2AF5A

2.5a x-ray structure of engineered ospa protein
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
292
structure length
292
Chain Sequence
NSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLELKGTSDKNNGSGVLEGVKADKSKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKFNEKGELSEKKITRADKSSTEEKFNEKGELSEKKITRADKSSTEEKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTKENTITVQQYDSNGTKLEGSAVEITKLDEIKNALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Engineered Outer Surface Protein A (OspA) with the inserted
publication title Atomic structures of peptide self-assembly mimics.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags De novo protein, immune system
total genus 56
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2005-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 2af5A01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2af5A02
3.90.930.30 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2af5A03
1P4PA 2OY5O 5B10O 3CKGA 2OL6O 2OL7A 3EC5A 2FKGA 2I5ZO 2OL8O 2HKDA 5B2AO 2OY7A 1RJLC 3CKFA 5B11O 2I5VO 5B3MO 2FKJA 2G8CO 1OSPO 3AUMO 2OY1O 1FJ1E 2PI3O 2OY8A 2AF5A 2OYBO
chains in the Genus database with same CATH superfamily
1QFVA 2G78A 1U18A 4O4OA 4DQ3A 1ERXA 2BT9A 1FTPA 4BX6B 3WZPA 2RTDB 1VWLB 3WBGA 5EEDA 5FQ8E 1BBPA 3VU1A 4GGZA 2G8CO 1JQPA 1X8PA 2G5LA 4TLJA 3UEXA 1B56A 4QZUA 3JSQA 4RUUA 3HWGA 2R73A 3F9DA 1VQ8E 4Y0SA 2KTSA 3VG2A 4WCEE 1CRBA 1W4TA 2OFBA 3MG5A 4GE1A 2G7BA 1P4PA 1RXKA 3C78X 3P6DA 5HZQA 5AEOA 4WF9E 1BLRA 3FENA 3BRNA 4XMFA 1VQKE 1X8OA 4ZCBA 4I3DA 1LDQA 3KQ0A 4NNTA 3CPWE 3NX2A 1E2TA 1TVQA 1WBIA 1YWBA 4TKJA 1QY1A 1TOUA 1VQOE 2X45A 2CZTA 2N93A 4IOCE 5KIDA 2RQ0A 4CDDA 3IGEA 4BJ8A 1ZRYA 3K3LA 2X32A 1YI2E 5BVSA 1X8NA 4FBRA 3P6GA 4DNEA 1CBRA 1I05A 4BVMA 2Q9SA 2WWPA 4N7CA 1O8VA 2YG2A 1SWDA 1ADLA 1LICA 1SWAA 1Y52X 3KFFA 4I9SA 1SLFB 1DF8A 1KT7A 5FFHA 2MF6A 2WQAE 4IO9E 2R74A 3X00A 3STKA 2FGSA 1QG5A 4Z2VA 2RTQB 2OTJE 4YKOA 1Q86G 1STRB 2LBVA 4YGGA 1VQ7E 4YVBA 3TGCA 1UREA 1VYOA 3EYCA 3APWA 1X89A 1K9MG 3T6FA 2C1QA 3NQKA 3P24A 5HTDA 1X8UA 3FR4A 5B29A 1TW4A 3PDFA 1JYJA 1VWOB 1SRIA 4HWMA 4ARHA 2Q39A 1VWAB 1SWTA 3NQ9A 1LELA 4MEEA 2RTIB 5B2AO 3RDSA 2FS7A 4Y5DA 4FBVA 1QY2A 4IB7A 3WZQA 4CK4A 3DSZA 4JGLA 4KC8A 5D45A 1VQ9E 1P6PA 3CCLE 2RD7C 3SLTA 1B8EA 1BJ7A 4Y59A 1Y9TA 5JVGE 4YGHA 3VHIA 3VHHA 2OY7A 5L8IA 4XMHA 3F6ZB 2OVAA 3O19A 1M1KG 1KT4A 3VE2A 3CXCE 4AZQA 1XKIA 1OPAA 2C1SA 4D6AA 1DZMA 1SWCA 3PH5A 2AVIA 4Z27A 3WOVA 1T8VA 2AL0X 2F01A 1AQBA 5H8TA 1LCVA 3P6HA 4K19A 5EDBA 1HXLA 4CPHA 1U17A 5EDCA 5AQ6A 2FLJA 5AJBA 1SRGA 1ZNKA 4NYQA 5HCCC 3WZNA 5LJDA 5LJHA 1YP7A 3HWFA 1FDQA 4YCHA 4GJVA 4EDEA 5IO5A 4QGVA 4I60A 3PQSA 1MK5A 1SY2A 5GADG 3VG6A 3WJFA 4YFPA 4ID2A 3KZAA 2QEXE 1MDCA 1HBPA 4JHQA 1VQ5E 1VQNE 5HZ5A 4UY8G 3FA9A 3CD6E 2IZDB 2DJGA 1KL5A 3CQRA 5AN9B 2WEXA 5IRWA 1VWEB 3PEDA 2FWVA 4GKCA 4LZUA 2HLVA 2CQLA 4ZH6A 3C77X 1B4MA 1IW2A 1ZNHA 1HMSA 3NR3A 3E3CA 3VG5A 3FLLA 1CBQA 2XSTA 3FR2A 3FA7A 5B11O 2OZQA 2Z4IA 4QYPA 2RTMA 3DTQA 3T2XA 2OY1O 1YJWE 5HA1A 2BS6A 1YUPA 4BOEA 3UEUA 1KQWA 4ORSA 4ZHDA 4IOAE 1O1UA 1PEEA 2JU8A 4GD9A 2A5BA 4YBUA 4ZHGA 3TZSA 1DZPA 2PI3O 4NYRA 1G85A 1ZNLA 5H9AA 1LNMA 3CCQE 4AW8A 4Z2OA 4HPBA 1Z24A 4MISA 2FHLA 1SWSA 1X71A 1BSOA 1LIFA 1AVEA 1XCAA 3HOEA 2HMBA 4ZR2A 3NPOA 5H9LA 4NNSA 1X8QA 3BU1A 2MJIA 3HWEA 3PQUA 4HPAA 2OL8O 3IFBA 3F8AA 2RCTA 1N8RG 2FRSA 1RLBE 4CDEA 4CSBA 1A3YA 2RTCB 4XMDA 4UU2A 4ON1A 5H1SI 5HAEA 3BU9A 3RDOA 3CCVE 4WFBE 3G7XA 4EEJA 3B2IA 1EPBA 4EKVA 3Q34A 5LJGA 1K8AG 3ZW2A 1QVGE 2QOMA 3OBLA 1G74A 1W6FA 3WYQA 5F7GA 1HMTA 1RSUB 3CCJE 1I06A 2FTBA 1UYOX 3NP1A 3EW1A 3P02A 3SAOA 3PPTA 2HZRA 5FENA 2BC3A 4QYNA 2MHDA 5B5FA 3BS2A 5HL7E 2ZSCA 2A3FX 1JJJA 3WJBA 1SWBA 5C0NA 2W2AA 3U03A 4WFNE 4L3RA 1Q7YG 4OS3A 4KC7A 1QFTA 4OELA 1OEJA 1KT5A 1KT6A 4FGIB 4NLJA 2RTBB 1JYDA 2JU7A 2M4LA 1EIIA 4GK9A 3PECA 2X4MA 1VWRB 1B0OA 2BS5A 3B2KA 1ML7A 1CBSA 1GX8A 3RDQA 1HY2A 1FELA 3VE1A 2LBAA 3N91A 2L9CA 5HWZA 4PSQA 1GM6A 1N7YA 1SMPI 2BLGA 2HYSA 1PMPA 2JU3A 1TOWA 1QY0A 3PK2A 3WJGA 5DPQA 4CPHB 3VG4A 3P6EA 4QGXA 4TKBA 1IKEA 1NP4A 4YMYA 2OY5O 2ALLX 1N0SA 2NNQA 5F2BA 1GKAA 2ZJRE 1LKEA 1A57A 2OTLE 1NQNA 4CPFA 1ZNEA 1TXLA 1GT3A 1SWLA 4ORYA 1PBYA 2RTGB 4M6SA 3HK1A 4BX5A 1K3BA 2IZBA 1KL3A 4ML7B 2E4JA 1EQDA 4PJ2A 3DLLE 4M7MA 3CWKA 1IFBA 5H9NA 2AT8X 2LFOA 4YDBA 2QCBA 1MM9A 3WYPA 2FT9A 1E5PA 1OEKA 1YJNE 2UZ2A 4I3CA 3FR5A 3B2JA 2QM9A 4A60A 5DM7E 1KQSE 1AELA 4EXZA 5KHPA 3VG7A 1GX9A 5BVTA 3CQNA 3KFGA 1K24A 1W5RA 4OEMA 3CR6A 5B5GA 1HN2A 3CBSA 2W2FA 2C4IA 3H3IA 1EALA 2MWHA 1VWNB 1VYFA 1A18A 4ORWA 5D8JA 3QKGA 1SWEA 1KZXA 3GE2A 2NNEA 3OW2E 4ZGUA 1KXOA 3NBXX 5K68A 2RTLA 2AT3X 4GGRA 3SZIA 1MUPA 5HCEC 5DM6E 3FEKA 1K73G 1S44A 5EPQA 1SY3A 1Q82G 3FW4A 2A0AA 5IXGA 3GAQA 2OFRX 4LQZA 4GRJA 4N7DA 3KFHA 5EZ2A 1KT3A 1AB0A 4Y0RA 3JS1A 1S7DA 3ZW0A 4O3YA 4CPIA 3WJCA 3RDUA 2IZJA 1SXUA 5B3MO 4ZFXA 3LHNA 3WJEA 1CJ5A 3RBYA 1GT5A 3EBWA 3STMX 1LIDA 1GXAA 3UEVA 2AT0X 1WUBA 4YFRA 5F1EA 4OMWA 3CF5E 1VQLE 4D6BA 1HXZA 3FIDA 2KT4B 2JN3A 3J7ZG 1LPJA 4YBPA 3I0AA 1JIWI 1MX7A 2X8FA 4B55A 3CC7E 3OJYC 3PIOE 5HZ9A 3RDXA 4QAEA 4KCAA 2AT6X 4IB9A 4HFOA 1SWRA 4QGWA 4TQ2A 2DJFA 2HNXA 3RKGA 1JJUA 1SREA 4YH0A 3ZUOA 2GH7A 1BSQA 4YDAA 1HQQA 3BLGA 3UEWA 5BYPA 4IB8A 4WFUA 1N4JA 2X8TA 1KL4A 2LKKA 2BHVA 5HTEA 2K62A 1N9MA 1G5WA 4GH7A 1LDOA 1YP6A 1JJXA 4LKPA 3FDCA 1SRHA 4GNWA 1R0UA 1UYNX 1LF7A 4RUNA 1GKAB 3O22A 2CAMA 4GJSA 1VWHB 1QABE 1JMZA 2JOZA 3STNA 2X34A 5HZ6A 4KH8A 1DC9A 3VPJE 3VGWA 5MLCH 1IFCA 1JV4A 2OVDA 3NQ3A 1YWCA 4AYHA 1AVDA 2OVSA 1T68X 4BX5B 3TGBA 2IZEB 5AJCA 3AKMA 4MVLA 1STSB 3WJDA 2AKQA 3FA8A 4JNJA 1SY0A 1SWOA 3BX8A 4TJZA 1Y9LA 2CM9A 1YJ9E 1CBIA 2WUTA 2HZQA 4QNIA 5F58A 3SLOA 3G4SE 5IRUA 4I9RA 4CPEA 2ZJQE 1IJ8A 4NP1A 2FHNX 4UU3A 2AT5X 4Y0PA 1FENA 2ACOA 2IZIA 5CHKA 3AEHA 3MM0A 1I04A 4Z6JA 1NDJA 4GZVA 2NP1A 1VWQB 5CSEA 3P6CA 4ORRA 4YGZA 1SY1A 3CKFA 1GX3A 2ZAGA 3BSZE 4KIIA 2W2BA 3ZUIA 4U8UO 1JBHA 5HZ8A 1VWMB 3ZW1A 3WZOA 3APUA 4FBOA 1E02A 2IZAA 2I5VO 1STPA 4QRLA 1EI5A 2A5CA 1SWUA 4EQAC 1NJIG 2IZLB 1SLDB 3AUMO 4LKTA 3PP6A 1T0VA 4O3WA 3CKGA 2OL6O 1JMXA 3Q6LA 1A2DA 3OE3A 1KGLA 1SWPA 2X55A 3SOTA 1ICNA 4LZVA 3T1DA 2RTRB 2WEWA 4IMNA 2RTPB 3T6LA 3ZQ3A 4BQUA 3CMAE 5F6ZA 1LIEA 3ZW0B 4EFGA 3IG9A 2KD2A 3FIQA 4IAWA 3TGAA 2F73A 2QO6A 5H9KA 2GTLM 3LV4A 5BVQA 2CBSA 4U46A 1D3SA 3QQ2A 5LJBA 3CCME 4YKMA 2UYWA 3ELZA 3ZZVA 2RTOB 1VWIB 2FKGA 3P6FA 5DG4A 1DZJA 4ORXA 1ZNDA 4NV8A 3PIPE 4IBAA 5KICA 1Y0GA 4Z2PA 5CYBA 2RTJA 4BBOA 4I95A 3SZJA 3O2YA 1N43A 4OKAA 2WSJA 2A8GA 2CM4A 2GTLO 1ACDA 1MEPA 3S60A 1HMRA 4DCBA 2CZUA 2RTEB 5EEEA 4U3QA 1VQPE 1I4UA 5HA0A 4ZJ0A 3APXA 3CCSE 3B2LA 1LIBA 4WFVA 4ALBA 5IRAA 3NX1A 1DV9A 3PH6A 3HOLA 1LCZA 3L4RA 4GU8A 2GTLN 3ZWEA 4GNYA 1QQSA 1PM1X 4GETA 2QO5A 3I56E 1Y55X 1HQPA 2RTHB 4CDCA 5GAHG 2IZHB 2Q2MA 4CDFA 5LKFA 5FAZA 1Q81G 4GDZA 4BX7A 1FEMA 1L6MA 1SRJA 3EW2A 2CBRA 2HKDA 1U0XA 4U67E 2IZKA 1OPBA 2LA7A 3RWXA 2KW1A 1OBPA 1YWAA 2G79A 2Y3FA 2ZAIA 5FQ7E 2QOSC 2X8SA 3FELA 3KFIA 1RXJA 2OY8A 2OVEA 3D97A 1O1VA 4A1HA 2OYBO 3CBCA 1EW3A 2O62A 3WVMA 1ICMA 3EC5A 2OF9A 1NBXA 4ZHFA 2R56A 2FS6A 1VQME 1SXYA 3D4RA 3RY1A 2GJ5A 1LCWA 1QWDA 2QO4A 4IAXA 4AZOA 4XMGA 1YITE 1KD1G 1VYGA 2L5PA 1MX8A 4IRWA 2I5ZO 2MM3A 2P8GA 1KZWA 1G7NA 1DFVA 3D9WA 1SXWA 3OD9A 1SWQA 3NADA 1S72E 1E00A 2IZGB 4O3ZA 4O3XB 1SLEB 4NLIA 3B2HA 4HPCA 1GT1A 2QMIA 1KQXA 4A8ZA 3I17A 4IABA 2X56A 4R0BA 4NW4A 4ZH9A 1UZ2X 2VFCA 3ZW1B 3WXQA 4GGTA 1HBQA 1Y53X 3RY2A 4ZGFA 1I9HA 2RTFB 4HPDA 3G6EE 5IO6A 3V8UA 3FMZA 2QA4E 1EXSA 1I78A 3G71E 2VFBA 5FQ6E 1KC8G 2DM5A 1SWKA 3HWDA 4XMEA 1E06A 3KVNA 4GUZA 3BY0A 2Q4NA 2L68A 2GTFX 1FE3A 3S26A 4DQ4A 4AZMA 2ANSA 2NNDA 4MVEA 1KOIA 3VG3A 2ASNX 2POAA 1SWGA 2ACPX 1VWDB 4OMXA 1VWPB 3CC2E 1H91A 2OFMX 1YHQE 1NC9A 4BGFA 5LJCA 2VDFA 3T2WA 2WR6A 4YFQA 2RCQA 1N9YA 3S5XA 3AKNA 1IKJA 1EPAA 1RXHA 4O9SA 5HCDC 3CCEE 4O49A 5L8NA 1YIJE 4OS8A 1MVGA 4COTA 1AVGI 2MO5A 5CE4A 3U9PC 5B10O 2OFAA 2ZJPE 1M90G 3FYFA 1D2UA 5F6BA 1VWGB 4BX6A 4MVIA 2IZCB 4MVKA 3VHMA 3FW5A 5JR8A 1VWKB 5D48A 2X46A 4O4UA 4O4XA 1BRQA 3CCUE 3CMEE 3MBTA 3MX7A 4A1YA 1RSTB 3UAQA 4Y0QA 3BX7A 1RAVA 5K06A 1GT4A 2WQ9A 1KFFA 4U9CA 5JD2A 3RSWA 1LUQA 2Y32A 4I3BA 3RE5A 4O4SA 1LFOA 5D47A 3U0DA 4BX7B 2AF5A 5K67A 2F09A 5B27A 5GAEG 1ZNGA 2Y3EA 3IA8A 1VQ4E 5LJEA 2Z4HA 3EBKA 1VQ6E 1BM5A 3RDMA 4KT5A 2IFBA 5D4AA 1OEEA 4ES7A 2FR3A 5GAGG 2JGSA 1VWCB 1VWBB 1BRPA 1YIVA 2OL7A 2AH7X 5JVHE 2RTNB 3D95A 4AZRA 1PBOA 4U8UM 1PTSA 4QZTA 2LB6A 4NV7A 1OSPO 4WFAE 4AZPA 3HPEA 2XKLA 1S2PA 1BWYA 3ELXA 2K23A 2RA6A 1SWFA 3EM0A 5LKEA 4CV7A 2RN4A 4JO6A 1NQMA 1YWDA 1OBUA 2YMSA 1BEBA 2A2UA 3LTWA 1OBQA 2FR2A 3I55E 4TNNA 1VPRA 5IO7A 2OF8A 2PY1A 1W2BE 3CMPA 4FQBB 4I6SA 1RJLC 3MVFA 4GDAA 1DF3A 1SRFA 2L67A 1SWJA 2A2GA 5HBSA 4WHIA 1FJ1E 1GGLA 3C76X 2A13A 4ORUA 3RE6A 1JJ2E 3EMMA 4TKHA 1NGLA 3D96A 3CC4E 3JQOA 4C5PA 1VWJB 4U8UN 2FKJA 3CCRE 1SA8A 2GC9A 3TF6A 3RZYA 4IB6A 1BSYA 1DZKA 4OS0A 3FA6A 1MOYA 1SLGB 4ZHCA 5LJKA 1SWHA 2RTKA 4INNA 4Z28A 2KTDA 4AZNA 2Q2PA 2IZFB 1SWNA 2JW1A 5L8OA 4QQ1A 1JZUA 4XMCA 3SLJA 3APVA 1VWFB 5L3YA 3HTYA 2BSZA 2EU7X 1IIUA 1EIOA 1EUOA 1ERBA 4YCEA 4MIRA 3S5VA 2RTAA 4ALOA 4ODDA 3ZI8A 2JMBA 4L1NA 4ZHHA 3BDRA 1RBPA 1ALBA 4BCSA 1QVFE 1NP1A 1SXXA 4IMOA 2WPUA 2AMMX 3SZHA 3FEPA 4WBKA 1RL6A
chains in the Genus database with same CATH topology
1P4PA 2OY5O 5B10O 3CKGA 2OL6O 2OL7A 3EC5A 2FKGA 2I5ZO 3IG9A 2OL8O 2HKDA 5B2AO 2OY7A 1RJLC 3CKFA 5B11O 2I5VO 5B3MO 2FKJA 2G8CO 1OSPO 3AUMO 2OY1O 1FJ1E 2PI3O 2OY8A 2AF5A 3IGEA 2OYBO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P4P A;  2OY5 O;  5B10 O;  3CKG A;  2OL6 O;  2OL7 A;  3EC5 A;  2FKG A;  2I5Z O;  2OL8 O;  2HKD A;  5B2A O;  2OY7 A;  1RJL C;  3CKF A;  5B11 O;  2I5V O;  5B3M O;  2FKJ A;  2G8C O;  1OSP O;  3AUM O;  2OY1 O;  1FJ1 E;  2PI3 O;  2OY8 A;  2AF5 A;  2OYB O; 
#chains in the Genus database with same CATH topology
 1QFV A;  2G78 A;  1U18 A;  4O4O A;  4DQ3 A;  1ERX A;  2BT9 A;  1FTP A;  4BX6 B;  3WZP A;  2RTD B;  1VWL B;  3WBG A;  5EED A;  5FQ8 E;  1BBP A;  3VU1 A;  4GGZ A;  2G8C O;  1JQP A;  1X8P A;  2G5L A;  4TLJ A;  3UEX A;  1B56 A;  4QZU A;  3JSQ A;  4RUU A;  3HWG A;  2R73 A;  3F9D A;  1VQ8 E;  4Y0S A;  2KTS A;  3VG2 A;  4WCE E;  1CRB A;  1W4T A;  2OFB A;  3MG5 A;  4GE1 A;  2G7B A;  1P4P A;  1RXK A;  3C78 X;  3P6D A;  5HZQ A;  5AEO A;  4WF9 E;  1BLR A;  3FEN A;  3BRN A;  4XMF A;  1VQK E;  1X8O A;  4ZCB A;  4I3D A;  1LDQ A;  3KQ0 A;  4NNT A;  3CPW E;  3NX2 A;  1E2T A;  1TVQ A;  1WBI A;  1YWB A;  4TKJ A;  1QY1 A;  1TOU A;  1VQO E;  2X45 A;  2CZT A;  2N93 A;  4IOC E;  5KID A;  2RQ0 A;  4CDD A;  3IGE A;  4BJ8 A;  1ZRY A;  3K3L A;  2X32 A;  1YI2 E;  5BVS A;  1X8N A;  4FBR A;  3P6G A;  4DNE A;  1CBR A;  1I05 A;  4BVM A;  2Q9S A;  2WWP A;  4N7C A;  1O8V A;  2YG2 A;  1SWD A;  1ADL A;  1LIC A;  1SWA A;  1Y52 X;  3KFF A;  4I9S A;  1SLF B;  1DF8 A;  1KT7 A;  5FFH A;  2MF6 A;  2WQA E;  4IO9 E;  2R74 A;  3X00 A;  3STK A;  2FGS A;  1QG5 A;  4Z2V A;  2RTQ B;  2OTJ E;  4YKO A;  1Q86 G;  1STR B;  2LBV A;  4YGG A;  1VQ7 E;  4YVB A;  3TGC A;  1URE A;  1VYO A;  3EYC A;  3APW A;  1X89 A;  1K9M G;  3T6F A;  2C1Q A;  3NQK A;  3P24 A;  5HTD A;  1X8U A;  3FR4 A;  5B29 A;  1TW4 A;  3PDF A;  1JYJ A;  1VWO B;  1SRI A;  4HWM A;  4ARH A;  2Q39 A;  1VWA B;  1SWT A;  3NQ9 A;  1LEL A;  4MEE A;  2RTI B;  5B2A O;  3RDS A;  2FS7 A;  4Y5D A;  4FBV A;  1QY2 A;  4IB7 A;  3WZQ A;  4CK4 A;  3DSZ A;  4JGL A;  4KC8 A;  5D45 A;  1VQ9 E;  1P6P A;  3CCL E;  2RD7 C;  3SLT A;  1B8E A;  1BJ7 A;  4Y59 A;  1Y9T A;  5JVG E;  4YGH A;  3VHI A;  3VHH A;  2OY7 A;  5L8I A;  4XMH A;  3F6Z B;  2OVA A;  3O19 A;  1M1K G;  1KT4 A;  3VE2 A;  3CXC E;  4AZQ A;  1XKI A;  1OPA A;  2C1S A;  4D6A A;  1DZM A;  1SWC A;  3PH5 A;  2AVI A;  4Z27 A;  3WOV A;  1T8V A;  2AL0 X;  2F01 A;  1AQB A;  5H8T A;  1LCV A;  3P6H A;  4K19 A;  5EDB A;  1HXL A;  4CPH A;  1U17 A;  5EDC A;  5AQ6 A;  2FLJ A;  5AJB A;  1SRG A;  1ZNK A;  4NYQ A;  5HCC C;  3WZN A;  5LJD A;  5LJH A;  1YP7 A;  3HWF A;  1FDQ A;  4YCH A;  4GJV A;  4EDE A;  5IO5 A;  4QGV A;  4I60 A;  3PQS A;  1MK5 A;  1SY2 A;  5GAD G;  3VG6 A;  3WJF A;  4YFP A;  4ID2 A;  3KZA A;  2QEX E;  1MDC A;  1HBP A;  4JHQ A;  1VQ5 E;  1VQN E;  5HZ5 A;  4UY8 G;  3FA9 A;  3CD6 E;  2IZD B;  2DJG A;  1KL5 A;  3CQR A;  5AN9 B;  2WEX A;  5IRW A;  1VWE B;  3PED A;  2FWV A;  4GKC A;  4LZU A;  2HLV A;  2CQL A;  4ZH6 A;  3C77 X;  1B4M A;  1IW2 A;  1ZNH A;  1HMS A;  3NR3 A;  3E3C A;  3VG5 A;  3FLL A;  1CBQ A;  2XST A;  3FR2 A;  3FA7 A;  5B11 O;  2OZQ A;  2Z4I A;  4QYP A;  2RTM A;  3DTQ A;  3T2X A;  2OY1 O;  1YJW E;  5HA1 A;  2BS6 A;  1YUP A;  4BOE A;  3UEU A;  1KQW A;  4ORS A;  4ZHD A;  4IOA E;  1O1U A;  1PEE A;  2JU8 A;  4GD9 A;  2A5B A;  4YBU A;  4ZHG A;  3TZS A;  1DZP A;  2PI3 O;  4NYR A;  1G85 A;  1ZNL A;  5H9A A;  1LNM A;  3CCQ E;  4AW8 A;  4Z2O A;  4HPB A;  1Z24 A;  4MIS A;  2FHL A;  1SWS A;  1X71 A;  1BSO A;  1LIF A;  1AVE A;  1XCA A;  3HOE A;  2HMB A;  4ZR2 A;  3NPO A;  5H9L A;  4NNS A;  1X8Q A;  3BU1 A;  2MJI A;  3HWE A;  3PQU A;  4HPA A;  2OL8 O;  3IFB A;  3F8A A;  2RCT A;  1N8R G;  2FRS A;  1RLB E;  4CDE A;  4CSB A;  1A3Y A;  2RTC B;  4XMD A;  4UU2 A;  4ON1 A;  5H1S I;  5HAE A;  3BU9 A;  3RDO A;  3CCV E;  4WFB E;  3G7X A;  4EEJ A;  3B2I A;  1EPB A;  4EKV A;  3Q34 A;  5LJG A;  1K8A G;  3ZW2 A;  1QVG E;  2QOM A;  3OBL A;  1G74 A;  1W6F A;  3WYQ A;  5F7G A;  1HMT A;  1RSU B;  3CCJ E;  1I06 A;  2FTB A;  1UYO X;  3NP1 A;  3EW1 A;  3P02 A;  3SAO A;  3PPT A;  2HZR A;  5FEN A;  2BC3 A;  4QYN A;  2MHD A;  5B5F A;  3BS2 A;  5HL7 E;  2ZSC A;  2A3F X;  1JJJ A;  3WJB A;  1SWB A;  5C0N A;  2W2A A;  3U03 A;  4WFN E;  4L3R A;  1Q7Y G;  4OS3 A;  4KC7 A;  1QFT A;  4OEL A;  1OEJ A;  1KT5 A;  1KT6 A;  4FGI B;  4NLJ A;  2RTB B;  1JYD A;  2JU7 A;  2M4L A;  1EII A;  4GK9 A;  3PEC A;  2X4M A;  1VWR B;  1B0O A;  2BS5 A;  3B2K A;  1ML7 A;  1CBS A;  1GX8 A;  3RDQ A;  1HY2 A;  1FEL A;  3VE1 A;  2LBA A;  3N91 A;  2L9C A;  5HWZ A;  4PSQ A;  1GM6 A;  1N7Y A;  1SMP I;  2BLG A;  2HYS A;  1PMP A;  2JU3 A;  1TOW A;  1QY0 A;  3PK2 A;  3WJG A;  5DPQ A;  4CPH B;  3VG4 A;  3P6E A;  4QGX A;  4TKB A;  1IKE A;  1NP4 A;  4YMY A;  2OY5 O;  2ALL X;  1N0S A;  2NNQ A;  5F2B A;  1GKA A;  2ZJR E;  1LKE A;  1A57 A;  2OTL E;  1NQN A;  4CPF A;  1ZNE A;  1TXL A;  1GT3 A;  1SWL A;  4ORY A;  1PBY A;  2RTG B;  4M6S A;  3HK1 A;  4BX5 A;  1K3B A;  2IZB A;  1KL3 A;  4ML7 B;  2E4J A;  1EQD A;  4PJ2 A;  3DLL E;  4M7M A;  3CWK A;  1IFB A;  5H9N A;  2AT8 X;  2LFO A;  4YDB A;  2QCB A;  1MM9 A;  3WYP A;  2FT9 A;  1E5P A;  1OEK A;  1YJN E;  2UZ2 A;  4I3C A;  3FR5 A;  3B2J A;  2QM9 A;  4A60 A;  5DM7 E;  1KQS E;  1AEL A;  4EXZ A;  5KHP A;  3VG7 A;  1GX9 A;  5BVT A;  3CQN A;  3KFG A;  1K24 A;  1W5R A;  4OEM A;  3CR6 A;  5B5G A;  1HN2 A;  3CBS A;  2W2F A;  2C4I A;  3H3I A;  1EAL A;  2MWH A;  1VWN B;  1VYF A;  1A18 A;  4ORW A;  5D8J A;  3QKG A;  1SWE A;  1KZX A;  3GE2 A;  2NNE A;  3OW2 E;  4ZGU A;  1KXO A;  3NBX X;  5K68 A;  2RTL A;  2AT3 X;  4GGR A;  3SZI A;  1MUP A;  5HCE C;  5DM6 E;  3FEK A;  1K73 G;  1S44 A;  5EPQ A;  1SY3 A;  1Q82 G;  3FW4 A;  2A0A A;  5IXG A;  3GAQ A;  2OFR X;  4LQZ A;  4GRJ A;  4N7D A;  3KFH A;  5EZ2 A;  1KT3 A;  1AB0 A;  4Y0R A;  3JS1 A;  1S7D A;  3ZW0 A;  4O3Y A;  4CPI A;  3WJC A;  3RDU A;  2IZJ A;  1SXU A;  5B3M O;  4ZFX A;  3LHN A;  3WJE A;  1CJ5 A;  3RBY A;  1GT5 A;  3EBW A;  3STM X;  1LID A;  1GXA A;  3UEV A;  2AT0 X;  1WUB A;  4YFR A;  5F1E A;  4OMW A;  3CF5 E;  1VQL E;  4D6B A;  1HXZ A;  3FID A;  2KT4 B;  2JN3 A;  3J7Z G;  1LPJ A;  4YBP A;  3I0A A;  1JIW I;  1MX7 A;  2X8F A;  4B55 A;  3CC7 E;  3OJY C;  3PIO E;  5HZ9 A;  3RDX A;  4QAE A;  4KCA A;  2AT6 X;  4IB9 A;  4HFO A;  1SWR A;  4QGW A;  4TQ2 A;  2DJF A;  2HNX A;  3RKG A;  1JJU A;  1SRE A;  4YH0 A;  3ZUO A;  2GH7 A;  1BSQ A;  4YDA A;  1HQQ A;  3BLG A;  3UEW A;  5BYP A;  4IB8 A;  4WFU A;  1N4J A;  2X8T A;  1KL4 A;  2LKK A;  2BHV A;  5HTE A;  2K62 A;  1N9M A;  1G5W A;  4GH7 A;  1LDO A;  1YP6 A;  1JJX A;  4LKP A;  3FDC A;  1SRH A;  4GNW A;  1R0U A;  1UYN X;  1LF7 A;  4RUN A;  1GKA B;  3O22 A;  2CAM A;  4GJS A;  1VWH B;  1QAB E;  1JMZ A;  2JOZ A;  3STN A;  2X34 A;  5HZ6 A;  4KH8 A;  1DC9 A;  3VPJ E;  3VGW A;  5MLC H;  1IFC A;  1JV4 A;  2OVD A;  3NQ3 A;  1YWC A;  4AYH A;  1AVD A;  2OVS A;  1T68 X;  4BX5 B;  3TGB A;  2IZE B;  5AJC A;  3AKM A;  4MVL A;  1STS B;  3WJD A;  2AKQ A;  3FA8 A;  4JNJ A;  1SY0 A;  1SWO A;  3BX8 A;  4TJZ A;  1Y9L A;  2CM9 A;  1YJ9 E;  1CBI A;  2WUT A;  2HZQ A;  4QNI A;  5F58 A;  3SLO A;  3G4S E;  5IRU A;  4I9R A;  4CPE A;  2ZJQ E;  1IJ8 A;  4NP1 A;  2FHN X;  4UU3 A;  2AT5 X;  4Y0P A;  1FEN A;  2ACO A;  2IZI A;  5CHK A;  3AEH A;  3MM0 A;  1I04 A;  4Z6J A;  1NDJ A;  4GZV A;  2NP1 A;  1VWQ B;  5CSE A;  3P6C A;  4ORR A;  4YGZ A;  1SY1 A;  3CKF A;  1GX3 A;  2ZAG A;  3BSZ E;  4KII A;  2W2B A;  3ZUI A;  4U8U O;  1JBH A;  5HZ8 A;  1VWM B;  3ZW1 A;  3WZO A;  3APU A;  4FBO A;  1E02 A;  2IZA A;  2I5V O;  1STP A;  4QRL A;  1EI5 A;  2A5C A;  1SWU A;  4EQA C;  1NJI G;  2IZL B;  1SLD B;  3AUM O;  4LKT A;  3PP6 A;  1T0V A;  4O3W A;  3CKG A;  2OL6 O;  1JMX A;  3Q6L A;  1A2D A;  3OE3 A;  1KGL A;  1SWP A;  2X55 A;  3SOT A;  1ICN A;  4LZV A;  3T1D A;  2RTR B;  2WEW A;  4IMN A;  2RTP B;  3T6L A;  3ZQ3 A;  4BQU A;  3CMA E;  5F6Z A;  1LIE A;  3ZW0 B;  4EFG A;  3IG9 A;  2KD2 A;  3FIQ A;  4IAW A;  3TGA A;  2F73 A;  2QO6 A;  5H9K A;  2GTL M;  3LV4 A;  5BVQ A;  2CBS A;  4U46 A;  1D3S A;  3QQ2 A;  5LJB A;  3CCM E;  4YKM A;  2UYW A;  3ELZ A;  3ZZV A;  2RTO B;  1VWI B;  2FKG A;  3P6F A;  5DG4 A;  1DZJ A;  4ORX A;  1ZND A;  4NV8 A;  3PIP E;  4IBA A;  5KIC A;  1Y0G A;  4Z2P A;  5CYB A;  2RTJ A;  4BBO A;  4I95 A;  3SZJ A;  3O2Y A;  1N43 A;  4OKA A;  2WSJ A;  2A8G A;  2CM4 A;  2GTL O;  1ACD A;  1MEP A;  3S60 A;  1HMR A;  4DCB A;  2CZU A;  2RTE B;  5EEE A;  4U3Q A;  1VQP E;  1I4U A;  5HA0 A;  4ZJ0 A;  3APX A;  3CCS E;  3B2L A;  1LIB A;  4WFV A;  4ALB A;  5IRA A;  3NX1 A;  1DV9 A;  3PH6 A;  3HOL A;  1LCZ A;  3L4R A;  4GU8 A;  2GTL N;  3ZWE A;  4GNY A;  1QQS A;  1PM1 X;  4GET A;  2QO5 A;  3I56 E;  1Y55 X;  1HQP A;  2RTH B;  4CDC A;  5GAH G;  2IZH B;  2Q2M A;  4CDF A;  5LKF A;  5FAZ A;  1Q81 G;  4GDZ A;  4BX7 A;  1FEM A;  1L6M A;  1SRJ A;  3EW2 A;  2CBR A;  2HKD A;  1U0X A;  4U67 E;  2IZK A;  1OPB A;  2LA7 A;  3RWX A;  2KW1 A;  1OBP A;  1YWA A;  2G79 A;  2Y3F A;  2ZAI A;  5FQ7 E;  2QOS C;  2X8S A;  3FEL A;  3KFI A;  1RXJ A;  2OY8 A;  2OVE A;  3D97 A;  1O1V A;  4A1H A;  2OYB O;  3CBC A;  1EW3 A;  2O62 A;  3WVM A;  1ICM A;  3EC5 A;  2OF9 A;  1NBX A;  4ZHF A;  2R56 A;  2FS6 A;  1VQM E;  1SXY A;  3D4R A;  3RY1 A;  2GJ5 A;  1LCW A;  1QWD A;  2QO4 A;  4IAX A;  4AZO A;  4XMG A;  1YIT E;  1KD1 G;  1VYG A;  2L5P A;  1MX8 A;  4IRW A;  2I5Z O;  2MM3 A;  2P8G A;  1KZW A;  1G7N A;  1DFV A;  3D9W A;  1SXW A;  3OD9 A;  1SWQ A;  3NAD A;  1S72 E;  1E00 A;  2IZG B;  4O3Z A;  4O3X B;  1SLE B;  4NLI A;  3B2H A;  4HPC A;  1GT1 A;  2QMI A;  1KQX A;  4A8Z A;  3I17 A;  4IAB A;  2X56 A;  4R0B A;  4NW4 A;  4ZH9 A;  1UZ2 X;  2VFC A;  3ZW1 B;  3WXQ A;  4GGT A;  1HBQ A;  1Y53 X;  3RY2 A;  4ZGF A;  1I9H A;  2RTF B;  4HPD A;  3G6E E;  5IO6 A;  3V8U A;  3FMZ A;  2QA4 E;  1EXS A;  1I78 A;  3G71 E;  2VFB A;  5FQ6 E;  1KC8 G;  2DM5 A;  1SWK A;  3HWD A;  4XME A;  1E06 A;  3KVN A;  4GUZ A;  3BY0 A;  2Q4N A;  2L68 A;  2GTF X;  1FE3 A;  3S26 A;  4DQ4 A;  4AZM A;  2ANS A;  2NND A;  4MVE A;  1KOI A;  3VG3 A;  2ASN X;  2POA A;  1SWG A;  2ACP X;  1VWD B;  4OMX A;  1VWP B;  3CC2 E;  1H91 A;  2OFM X;  1YHQ E;  1NC9 A;  4BGF A;  5LJC A;  2VDF A;  3T2W A;  2WR6 A;  4YFQ A;  2RCQ A;  1N9Y A;  3S5X A;  3AKN A;  1IKJ A;  1EPA A;  1RXH A;  4O9S A;  5HCD C;  3CCE E;  4O49 A;  5L8N A;  1YIJ E;  4OS8 A;  1MVG A;  4COT A;  1AVG I;  2MO5 A;  5CE4 A;  3U9P C;  5B10 O;  2OFA A;  2ZJP E;  1M90 G;  3FYF A;  1D2U A;  5F6B A;  1VWG B;  4BX6 A;  4MVI A;  2IZC B;  4MVK A;  3VHM A;  3FW5 A;  5JR8 A;  1VWK B;  5D48 A;  2X46 A;  4O4U A;  4O4X A;  1BRQ A;  3CCU E;  3CME E;  3MBT A;  3MX7 A;  4A1Y A;  1RST B;  3UAQ A;  4Y0Q A;  3BX7 A;  1RAV A;  5K06 A;  1GT4 A;  2WQ9 A;  1KFF A;  4U9C A;  5JD2 A;  3RSW A;  1LUQ A;  2Y32 A;  4I3B A;  3RE5 A;  4O4S A;  1LFO A;  5D47 A;  3U0D A;  4BX7 B;  2AF5 A;  5K67 A;  2F09 A;  5B27 A;  5GAE G;  1ZNG A;  2Y3E A;  3IA8 A;  1VQ4 E;  5LJE A;  2Z4H A;  3EBK A;  1VQ6 E;  1BM5 A;  3RDM A;  4KT5 A;  2IFB A;  5D4A A;  1OEE A;  4ES7 A;  2FR3 A;  5GAG G;  2JGS A;  1VWC B;  1VWB B;  1BRP A;  1YIV A;  2OL7 A;  2AH7 X;  5JVH E;  2RTN B;  3D95 A;  4AZR A;  1PBO A;  4U8U M;  1PTS A;  4QZT A;  2LB6 A;  4NV7 A;  1OSP O;  4WFA E;  4AZP A;  3HPE A;  2XKL A;  1S2P A;  1BWY A;  3ELX A;  2K23 A;  2RA6 A;  1SWF A;  3EM0 A;  5LKE A;  4CV7 A;  2RN4 A;  4JO6 A;  1NQM A;  1YWD A;  1OBU A;  2YMS A;  1BEB A;  2A2U A;  3LTW A;  1OBQ A;  2FR2 A;  3I55 E;  4TNN A;  1VPR A;  5IO7 A;  2OF8 A;  2PY1 A;  1W2B E;  3CMP A;  4FQB B;  4I6S A;  1RJL C;  3MVF A;  4GDA A;  1DF3 A;  1SRF A;  2L67 A;  1SWJ A;  2A2G A;  5HBS A;  4WHI A;  1FJ1 E;  1GGL A;  3C76 X;  2A13 A;  4ORU A;  3RE6 A;  1JJ2 E;  3EMM A;  4TKH A;  1NGL A;  3D96 A;  3CC4 E;  3JQO A;  4C5P A;  1VWJ B;  4U8U N;  2FKJ A;  3CCR E;  1SA8 A;  2GC9 A;  3TF6 A;  3RZY A;  4IB6 A;  1BSY A;  1DZK A;  4OS0 A;  3FA6 A;  1MOY A;  1SLG B;  4ZHC A;  5LJK A;  1SWH A;  2RTK A;  4INN A;  4Z28 A;  2KTD A;  4AZN A;  2Q2P A;  2IZF B;  1SWN A;  2JW1 A;  5L8O A;  4QQ1 A;  1JZU A;  4XMC A;  3SLJ A;  3APV A;  1VWF B;  5L3Y A;  3HTY A;  2BSZ A;  2EU7 X;  1IIU A;  1EIO A;  1EUO A;  1ERB A;  4YCE A;  4MIR A;  3S5V A;  2RTA A;  4ALO A;  4ODD A;  3ZI8 A;  2JMB A;  4L1N A;  4ZHH A;  3BDR A;  1RBP A;  1ALB A;  4BCS A;  1QVF E;  1NP1 A;  1SXX A;  4IMO A;  2WPU A;  2AMM X;  3SZH A;  3FEP A;  4WBK A;  1RL6 A; 
#chains in the Genus database with same CATH homology
 1P4P A;  2OY5 O;  5B10 O;  3CKG A;  2OL6 O;  2OL7 A;  3EC5 A;  2FKG A;  2I5Z O;  3IG9 A;  2OL8 O;  2HKD A;  5B2A O;  2OY7 A;  1RJL C;  3CKF A;  5B11 O;  2I5V O;  5B3M O;  2FKJ A;  2G8C O;  1OSP O;  3AUM O;  2OY1 O;  1FJ1 E;  2PI3 O;  2OY8 A;  2AF5 A;  3IGE A;  2OYB O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...