;  3K3L A;  5FQ8 E;  4QZT A;  1BLR A;  3B2H A;  1LDO A;  5AJC A;  1EUO A;  1ZNG A;  3P02 A;  3UAQ A;  4HPC A;  1YWB A;  4QYN A;  4OS0 A;  2ZJR E;  5HWZ A;  1LUQ A;  2VFB A;  1VWN B;  3FR4 A;  1SLG B;  4LZV A;  2BS6 A;  2RA6 A;  4CPH A;  4ARH A;  2MO5 A;  5MLC H;  1VWD B;  5H9K A;  1O1V A;  5LJG A;  3JQO A;  5LJC A;  4MVI A;  4MIR A;  3C76 X;  5EEE A;  3WYQ A;  5JD2 A;  1GX3 A;  2OY7 A;  2RTN B;  3CCU E;  2A2G A;  3P24 A;  2RTI B;  1NGL A;  1VQ8 E;  3WZO A;  4TKJ A;  2OY5 O;  3PP6 A;  2XST A;  4IB8 A;  1I04 A;  4WCE E;  1SLF B;  1VWR B;  2M4L A;  1I4U A;  1NBX A;  1E02 A;  5L3Y A;  1W5R A;  2FKJ A;  4TQ2 A;  3FEP A;  3ZZV A;  5HZ9 A;  5HZ6 A;  2QO6 A;  1GXA A;  5AEO A;  1QWD A;  1SWP A;  4O3W A;  4Y59 A;  3BX8 A;  1HMT A;  1LID A;  3CPW E;  1JYD A;  5D45 A;  5H1S I;  2Q4N A;  1YJN E;  5D4A A;  4ZHF A;  4GE1 A;  1KQW A;  3SAO A;  3RY2 A;  4YBP A;  4GD9 A;  2RTA A;  5K06 A;  1QFT A;  3IA8 A;  3NX2 A;  3IFB A;  3KFI A;  3CMA E;  4HPA A;  2A3F X;  3DTQ A;  3I17 A;  1Z24 A;  1KT5 A;  1FJ1 E;  3O2Y A;  4UY8 G;  2OFA A;  5GAG G;  2G79 A;  1N0S A;  1FDQ A;  3B2I A;  1I78 A;  1SXY A;  3P6D A;  2OVE A;  3MX7 A;  1IFB A;  4TJZ A;  4GGR A;  1EI5 A;  3F6Z B;  3PPT A;  2CM9 A;  1VQN E;  4ZGU A;  2DM5 A;  3T6F A;  4YH0 A;  5HCD C;  4ZH6 A;  2G8C O;  1VQ5 E;  3CCQ E;  5D48 A;  1SWT A;  1Y52 X;  2G5L A;  3CCJ E;  3HTY A;  1G74 A;  2BC3 A;  3JSQ A;  4Z28 A;  5C0N A;  5KHP A;  5D47 A;  4NNT A;  1X8N A;  3GAQ A;  3ZUI A;  2QO4 A;  2AT5 X;  3FA6 A;  3ZWE A;  1IIU A;  4Y0Q A;  2CM4 A;  1SRF A;  1FEM A;  2X56 A;  1SWG A;  2C1Q A;  4EXZ A;  3RDS A;  1FE3 A;  4UU3 A;  4YCH A;  1LFO A;  4GKC A;  4MVK A;  4CK4 A;  2FR2 A;  5HAE A;  4WF9 E;  4KH8 A;  2FT9 A;  2RTE B;  1MOY A;  3FEL A;  1CBR A;  4YGG A;  3VG3 A;  4GGZ A;  3IGE A;  5IO5 A;  1VWF B;  2L9C A;  4KCA A;  1HBP A;  1QVF E;  1A18 A;  3CBC A;  3CXC E;  4O3Y A;  2OL6 O;  3RE6 A;  3EMM A;  4FBO A;  1PBY A;  4CDF A;  2BS5 A;  5DPQ A;  3VU1 A;  1DZK A;  3MM0 A;  2HZQ A;  1LIE A;  1DFV A;  2ZSC A;  3EYC A;  1S7D A;  4YDB A;  1P6P A;  1PEE A;  2RQ0 A;  4O9S A;  3P6F A;  4O49 A;  3CC4 E;  2IZH B;  2K23 A;  4IB7 A;  4WFN E;  1AEL A;  1KZW A;  4OMX A;  3NAD A;  2ACO A;  4ZHC A;  1BSO A;  2KT4 B;  3O19 A;  4MIS A;  4TKH A;  2KW1 A;  1SRJ A;  4TNN A;  1DC9 A;  1ALB A;  3FMZ A;  1HXZ A;  5K67 A;  3EM0 A;  5HCC C;  2FS7 A;  2BLG A;  4QQ1 A;  3BS2 A;  1SWS A;  4AW8 A;  2FHL A;  3ELX A;  2OL7 A;  1SWD A;  1RJL C;  4JO6 A;  4NW4 A;  5DM7 E;  3TGC A;  3RDM A;  1EII A;  3BY0 A;  1VQO E;  1PBO A;  4KII A;  4ORS A;  2CAM A;  5LJK A;  4IAX A;  5BVT A;  2HNX A;  2L5P A;  1VWP B;  4IB6 A;  1SWL A;  4U8U N;  1ML7 A;  4YDA A;  4I60 A;  3STM X;  1SLD B;  4FBV A;  3P6G A;  5B27 A;  5KIC A;  4INN A;  3MG5 A;  1E06 A;  5IXG A;  5FEN A;  1YIT E;  3RZY A;  1B4M A;  4KC7 A;  1KL3 A;  1E00 A;  4BQU A;  1E2T A;  4NYR A;  4ZHG A;  2WWP A;  1RXK A;  3FA7 A;  2WEX A;  2CZU A;  4ZFX A;  2OVD A;  4U8U O;  2AH7 X;  3PH5 A;  4IRW A;  4LKT A;  4MEE A;  5HA1 A;  2RTO B;  5FQ7 E;  4CPE A;  2IFB A;  1OEJ A;  3WJG A;  2JOZ A;  4AZM A;  3APW A;  1RBP A;  4NLI A;  2BT9 A;  3WZQ A;  2NNE A;  1ACD A;  1MK5 A;  4BVM A;  1DV9 A;  3VG2 A;  2RTK A;  3B2K A;  4I6S A;  3V8U A;  1GX9 A;  1WUB A;  1BEB A;  1QY1 A;  5LKF A;  1ADL A;  3J7Z G;  1BSQ A;  1UYO X;  2Z4I A;  2A0A A;  1SRG A;  1GKA B;  2OTL E;  3TGA A;  3NR3 A;  2Z4H A;  2I5Z O;  3APV A;  5HL7 E;  2NND A;  3OE3 A;  1NDJ A;  4DCB A;  1TVQ A;  2WQA E;  3EW2 A;  3WJF A;  5L8O A;  1EXS A;  1W6F A;  3D96 A;  4WFA E;  4BJ8 A;  4FQB B;  5L8N A;  2IZL B;  2X55 A;  1OBP A;  1AQB A;  5FAZ A;  2FLJ A;  2Q39 A;  2OF8 A;  5CSE A;  3T1D A;  5LJH A;  2JU8 A;  4U46 A;  5EZ2 A;  3PIP E;  3CCV E;  3RDU A;  4NLJ A;  5HZ5 A;  1K24 A;  2C1S A;  1OPB A;  4ZH9 A;  1GT4 A;  4BX7 A;  2W2F A;  3AKM A;  1VPR A;  3KFH A;  2CZT A;  3D9W A;  3FR5 A;  2HMB A;  2PY1 A;  4AZR A;  1G7N A;  3D97 A;  2UZ2 A;  5CHK A;  1LCW A;  3PK2 A;  3L4R A;  3FA8 A;  4OEL A;  1N4J A;  3U03 A;  3NP1 A;  3OBL A;  4K19 A;  3KFG A;  1YHQ E;  4QGW A;  1STR B;  4JHQ A;  2FS6 A;  3S26 A;  2OFM X;  2QO5 A;  2R73 A;  2Q9S A;  4Z2O A;  1NP1 A;  3JS1 A;  1G5W A;  4OKA A;  3VG5 A;  2OYB O;  1JIW I;  4GH7 A;  2AT6 X;  1JBH A;  3FDC A;  1SWK A;  5IRW A;  2P8G A;  1KT3 A;  1HBQ A;  1SY0 A;  2RTL A;  2RCQ A;  1KFF A;  3P6C A;  2POA A;  2L68 A;  2X4M A;  1BBP A;  3ZW0 B;  2E4J A;  3CC2 E;  3NQK A;  1NQN A;  1IKJ A;  2AT8 X;  1DF8 A;  3WJB A;  3FEN A;  2N93 A;  3HWF A;  1SWB A;  3CR6 A;  4IAB A;  3F9D A;  5BVS A;  3N91 A;  2AF5 A;  1LIF A;  2IZE B;  4NP1 A;  1QG5 A;  1KQS E;  1SWJ A;  3SOT A;  3ZUO A;  4YKO A;  4CSB A;  1NJI G;  3SZI A;  3RSW A;  1JZU A;  4BX5 B;  3PIO E;  2RTC B;  2BSZ A;  4IB9 A;  2QMI A;  2RTB B;  1MX7 A;  1OBQ A;  1TW4 A;  4NNS A;  1GT1 A;  2A13 A;  1AVE A;  1KL5 A;  1KT4 A;  4O3Z A;  3STK A;  3NQ3 A;  5F58 A;  3HWG A;  3OJY C;  3FID A;  4IOC E;  5JVH E;  4Z2V A;  1ZRY A;  1SWA A;  1SRH A;  4Z6J A;  3G4S E;  4YGZ A;  1FEL A;  1NQM A;  3CKF A;  1SWN A;  1FTP A;  4DQ4 A;  1ZNH A;  2KTS A;  4I9S A;  4OMW A;  2OL8 O;  5D8J A;  3VE1 A;  2ZJQ E;  2VDF A;  1Y53 X;  3HWE A;  4KC8 A;  4ZCB A;  1VQ6 E;  1X8Q A;  4AZO A;  2EU7 X;  3S5V A;  4U9C A;  5EPQ A;  4EDE A;  1OBU A;  3C77 X;  1VWM B;  1YWA A;  1BM5 A;  2CBS A;  3HOL A;  4WHI A;  1VWA B;  2QOM A;  5B5F A;  1URE A;  3CCS E;  4CPI A;  1AB0 A;  2YG2 A;  1YP7 A;  3CC7 E;  1KQX A;  4WBK A;  4BOE A;  4BBO A;  1X8O A;  2UYW A;  2FHN X;  2RTJ A;  2WR6 A;  1YI2 E;  3FYF A;  1OPA A;  3BDR A;  1SA8 A;  3VHI A;  2HZR A;  4O3X B;  4GDZ A;  5HZQ A;  1IFC A;  4XMG A;  1TOW A;  5HTE A;  1VWG B;  4LZU A;  1Q81 G;  1ZND A;  1ERB A;  2LKK A;  4O4X A;  1ZNL A;  3VG6 A;  1LCZ A;  2FGS A;  2F09 A;  4HWM A;  1YWD A;  4CDC A;  1E5P A;  3LV4 A;  4ON1 A;  4A8Z A;  1VQL E;  4QAE A;  1HMS A;  1Y9T A;  3CME E;  3PQS A;  3HPE A;  4I95 A;  4DQ3 A;  1Q7Y G;  2WUT A;  1LF7 A;  3RDO A;  4ZHH A;  3SZJ A;  4LKP A;  2IZJ A;  4ZGF A;  2A5C A;  5L8I A;  3VG4 A;  4AYH A;  3G6E E;  1T8V A;  1BWY A;  1SRE A;  3KQ0 A;  4FGI B;  1VYF A;  3TZS A;  2I5V O;  3LTW A;  2FTB A;  3WZN A;  1CRB A;  5B10 O;  4CPF A;  2ZJP E;  1N9Y A;  1EW3 A;  2DJG A;  1T68 X;  1I06 A;  3WBG A;  5JVG E;  1S2P A;  1YIV A;  4YMY A;  5EED A;  5AJB A;  2QCB A;  3PED A;  4PJ2 A;  4QGV A;  4GRJ A;  2AT0 X;  3UEW A;  4MVL A;  1H91 A;  4NV8 A;  4JNJ A;  2RTM A;  2ASN X;  4R0B A;  2OF9 A;  2WEW A;  2VFC A;  3CCL E;  1JJJ A;  3BSZ E;  2X45 A;  5EDB A;  1ZNE A;  4I3B A;  1B8E A;  2RTD B;  2NNQ A;  2HKD A;  2Y3E A;  1KD1 G;  2MF6 A;  3HOE A;  2X8F A;  2OY1 O;  4U3Q A;  4Y0R A;  1DZP A;  4U67 E;  1IJ8 A;  2WQ9 A;  2AMM X;  2X46 A;  1M1K G;  3FW5 A;  3CCR E;  3RY1 A;  5IRU A;  1MM9 A;  1JYJ A;  3VG7 A;  4WFB E;  5HCE C;  5F6Z A;  3T6L A;  1VYG A;  1ZNK A;  1ICN A;  4XMH A;  4AZQ A;  1G85 A;  1YP6 A;  1SWR A;  1N43 A;  1IW2 A;  4EQA C;  3AUM O;  2BHV A;  2F73 A;  2RCT A;  1RXH A;  3WOV A;  3NPO A;  5B2A O;  1SWQ A;  4O4U A;  3STN A;  3CCE E;  3BU1 A;  5GAE G;  1GKA A;  4HPB A;  3B2L A;  2MWH A;  5DM6 E;  2Q2P A;  3WYP A;  4M6S A;  5B11 O;  3KFF A;  2KD2 A;  3AKN A;  5B3M O;  1CJ5 A;  3FR2 A;  5H8T A;  3CCM E;  2RTH B;  1KL4 A;  4EEJ A;  1TOU A;  3WZP A;  4N7D A;  4EKV A;  3G7X A;  2AL0 X;  1LCV A;  2OVA A;  1LIC A;  1SXU A;  2O62 A;  2RTQ B;  3T2W A;  1VWB B;  3O22 A;  3FLL A;  2OY8 A;  5F2B A;  3SZH A;  1BRQ A;  1JJX A;  5GAH G;  3WVM A;  4OS8 A;  4O4O A;  2XKL A;  1STP A;  1KT7 A;  1X8P A;  2A5B A;  4B55 A;  1VQ7 E;  5EDC A;  4CDE A;  2Y3F A;  2ZAG A;  1VWE B;  3CQN A;  3BRN A;  4A1H A;  3EBW A;  3WXQ A;  2FRS A;  3BX7 A;  2OFB A;  5LJD A;  4ZHD A;  1VWI B;  2KTD A;  3ZW1 B;  5IO6 A;  2RTG B;  3EBK A;  1VQP E;  3VGW A;  2IZG B;  5B5G A;  1U17 A;  3WJE A;  1JJ2 E;  4GJS A;  2GH7 A;  5IO7 A;  2GTL M;  2IZI A;  2MJI A;  2W2B A;  5LJE A;  1QVG E;  3NBX X;  4BX6 B;  1Y9L A;  2DJF A;  4WFV A;  4IOA E;  1LKE A;  3U0D A;  3CMP A;  2G7B A;  4O4S A;  5FFH A;  2LBV A;  3QKG A;  1VWH B;  3QQ2 A;  1JJU A;  3CWK A;  4Y0S A;  1U18 A;  3TGB A;  1SY1 A;  2AVI A;  1W2B E;  2FKG A;  2OZQ A;  3F8A A;  4YBU A;  4C5P A;  3SLO A;  5CE4 A;  1JQP A;  3ZW0 A;  2IZC B;  3GE2 A;  1GT5 A;  2X8T A;  1SWC A;  1BSY A;  2JN3 A;  1EAL A;  4DNE A;  2CBR A;  4L1N A;  2OFR X;  3H3I A;  1OSP O;  4CPH B;  1RST B;  5H9L A;  1XCA A;  5H9N A;  1QY0 A;  3G71 E;  1L6M A;  1YJW E;  1RSU B;  3X00 A;  1Q86 G;  4IO9 E;  4ID2 A;  4XME A;  4L3R A;  1QY2 A;  3E3C A;  3Q6L A;  3CD6 E;  1SXW A;  3KZA A;  1S44 A;  2K62 A;  3FA9 A;  4GNW A;  1RL6 A;  4D6A A;  4Z2P A;  2IZA A;  4CDD A;  1KOI A;  1CBS A;  1Y55 X;  2AKQ A;  1A2D A;  4BX5 A; 
#chains in the Genus database with same CATH homology
 2OL7 A;  2OL6 O;  3EC5 A;  2OY1 O;  1RJL C;  2OY8 A;  5B2A O;  2OY7 A;  3CKF A;  3IGE A;  2I5Z O;  3CKG A;  2FKJ A;  3AUM O;  2AF5 A;  2OYB O;  3IG9 A;  2I5V O;  1P4P A;  2OL8 O;  1OSP O;  5B11 O;  2OY5 O;  2PI3 O;  5B10 O;  2G8C O;  2FKG A;  1FJ1 E;  5B3M O;  2HKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...