2AF7A

Crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
119
structure length
119
Chain Sequence
b'MERYRRGMEILNRMNRKSYTAIRDELEDVAPDLARFVAEFAYGDVYSRGVLDLKTRELLTLAALTVLRADDQLKSHVRGALNAGCSKDEIIEVMIQMAVYAGFPAAINAVLAAKEVFTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords gamma-carboxymuconolactone decarboxylase
publication title Crystal structure of the gamma-carboxymuconolactone decarboxylase from Methanobacterium thermoautotrophicum.
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 37
structure length 119
sequence length 119
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 4.1.1.44: 4-carboxymuconolactone decarboxylase.
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02627 CMD Carboxymuconolactone decarboxylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1290.10 Mainly Alpha Up-down Bundle AhpD-like AhpD-like 2af7A00
2GMYA 2IJCA 1ME5A 3C1LA 1P8CA 2PRRA 2QEUA 3BEYA 5DIKA 2Q0TA 3D7IA 2PFXA 5DIPA 1VKEA 1LW1A 1KNCA 4G9QA 3LVYA 2CWQA 1GU9A 2AF7A 2OYOA 2O4DA 2OUWA
chains in the Genus database with same CATH superfamily
2GMYA 2IJCA 1ME5A 3C1LA 1P8CA 3AA6A 2ES9A 2PRRA 1IZNA 2QEUA 3BEYA 5DIKA 4AKRA 5ADXK 2Q0TA 3D7IA 2PFXA 2KZ7A 3LK41 5DIPA 1VKEA 1LW1A 1KNCA 4G9QA 3LVYA 2CWQA 2JN8A 3AA7A 1GU9A 2AF7A 2OYOA 3LK3A 3AAEA 5AFUK 3AAAA 2O4DA 3LK2A 2KXPA 2OUWA 3AA1A 3AA0A
chains in the Genus database with same CATH topology
2GMYA 2IJCA 1ME5A 3C1LA 1P8CA 3AA6A 2ES9A 2PRRA 1IZNA 2QEUA 3BEYA 5DIKA 4AKRA 5ADXK 2Q0TA 3D7IA 2PFXA 2KZ7A 3LK41 5DIPA 1VKEA 1LW1A 1KNCA 4G9QA 3LVYA 2CWQA 2JN8A 3AA7A 1GU9A 2AF7A 2OYOA 3LK3A 3AAEA 5AFUK 3AAAA 2O4DA 3LK2A 2KXPA 2OUWA 3AA1A 3AA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GMY A;  2IJC A;  1ME5 A;  3C1L A;  1P8C A;  2PRR A;  2QEU A;  3BEY A;  5DIK A;  2Q0T A;  3D7I A;  2PFX A;  5DIP A;  1VKE A;  1LW1 A;  1KNC A;  4G9Q A;  3LVY A;  2CWQ A;  1GU9 A;  2AF7 A;  2OYO A;  2O4D A;  2OUW A; 
#chains in the Genus database with same CATH topology
 2GMY A;  2IJC A;  1ME5 A;  3C1L A;  1P8C A;  3AA6 A;  2ES9 A;  2PRR A;  1IZN A;  2QEU A;  3BEY A;  5DIK A;  4AKR A;  5ADX K;  2Q0T A;  3D7I A;  2PFX A;  2KZ7 A;  3LK4 1;  5DIP A;  1VKE A;  1LW1 A;  1KNC A;  4G9Q A;  3LVY A;  2CWQ A;  2JN8 A;  3AA7 A;  1GU9 A;  2AF7 A;  2OYO A;  3LK3 A;  3AAE A;  5AFU K;  3AAA A;  2O4D A;  3LK2 A;  2KXP A;  2OUW A;  3AA1 A;  3AA0 A; 
#chains in the Genus database with same CATH homology
 2GMY A;  2IJC A;  1ME5 A;  3C1L A;  1P8C A;  3AA6 A;  2ES9 A;  2PRR A;  1IZN A;  2QEU A;  3BEY A;  5DIK A;  4AKR A;  5ADX K;  2Q0T A;  3D7I A;  2PFX A;  2KZ7 A;  3LK4 1;  5DIP A;  1VKE A;  1LW1 A;  1KNC A;  4G9Q A;  3LVY A;  2CWQ A;  2JN8 A;  3AA7 A;  1GU9 A;  2AF7 A;  2OYO A;  3LK3 A;  3AAE A;  5AFU K;  3AAA A;  2O4D A;  3LK2 A;  2KXP A;  2OUW A;  3AA1 A;  3AA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...