2AFMA

Crystal structure of human glutaminyl cyclase at ph 6.5
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
329
structure length
323
Chain Sequence
b'ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title Crystal structures of human glutaminyl cyclase, an enzyme responsible for protein N-terminal pyroglutamate formation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 110
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2afmA00
1CX8A 2F8HA 2PJ1A 1HDQA 3FJUA 4UIAA 1TKFA 2CF4A 5LYFA 4DYOA 3B3SA 2PJ6A 3PB6X 2PCUA 4P4BA 4YU9A 2O53A 1FT7A 1NSAA 4PXBA 4O23A 2ZOFA 1XBUA 2PVVA 2QYVA 4NGNA 1EE3P 1F57A 2EK8A 1RTQA 2V8HA 2NSMA 2PJ7A 2QJ8A 5D8NA 1UWYA 3D67A 1VGYA 4MXUA 5K8NA 2HC9A 2PJBA 1AMPA 1CPXA 4MCPA 4OC2A 3N5FA 4ONWA 1Y0RA 2Q4ZA 2V8DA 2NYQA 4OC0A 3JRUA 3PB7X 1TKHA 4NJQA 4P4FA 2OOTA 4RUHA 3FF3A 2AFSA 5JH9A 4NGRA 1JQGA 4JZ0A 2WYRA 4OIWA 1FNOA 1LAMA 2F7VA 4EMEA 4F9VA 4FBEA 7CPAA 4IK2A 2ABZA 3D7DA 1BPMA 1ZG7A 3SI0A 4A38A 4EWTA 4TWEA 1ZLHA 3CPAA 4NGQA 2XEIA 4OIDA 3FMCA 3S9MA 3WC6A 4P10A 1PYTB 3K9TA 4OP4A 5HVFA 3FH4A 2BCOA 3FEDA 5HVHA 2AFXA 2V8VA 1TKJA 4LQGA 4IHMA 2FVGA 2CTCA 1VHOA 3KR4A 4A94A 3IWWA 3PFEA 1LCPA 3WC7A 3H8EA 2AFOA 3KR5A 4MCSA 1TXRA 4A37A 3LWUA 3PBEA 1XMBA 4TNUA 1BAVA 2ZEOA 3SJXA 5I4MA 3MRUA 3SJGA 3HLPA 3KZWA 3KGQA 1ELLP 1M4LA 4DUKA 5LRJA 4X2TA 8CPAA 2PIZA 4DJLA 2PVWA 3SI2A 4FAIA 4P4EA 4F8ZA 3PB8X 3H8FA 2PJCA 3BI0A 2AFWA 3D7HA 3SI1A 5K8MA 2RFHA 3KASA 2PJ0A 4OC4A 2Q43A 1PCAA 1CG2A 4P4DA 4WWVA 1OBRA 3TX8A 2C6CA 2J9AA 2GLFA 4X3RA 4FUUA 2EK9A 3D7FA 5HVGA 1IY7A 1ARLA 3L2NA 4MRIA 2CIJA 1DE4C 2AFMA 1LANA 4MHPA 1ZG8A 2CTBA 2XEJA 2ZEGA 3FVLA 5J1QA 4K3NA 4R8FA 3PRTA 3CPXA 5THWA 3V38A 4NGMA 1ZG9A 1Q7LA 2DEAA 3GUXA 1R3NA 2JEWA 1CBXA 3KQXA 5CPAA 2ZEMA 4OMEA 3IEHA 1YSJA 2POKA 5D29A 5LYLA 6CPAA 2V8GA 1YLOA 1R43A 4P44A 4PPZA 4H2KA 4R6TA 4UEEA 2ZOGA 2GREA 4IAVA 4MCQA 4UIBA 2VL1A 1HEEA 3H8GA 1VHEA 3MN8A 5DS0A 4FWUA 3LMSA 4Z65A 4GM5A 1LAPA 1AYEA 4NGTA 4W9YA 4NGPA 4ZY0A 3IIBA 2IJZA 3PBBA 2IQ6A 4X8IA 2AFZA 4MCRA 4KSIA 3KHZA 1GYTA 4NFRA 4ZX8A 2Q51A 2EWBA 3B3VA 3NH4A 2ZEPA 4WJBA 2WZNA 3HUVA 5HXDA 2C6PA 1YMEA 5ELYA 2PJ5A 2V77A 1YW6A 3CDXA 1H8LA 3ISXA 1Y0YA 2ANPA 4OC5A 3B3CA 1ZLIA 4ZX9A 4A39A 3B2YA 3D68A 1ELMP 2PE3A 3RBUA 2XEGA 3B3WA 3K2KA 4OC1A 3RZAA 4PQAA 2O4HA 3I1UA 3S9NA 1XRYA 4MMOA 5LYDA 2PJ8A 2HB6A 3CT9A 4P4IA 3D4UA 4JYWA 1XFOA 3V7ZA 4NGSA 3IFEA 3QNVA 1DTDA 3NFZA 2G9DA 2BO9A 2C6GA 3PB9X 3GLJA 1Y7EA 2QVPA 4EFDA 2PIYA 2PJAA 1F2OA 4CPAA 1IGBA 2ZEEA 3BHXA 5K8OA 2GU2A 4B6ZA 3ISZA 3S9LA 3WC5A 2ZEFA 2PJ2A 1XJOA 4G1PA 4UEZA 4F9UA 2AFUA 4P45A 5LRKA 2OR4A 4ZYQA 3KQZA 1CP7A 2PJ9A 5LYIA 1F2PA 3KL9A 2RB7A 4PXDA 2XEFA 4MHYA 4BD9A 2JBJA 1Z5RA 1ARMA 5CBMA 5LRGA 3GB0A 2ZEDA 3SJEA 4OC3A 1BLLE 3VH9A 3B35A 4NJRA 3WT4A 2PJ3A 3NH8A 3KI9A 1Z2LA 3NA6A 4OKOA 1CP6A 3FEEA 3PEIA 1QMUA 2C1CA 3IC1A 3VARA 4UF4A 3WABA 3DLJA 1Z8LA 4ZY1A 5JM6A 4R7MA 4AXVA 4UEFA 4Q7AA 3T8WA 3B7IA 4P6YA 1QQ9A 2PRQA 5JGFA 2PJ4A 4MHZA 4R76A 4PXCA 3IO1A 3PFOA 5K8PA 1VIXA 5F09A 5IB9A 3BI1A 2I3CA 4YWYA 2ZENA 1LFWA 4ZI6A 4MHNA 1CPSA 3D7GA 3SJFA 3KHXA 3PB4X 4PXEA 3B3TA 3TC8A 3VATA 1KWMA 1TF9A 4P4JA 1LOKA 3DGVA 3BXMA 1YW4A 1TF8A 1HDUA 3RAMA 2ZELA 2BOAA 2ZEHA 2JBKA 2GLJA 3D66A 4ZY2A 3NH5A 3FECA 3IJ3A 3FX6A 1BPNA 2IMOA
chains in the Genus database with same CATH superfamily
2ATRA 1CX8A 1XOVA 1M1DA 2B58A 2F8HA 4MY3A 2PJ1A 3IU1A 1HDQA 3FJUA 4UIAA 1TKFA 2CF4A 5LYFA 1IOIA 3IWEA 3LACA 3B3SA 4RS2A 2PJ6A 3PB6X 4DYOA 2PCUA 4P4BA 1X10A 4YU9A 2O53A 1FT7A 1KUVA 5J8CA 1NSAA 4PXBA 4R57A 4B5PB 5HH1A 5A27A 5DWNA 4O23A 2ZOFA 3TOAA 1XBUA 2PVVA 2QYVA 4KZTA 4NGNA 4KOUA 1EE3P 1F57A 1M4GA 2EK8A 3JVNA 1RTQA 4KOYA 5GCNA 2Y0MA 4CAEA 2V8HA 3H5ZA 2NSMA 3SXOA 1I12A 2PJ7A 4XPDB 3B8GA 1BO4A 4HPSA 2QJ8A 4HNXB 5D8NA 2DPSA 4MY0A 3FYNA 1YK3A 1UWYA 3E0KA 3D67A 4MJ8A 1VGYA 4MXUA 3EY5A 5K8NA 4XPDC 3JTKA 2HC9A 3R1KA 4CYNA 5I4MA 2PJBA 2PSWA 1AMPA 1JWQA 2OZUA 5F49A 1S5KA 1CPXA 3C26A 4MCPA 4OC2A 4UFWA 3N5FA 4ONWA 1Z8XA 3DSBA 1Y0RA 4F6AA 1LRZA 2Q4ZA 2V8DA 2NYQA 4M6GA 4OC0A 3F5BA 3JRUA 3PB7X 1IYLA 1TKHA 4NJQA 4P4FA 2OOTA 4RUHA 4R3KA 4RI1A 4C2ZA 3FF3A 2AFSA 5JH9A 2I00A 4I49A 4NGRA 2WPXA 1P4NA 4K30A 1JQGA 4JZ0A 4II9A 4MFLA 4HKFA 4XPLA 2CNMA 2WYRA 2QIRA 3TO7A 4OIWA 4NEXA 1FNOA 1LAMA 2F7VA 4CGLA 4EMEA 4F9VA 4FBEA 4UWIA 2ZW4A 4IK2A 2ABZA 4J3GA 7CPAA 1GHEA 1BPMA 1ZG7A 2R7HA 2WSAA 3D7DA 2QMLA 3SI0A 4A38A 4EWTA 4Q36A 1QSTA 4TWEA 1ZLHA 4CAXA 1P0HA 4Q38A 4B5OA 3CPAA 4NGQA 2Q7BA 2XEIA 4JD6A 4KUBA 1A2ZA 4OIDA 2P6EA 3FMCA 3S9MA 3WC6A 1IYKA 4P10A 1MJ9A 4E2AA 3TFYA 1PYTB 2WPWA 3K9TA 4OP4A 5HVFA 5I0CA 3FH4A 1S7KA 1Z8TA 4LUAA 4E8OA 1XMTA 2BCOA 4CRZB 3FEDA 5HVHA 2AFXA 4M6IA 4RN7A 2V8VA 1TKJA 3TTHA 4LQGA 4IHMA 2FVGA 2CTCA 1VHOA 2ZW7A 3KR4A 4IF5A 3IWWA 3PFEA 1LCPA 2HV2A 4IUSA 2VQYA 5H84A 1CM0A 3WC7A 1IU8A 2AFOA 3H8EA 3KR5A 1TXRA 1I21A 4MCSA 4HNWB 2YNDA 4A37A 3LWUA 3PBEA 1XMBA 2Z3PA 4FD6A 3D3SA 5F46A 3F8KA 4TNUA 1BAVA 1KZFA 2B3UA 2ZEOA 4OLLA 2AJ6A 1XEBA 2R1IA 3MRUA 4XPKA 3SJXA 3WR7A 1QSOA 3SJGA 2FT0A 3HLPA 4UFXA 4YGOA 3KZWA 1ELLP 2FIWA 3KGQA 3EFAA 1KUXA 1M4LA 1B87A 1AUGA 1OZPA 4DUKA 2R98A 4CS0B 5LRJA 4X2TA 8CPAA 2PIZA 4B5PA 4CAVA 2ZW5A 4DJLA 2PVWA 3SI2A 2P6FA 4P4EA 4FAIA 4CYQA 1Y9KA 3K9UA 4PK3A 4F8ZA 5EC4A 2FXFA 2Z10A 3V8IA 2A4NA 2Q7SA 4B14A 3PB8X 3GYAA 2Z3NA 4UBRA 3H8FA 2PJCA 2YGWA 2FL4A 2ZW6A 4FD4A 3BI0A 3TO6A 5E96A 2FS5A 4M3SA 2AFWA 1QSRA 3DDDA 1RO5A 3D7HA 3SI1A 5K8MA 2RFHA 3KASA 2PJ0A 3FBUA 4OC4A 2Q43A 3GKRA 1PCAA 3QAHA 1U6MA 1CG2A 4P4DA 1S60A 1N71A 1OBRA 2J8NA 4WWVA 3TX8A 2C6CA 2J9AA 2GLFA 4X3RA 4FUUA 2EK9A 3D7FA 4YRHA 5A28A 5HVGA 2Z3MA 1IY7A 1ARLA 3L2NA 4MRIA 4KVXA 2CIJA 1Q2CA 1DE4C 1L0CA 2AFMA 1LANA 4MHPA 2Z3KA 4MFPA 1ZG8A 4CGOA 1S7FA 2CTBA 2VEZA 2XEJA 3R9FA 2ZEGA 3FVLA 3GIUA 4C68A 5J1QA 4K3NA 3JUWA 4R8FA 4C2YA 3PRTA 2CY2A 4A32A 3CPXA 1R57A 5AG7A 5THWA 3V38A 4NGMA 1ZG9A 4M6HA 1Q7LA 3IU2A 5IX3A 3BJ7A 2DEAA 2GANA 4DNCA 4AVCA 4UFVA 3GUXA 1R3NA 2JEWA 3CXQA 3F0AA 1CBXA 5KTDA 3KQXA 2YNCC 3MGDA 4CYOA 3VWEA 1IIDA 2D4OA 1Y9WA 1ON0A 2FSRA 5CPAA 2ZEMA 4LQ6A 4UA3A 4OMEA 2PRBA 3LODA 3IEHA 1YSJA 2POKA 5D29A 1IB1E 5LYLA 6CPAA 2V8GA 1YLOA 1R43A 4P44A 4MI4A 1WWZA 4H89A 4PPZA 5J8FA 5EMIA 5BWAB 4H2KA 1PUAA 3P2HA 4QC6A 4R6TA 4E0AA 4UEEA 4B10A 2ZOGA 2GFQA 2GREA 3DR8A 4IAVA 4MCQA 4UIBA 2VL1A 2RC4A 1HEEA 3H8GA 3FNCA 1VHEA 2Q44A 2ODFA 3MN8A 5DS0A 4FWUA 3LMSA 1IOFA 3R9GA 2P6GA 3CXPA 4Z65A 3OWCA 2B5GB 2G0BA 4R3LA 3VWDA 4GM5A 1LAPA 3SXNA 4QUSA 5G20A 1AYEA 2PR8A 4BINA 1Z4RA 4CGNA 4GS4A 4NGTA 2CNTA 4W9YA 4A30A 2BUEA 1WK4A 4H6UA 3KKWA 4NGPA 4ZY0A 3IIBA 1XF8A 2IJZA 3UY5A 2VBQA 3PBBA 4AVBA 3RO0A 3RNZA 2IQ6A 4X8IA 1S7NA 2AFZA 4MCRA 4B11A 4KSIA 4B12A 1QSNA 2P0WA 3KHZA 3PZJA 1YVOA 2CNSA 4CRYB 1YREA 3EO4A 4AVAA 1GYTA 4NFRA 4YFJA 3W6SA 4ZX8A 1YQEA 3FIXA 2Q51A 3G3SA 2EWBA 4ONUA 3TO9A 3B3VA 4JLYA 3I9SA 3DNSA 2ARHA 3NH4A 5FVJA 4H6ZA 4KS9A 2ZEPA 4WJBA 3TOBA 2WZNA 3TT2A 4CYPA 3HUVA 2NMTA 3PGPA 5HXDA 2C6PA 1YMEA 5ELYA 2PJ5A 2V77A 2FIAA 1YW6A 3CDXA 4EVYA 1H8LA 1YR0A 1KUYA 3ISXA 1Y0YA 2ANPA 2QECA 2B4DB 3QAYA 4OC5A 5HMNA 4MFJA 3B3CA 2Q4VA 4U9ZA 1ZLIA 2Q04A 4ZX9A 1NSLA 4AG9A 2OZHA 4A39A 3B2YA 2VI7A 3D68A 1ELMP 4A95A 2VXKA 2PE3A 2DPTA 3P2FA 5F48A 3RBUA 2X7BA 2XEGA 3B3WA 4Y49B 3K2KA 4OC1A 2OZGA 3RZAA 2FCKA 3ZJ0A 4PQAA 3DR6A 2PC1A 1MK4A 2O4HA 3I1UA 3S9NA 1XRYA 4MMOA 5EBVA 5AG6A 5LYDA 1I1DA 2HB6A 2PJ8A 4F0XA 4Y49C 4JJXA 2REEA 3CT9A 4P4IA 1VHSA 3D4UA 4JYWA 3S6KA 4CAFA 2BEIA 4CGPA 1XFOA 2EBJA 5JQ4A 1S3ZA 4NGSA 3V7ZA 4R9MA 3IFEA 3QNVA 5IV0A 4MHDA 1DTDA 5CNPA 2KCWA 4UCMA 4KVME 3NFZA 3A9LA 4MFZA 2G9DA 2BO9A 2C6GA 1V0CA 3PB9X 2DXQA 2WUUA 2EUIA 1NE9A 3GLJA 1Y7EA 4KOXA 2QVPA 4UWJA 2VZZA 5F47A 3H4QA 2Z11A 4EFDA 2EO8A 4U9YA 2R8VA 2PIYA 4JWPA 4PSWA 2PJAA 2B5GA 3TE4A 1F2OA 4CPAA 4KLWA 4CAWA 3FB3A 1TIQA 4X5KA 1Z9UA 2D4PA 1IGBA 2ZEEA 3BHXA 5K8OA 4UCNA 2GU2A 4B6ZA 5AGEA 3ISZA 1MJAA 3S9LA 1FY7A 4NSQA 3WC5A 2ZEFA 2PJ2A 1XJOA 4G1PA 4NXYA 2GE3A 1YX0A 2OU2A 4UEZA 4A94A 4F9UA 5ISVA 3EC4A 1IICA 4LX9A 2AFUA 3S6FA 1YVKA 4P45A 3T9YA 1MJBA 5LRKA 4CGMA 2OR4A 4ZYQA 3KQZA 1CP7A 1XE4A 2PJ9A 5LYIA 1M4DA 2B3VA 4NCZA 1UFHA 2Z0ZA 3D8PA 4OAEA 2B4BA 3NE8A 4BBHA 1B6BA 2I79A 1F2PA 3KL9A 2RB7A 2Z3LA 4PXDA 2AE6A 2XEFA 2YNEA 4MHYA 2Z3OA 4KSFA 4KOWA 4XNHB 4BD9A 4C2XA 2JBJA 1Z5RA 3IWGA 1ARMA 4AG7A 4MBUA 4QBJA 5CBMA 2BSWA 5LRGA 3I3GA 3GB0A 3D2PA 2B4DA 3D2MA 5KTCA 2ZEDA 4XNHC 3SJEA 4OC3A 3FXTA 3N7ZA 4A2ZA 1BLLE 2Q0YA 2F5IA 3B35A 4MFQA 3VH9A 4UCPA 4NJRA 3WT4A 2JDCA 2PJ3A 3SHPA 3NH8A 4L89A 4KLVA 3TCVA 2H5MA 3KI9A 1Q2DA 4FD7A 1Z2LA 3NA6A 4OKOA 1M44A 1CP6A 5KTAA 3FEEA 4MFKA 3CXSA 3PEIA 1ZO0A 4KUAA 4B13A 1QMUA 2C1CA 3IC1A 4GXHA 4KOVA 3CZXA 3VARA 1YLEA 4UF4A 4R87A 3DLJA 3WABA 1Z8LA 4OADA 5IB0A 4ZY1A 4KORA 5JM6A 4R7MA 4U5YA 2PR1A 4UEFA 4AXVA 1Z8WA 3BLNA 3B7IA 4Q7AA 3T8WA 4KOTA 4KSAA 4P6YA 4KOSA 1QQ9A 2PRQA 5JGFA 2G3TA 5DWMA 3RYOA 2PJ4A 4MHZA 2J8RA 1YGHA 5C88A 3EXNA 4R76A 4PXCA 3ZZIA 3IO1A 3S6GA 4ZGYB 3PFOA 5K8PA 1XIXA 2JLMA 1VIXA 2BL1A 5F09A 5IB9A 2PQ8A 5JPHA 4JXRA 3BI1A 2I3CA 4A31A 2K5TA 3FRMA 5G1ZA 3S6HA 3BJ8A 4KVOE 2OH1A 4C7IA 1Y7RA 2DF5A 5G21A 2REFA 3T90A 3R9EA 4YWYA 1S7LA 2ZENA 4ORFA 4PV6A 1J4JA 3LD2A 1LFWA 1K4JA 2CXAA 4QVTA 4ZI6A 2OB0A 4A33A 4MHNA 3NE7A 2YNCA 1CPSA 2J8MA 3D7GA 2HQYA 3PP9A 3SJFA 1SQHA 4PSXA 1M4IA 3KHXA 3PB4X 2EVNA 4PXEA 4BMHA 3B3TA 2HUZA 3TC8A 1KWMA 3VATA 4AB7A 1TF9A 1X12A 2FE7A 2G3AA 4P4JA 1LOKA 3DGVA 3G8WA 3BXMA 4HNYB 1YW4A 1TF8A 2JEVA 2O28A 4NF1A 4QB9A 1HDUA 2VZYA 4JXQA 3RAMA 1QSMA 2ZELA 2JDDA 2ZXVA 3W91A 1PU9A 3IGRA 3R95A 3R96A 2BOAA 1VKCA 2IL4A 2ZEHA 3QB8A 2JBKA 5AG5A 5G22A 1Q2YA 2GLJA 4F0YA 4ZBGA 5C82A 3D66A 4ZY2A 4FD5A 3NH5A 3W6XA 2GIVA 4C7HA 1Z4EA 3FECA 3IJ3A 2PDOA 4M85A 5AG4A 3FX6A 5H86A 1BPNA 1CJWA 3GY9A 1BOBA 2IMOA 2Q4YA 4L8AA 2ZPAA 4PK2A 1NMTA 1RXTA 2C27A
chains in the Genus database with same CATH topology
1CX8A 2F8HA 2PJ1A 1HDQA 3FJUA 4UIAA 1TKFA 2CF4A 5LYFA 4DYOA 3B3SA 2PJ6A 3PB6X 2PCUA 4P4BA 4YU9A 2O53A 1FT7A 1NSAA 4PXBA 4O23A 2ZOFA 1XBUA 2PVVA 2QYVA 4NGNA 1EE3P 1F57A 2EK8A 1RTQA 2V8HA 2NSMA 2PJ7A 2QJ8A 5D8NA 1UWYA 3D67A 1VGYA 4MXUA 5K8NA 2HC9A 2PJBA 1AMPA 1CPXA 4MCPA 4OC2A 3N5FA 4ONWA 1Y0RA 2Q4ZA 2V8DA 2NYQA 4OC0A 3JRUA 3PB7X 1TKHA 4NJQA 4P4FA 2OOTA 4RUHA 3FF3A 2AFSA 5JH9A 4NGRA 1JQGA 4JZ0A 2WYRA 4OIWA 1FNOA 1LAMA 2F7VA 4EMEA 4F9VA 4FBEA 7CPAA 4IK2A 2ABZA 3D7DA 1BPMA 1ZG7A 3SI0A 4A38A 4EWTA 4TWEA 1ZLHA 3CPAA 4NGQA 2XEIA 4OIDA 3FMCA 3S9MA 3WC6A 4P10A 1PYTB 3K9TA 4OP4A 5HVFA 3FH4A 2BCOA 3FEDA 5HVHA 2AFXA 2V8VA 1TKJA 4LQGA 4IHMA 2FVGA 2CTCA 1VHOA 3KR4A 4A94A 3IWWA 3PFEA 1LCPA 3WC7A 3H8EA 2AFOA 3KR5A 4MCSA 1TXRA 4A37A 3LWUA 3PBEA 1XMBA 4TNUA 1BAVA 2ZEOA 3SJXA 5I4MA 3MRUA 3SJGA 3HLPA 3KZWA 3KGQA 1ELLP 1M4LA 4DUKA 5LRJA 4X2TA 8CPAA 2PIZA 4DJLA 2PVWA 3SI2A 4FAIA 4P4EA 4F8ZA 3PB8X 3H8FA 2PJCA 3BI0A 2AFWA 3D7HA 3SI1A 5K8MA 2RFHA 3KASA 2PJ0A 4OC4A 2Q43A 1PCAA 1CG2A 4P4DA 4WWVA 1OBRA 3TX8A 2C6CA 2J9AA 2GLFA 4X3RA 4FUUA 2EK9A 3D7FA 5HVGA 1IY7A 1ARLA 3L2NA 4MRIA 2CIJA 1DE4C 2AFMA 1LANA 4MHPA 1ZG8A 2CTBA 2XEJA 2ZEGA 3FVLA 5J1QA 4K3NA 4R8FA 3PRTA 3CPXA 5THWA 3V38A 4NGMA 1ZG9A 1Q7LA 2DEAA 3GUXA 1R3NA 2JEWA 1CBXA 3KQXA 5CPAA 2ZEMA 4OMEA 3IEHA 1YSJA 2POKA 5D29A 5LYLA 6CPAA 2V8GA 1YLOA 1R43A 4P44A 4PPZA 4H2KA 4R6TA 4UEEA 2ZOGA 2GREA 4IAVA 4MCQA 4UIBA 2VL1A 1HEEA 3H8GA 1VHEA 3MN8A 5DS0A 4FWUA 3LMSA 4Z65A 4GM5A 1LAPA 1AYEA 4NGTA 4W9YA 4NGPA 4ZY0A 3IIBA 2IJZA 3PBBA 2IQ6A 4X8IA 2AFZA 4MCRA 4KSIA 3KHZA 1GYTA 4NFRA 4ZX8A 2Q51A 2EWBA 3B3VA 3NH4A 2ZEPA 4WJBA 2WZNA 3HUVA 5HXDA 2C6PA 1YMEA 5ELYA 2PJ5A 2V77A 1YW6A 3CDXA 1H8LA 3ISXA 1Y0YA 2ANPA 4OC5A 3B3CA 1ZLIA 4ZX9A 4A39A 3B2YA 3D68A 1ELMP 2PE3A 3RBUA 2XEGA 3B3WA 3K2KA 4OC1A 3RZAA 4PQAA 2O4HA 3I1UA 3S9NA 1XRYA 4MMOA 5LYDA 2PJ8A 2HB6A 3CT9A 4P4IA 3D4UA 4JYWA 1XFOA 3V7ZA 4NGSA 3IFEA 3QNVA 1DTDA 3NFZA 2G9DA 2BO9A 2C6GA 3PB9X 3GLJA 1Y7EA 2QVPA 4EFDA 2PIYA 2PJAA 1F2OA 4CPAA 1IGBA 2ZEEA 3BHXA 5K8OA 2GU2A 4B6ZA 3ISZA 3S9LA 3WC5A 2ZEFA 2PJ2A 1XJOA 4G1PA 4UEZA 4F9UA 2AFUA 4P45A 5LRKA 2OR4A 4ZYQA 3KQZA 1CP7A 2PJ9A 5LYIA 1F2PA 3KL9A 2RB7A 4PXDA 2XEFA 4MHYA 4BD9A 2JBJA 1Z5RA 1ARMA 5CBMA 5LRGA 3GB0A 2ZEDA 3SJEA 4OC3A 1BLLE 3VH9A 3B35A 4NJRA 3WT4A 2PJ3A 3NH8A 3KI9A 1Z2LA 3NA6A 4OKOA 1CP6A 3FEEA 3PEIA 1QMUA 2C1CA 3IC1A 3VARA 4UF4A 3WABA 3DLJA 1Z8LA 4ZY1A 5JM6A 4R7MA 4AXVA 4UEFA 4Q7AA 3T8WA 3B7IA 4P6YA 1QQ9A 2PRQA 5JGFA 2PJ4A 4MHZA 4R76A 4PXCA 3IO1A 3PFOA 5K8PA 1VIXA 5F09A 5IB9A 3BI1A 2I3CA 4YWYA 2ZENA 1LFWA 4ZI6A 4MHNA 1CPSA 3D7GA 3SJFA 3KHXA 3PB4X 4PXEA 3B3TA 3TC8A 3VATA 1KWMA 1TF9A 4P4JA 1LOKA 3DGVA 3BXMA 1YW4A 1TF8A 1HDUA 3RAMA 2ZELA 2BOAA 2ZEHA 2JBKA 2GLJA 3D66A 4ZY2A 3NH5A 3FECA 3IJ3A 3FX6A 1BPNA 2IMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CX8 A;  2F8H A;  2PJ1 A;  1HDQ A;  3FJU A;  4UIA A;  1TKF A;  2CF4 A;  5LYF A;  4DYO A;  3B3S A;  2PJ6 A;  3PB6 X;  2PCU A;  4P4B A;  4YU9 A;  2O53 A;  1FT7 A;  1NSA A;  4PXB A;  4O23 A;  2ZOF A;  1XBU A;  2PVV A;  2QYV A;  4NGN A;  1EE3 P;  1F57 A;  2EK8 A;  1RTQ A;  2V8H A;  2NSM A;  2PJ7 A;  2QJ8 A;  5D8N A;  1UWY A;  3D67 A;  1VGY A;  4MXU A;  5K8N A;  2HC9 A;  2PJB A;  1AMP A;  1CPX A;  4MCP A;  4OC2 A;  3N5F A;  4ONW A;  1Y0R A;  2Q4Z A;  2V8D A;  2NYQ A;  4OC0 A;  3JRU A;  3PB7 X;  1TKH A;  4NJQ A;  4P4F A;  2OOT A;  4RUH A;  3FF3 A;  2AFS A;  5JH9 A;  4NGR A;  1JQG A;  4JZ0 A;  2WYR A;  4OIW A;  1FNO A;  1LAM A;  2F7V A;  4EME A;  4F9V A;  4FBE A;  7CPA A;  4IK2 A;  2ABZ A;  3D7D A;  1BPM A;  1ZG7 A;  3SI0 A;  4A38 A;  4EWT A;  4TWE A;  1ZLH A;  3CPA A;  4NGQ A;  2XEI A;  4OID A;  3FMC A;  3S9M A;  3WC6 A;  4P10 A;  1PYT B;  3K9T A;  4OP4 A;  5HVF A;  3FH4 A;  2BCO A;  3FED A;  5HVH A;  2AFX A;  2V8V A;  1TKJ A;  4LQG A;  4IHM A;  2FVG A;  2CTC A;  1VHO A;  3KR4 A;  4A94 A;  3IWW A;  3PFE A;  1LCP A;  3WC7 A;  3H8E A;  2AFO A;  3KR5 A;  4MCS A;  1TXR A;  4A37 A;  3LWU A;  3PBE A;  1XMB A;  4TNU A;  1BAV A;  2ZEO A;  3SJX A;  5I4M A;  3MRU A;  3SJG A;  3HLP A;  3KZW A;  3KGQ A;  1ELL P;  1M4L A;  4DUK A;  5LRJ A;  4X2T A;  8CPA A;  2PIZ A;  4DJL A;  2PVW A;  3SI2 A;  4FAI A;  4P4E A;  4F8Z A;  3PB8 X;  3H8F A;  2PJC A;  3BI0 A;  2AFW A;  3D7H A;  3SI1 A;  5K8M A;  2RFH A;  3KAS A;  2PJ0 A;  4OC4 A;  2Q43 A;  1PCA A;  1CG2 A;  4P4D A;  4WWV A;  1OBR A;  3TX8 A;  2C6C A;  2J9A A;  2GLF A;  4X3R A;  4FUU A;  2EK9 A;  3D7F A;  5HVG A;  1IY7 A;  1ARL A;  3L2N A;  4MRI A;  2CIJ A;  1DE4 C;  2AFM A;  1LAN A;  4MHP A;  1ZG8 A;  2CTB A;  2XEJ A;  2ZEG A;  3FVL A;  5J1Q A;  4K3N A;  4R8F A;  3PRT A;  3CPX A;  5THW A;  3V38 A;  4NGM A;  1ZG9 A;  1Q7L A;  2DEA A;  3GUX A;  1R3N A;  2JEW A;  1CBX A;  3KQX A;  5CPA A;  2ZEM A;  4OME A;  3IEH A;  1YSJ A;  2POK A;  5D29 A;  5LYL A;  6CPA A;  2V8G A;  1YLO A;  1R43 A;  4P44 A;  4PPZ A;  4H2K A;  4R6T A;  4UEE A;  2ZOG A;  2GRE A;  4IAV A;  4MCQ A;  4UIB A;  2VL1 A;  1HEE A;  3H8G A;  1VHE A;  3MN8 A;  5DS0 A;  4FWU A;  3LMS A;  4Z65 A;  4GM5 A;  1LAP A;  1AYE A;  4NGT A;  4W9Y A;  4NGP A;  4ZY0 A;  3IIB A;  2IJZ A;  3PBB A;  2IQ6 A;  4X8I A;  2AFZ A;  4MCR A;  4KSI A;  3KHZ A;  1GYT A;  4NFR A;  4ZX8 A;  2Q51 A;  2EWB A;  3B3V A;  3NH4 A;  2ZEP A;  4WJB A;  2WZN A;  3HUV A;  5HXD A;  2C6P A;  1YME A;  5ELY A;  2PJ5 A;  2V77 A;  1YW6 A;  3CDX A;  1H8L A;  3ISX A;  1Y0Y A;  2ANP A;  4OC5 A;  3B3C A;  1ZLI A;  4ZX9 A;  4A39 A;  3B2Y A;  3D68 A;  1ELM P;  2PE3 A;  3RBU A;  2XEG A;  3B3W A;  3K2K A;  4OC1 A;  3RZA A;  4PQA A;  2O4H A;  3I1U A;  3S9N A;  1XRY A;  4MMO A;  5LYD A;  2PJ8 A;  2HB6 A;  3CT9 A;  4P4I A;  3D4U A;  4JYW A;  1XFO A;  3V7Z A;  4NGS A;  3IFE A;  3QNV A;  1DTD A;  3NFZ A;  2G9D A;  2BO9 A;  2C6G A;  3PB9 X;  3GLJ A;  1Y7E A;  2QVP A;  4EFD A;  2PIY A;  2PJA A;  1F2O A;  4CPA A;  1IGB A;  2ZEE A;  3BHX A;  5K8O A;  2GU2 A;  4B6Z A;  3ISZ A;  3S9L A;  3WC5 A;  2ZEF A;  2PJ2 A;  1XJO A;  4G1P A;  4UEZ A;  4F9U A;  2AFU A;  4P45 A;  5LRK A;  2OR4 A;  4ZYQ A;  3KQZ A;  1CP7 A;  2PJ9 A;  5LYI A;  1F2P A;  3KL9 A;  2RB7 A;  4PXD A;  2XEF A;  4MHY A;  4BD9 A;  2JBJ A;  1Z5R A;  1ARM A;  5CBM A;  5LRG A;  3GB0 A;  2ZED A;  3SJE A;  4OC3 A;  1BLL E;  3VH9 A;  3B35 A;  4NJR A;  3WT4 A;  2PJ3 A;  3NH8 A;  3KI9 A;  1Z2L A;  3NA6 A;  4OKO A;  1CP6 A;  3FEE A;  3PEI A;  1QMU A;  2C1C A;  3IC1 A;  3VAR A;  4UF4 A;  3WAB A;  3DLJ A;  1Z8L A;  4ZY1 A;  5JM6 A;  4R7M A;  4AXV A;  4UEF A;  4Q7A A;  3T8W A;  3B7I A;  4P6Y A;  1QQ9 A;  2PRQ A;  5JGF A;  2PJ4 A;  4MHZ A;  4R76 A;  4PXC A;  3IO1 A;  3PFO A;  5K8P A;  1VIX A;  5F09 A;  5IB9 A;  3BI1 A;  2I3C A;  4YWY A;  2ZEN A;  1LFW A;  4ZI6 A;  4MHN A;  1CPS A;  3D7G A;  3SJF A;  3KHX A;  3PB4 X;  4PXE A;  3B3T A;  3TC8 A;  3VAT A;  1KWM A;  1TF9 A;  4P4J A;  1LOK A;  3DGV A;  3BXM A;  1YW4 A;  1TF8 A;  1HDU A;  3RAM A;  2ZEL A;  2BOA A;  2ZEH A;  2JBK A;  2GLJ A;  3D66 A;  4ZY2 A;  3NH5 A;  3FEC A;  3IJ3 A;  3FX6 A;  1BPN A;  2IMO A; 
#chains in the Genus database with same CATH topology
 2ATR A;  1CX8 A;  1XOV A;  1M1D A;  2B58 A;  2F8H A;  4MY3 A;  2PJ1 A;  3IU1 A;  1HDQ A;  3FJU A;  4UIA A;  1TKF A;  2CF4 A;  5LYF A;  1IOI A;  3IWE A;  3LAC A;  3B3S A;  4RS2 A;  2PJ6 A;  3PB6 X;  4DYO A;  2PCU A;  4P4B A;  1X10 A;  4YU9 A;  2O53 A;  1FT7 A;  1KUV A;  5J8C A;  1NSA A;  4PXB A;  4R57 A;  4B5P B;  5HH1 A;  5A27 A;  5DWN A;  4O23 A;  2ZOF A;  3TOA A;  1XBU A;  2PVV A;  2QYV A;  4KZT A;  4NGN A;  4KOU A;  1EE3 P;  1F57 A;  1M4G A;  2EK8 A;  3JVN A;  1RTQ A;  4KOY A;  5GCN A;  2Y0M A;  4CAE A;  2V8H A;  3H5Z A;  2NSM A;  3SXO A;  1I12 A;  2PJ7 A;  4XPD B;  3B8G A;  1BO4 A;  4HPS A;  2QJ8 A;  4HNX B;  5D8N A;  2DPS A;  4MY0 A;  3FYN A;  1YK3 A;  1UWY A;  3E0K A;  3D67 A;  4MJ8 A;  1VGY A;  4MXU A;  3EY5 A;  5K8N A;  4XPD C;  3JTK A;  2HC9 A;  3R1K A;  4CYN A;  5I4M A;  2PJB A;  2PSW A;  1AMP A;  1JWQ A;  2OZU A;  5F49 A;  1S5K A;  1CPX A;  3C26 A;  4MCP A;  4OC2 A;  4UFW A;  3N5F A;  4ONW A;  1Z8X A;  3DSB A;  1Y0R A;  4F6A A;  1LRZ A;  2Q4Z A;  2V8D A;  2NYQ A;  4M6G A;  4OC0 A;  3F5B A;  3JRU A;  3PB7 X;  1IYL A;  1TKH A;  4NJQ A;  4P4F A;  2OOT A;  4RUH A;  4R3K A;  4RI1 A;  4C2Z A;  3FF3 A;  2AFS A;  5JH9 A;  2I00 A;  4I49 A;  4NGR A;  2WPX A;  1P4N A;  4K30 A;  1JQG A;  4JZ0 A;  4II9 A;  4MFL A;  4HKF A;  4XPL A;  2CNM A;  2WYR A;  2QIR A;  3TO7 A;  4OIW A;  4NEX A;  1FNO A;  1LAM A;  2F7V A;  4CGL A;  4EME A;  4F9V A;  4FBE A;  4UWI A;  2ZW4 A;  4IK2 A;  2ABZ A;  4J3G A;  7CPA A;  1GHE A;  1BPM A;  1ZG7 A;  2R7H A;  2WSA A;  3D7D A;  2QML A;  3SI0 A;  4A38 A;  4EWT A;  4Q36 A;  1QST A;  4TWE A;  1ZLH A;  4CAX A;  1P0H A;  4Q38 A;  4B5O A;  3CPA A;  4NGQ A;  2Q7B A;  2XEI A;  4JD6 A;  4KUB A;  1A2Z A;  4OID A;  2P6E A;  3FMC A;  3S9M A;  3WC6 A;  1IYK A;  4P10 A;  1MJ9 A;  4E2A A;  3TFY A;  1PYT B;  2WPW A;  3K9T A;  4OP4 A;  5HVF A;  5I0C A;  3FH4 A;  1S7K A;  1Z8T A;  4LUA A;  4E8O A;  1XMT A;  2BCO A;  4CRZ B;  3FED A;  5HVH A;  2AFX A;  4M6I A;  4RN7 A;  2V8V A;  1TKJ A;  3TTH A;  4LQG A;  4IHM A;  2FVG A;  2CTC A;  1VHO A;  2ZW7 A;  3KR4 A;  4IF5 A;  3IWW A;  3PFE A;  1LCP A;  2HV2 A;  4IUS A;  2VQY A;  5H84 A;  1CM0 A;  3WC7 A;  1IU8 A;  2AFO A;  3H8E A;  3KR5 A;  1TXR A;  1I21 A;  4MCS A;  4HNW B;  2YND A;  4A37 A;  3LWU A;  3PBE A;  1XMB A;  2Z3P A;  4FD6 A;  3D3S A;  5F46 A;  3F8K A;  4TNU A;  1BAV A;  1KZF A;  2B3U A;  2ZEO A;  4OLL A;  2AJ6 A;  1XEB A;  2R1I A;  3MRU A;  4XPK A;  3SJX A;  3WR7 A;  1QSO A;  3SJG A;  2FT0 A;  3HLP A;  4UFX A;  4YGO A;  3KZW A;  1ELL P;  2FIW A;  3KGQ A;  3EFA A;  1KUX A;  1M4L A;  1B87 A;  1AUG A;  1OZP A;  4DUK A;  2R98 A;  4CS0 B;  5LRJ A;  4X2T A;  8CPA A;  2PIZ A;  4B5P A;  4CAV A;  2ZW5 A;  4DJL A;  2PVW A;  3SI2 A;  2P6F A;  4P4E A;  4FAI A;  4CYQ A;  1Y9K A;  3K9U A;  4PK3 A;  4F8Z A;  5EC4 A;  2FXF A;  2Z10 A;  3V8I A;  2A4N A;  2Q7S A;  4B14 A;  3PB8 X;  3GYA A;  2Z3N A;  4UBR A;  3H8F A;  2PJC A;  2YGW A;  2FL4 A;  2ZW6 A;  4FD4 A;  3BI0 A;  3TO6 A;  5E96 A;  2FS5 A;  4M3S A;  2AFW A;  1QSR A;  3DDD A;  1RO5 A;  3D7H A;  3SI1 A;  5K8M A;  2RFH A;  3KAS A;  2PJ0 A;  3FBU A;  4OC4 A;  2Q43 A;  3GKR A;  1PCA A;  3QAH A;  1U6M A;  1CG2 A;  4P4D A;  1S60 A;  1N71 A;  1OBR A;  2J8N A;  4WWV A;  3TX8 A;  2C6C A;  2J9A A;  2GLF A;  4X3R A;  4FUU A;  2EK9 A;  3D7F A;  4YRH A;  5A28 A;  5HVG A;  2Z3M A;  1IY7 A;  1ARL A;  3L2N A;  4MRI A;  4KVX A;  2CIJ A;  1Q2C A;  1DE4 C;  1L0C A;  2AFM A;  1LAN A;  4MHP A;  2Z3K A;  4MFP A;  1ZG8 A;  4CGO A;  1S7F A;  2CTB A;  2VEZ A;  2XEJ A;  3R9F A;  2ZEG A;  3FVL A;  3GIU A;  4C68 A;  5J1Q A;  4K3N A;  3JUW A;  4R8F A;  4C2Y A;  3PRT A;  2CY2 A;  4A32 A;  3CPX A;  1R57 A;  5AG7 A;  5THW A;  3V38 A;  4NGM A;  1ZG9 A;  4M6H A;  1Q7L A;  3IU2 A;  5IX3 A;  3BJ7 A;  2DEA A;  2GAN A;  4DNC A;  4AVC A;  4UFV A;  3GUX A;  1R3N A;  2JEW A;  3CXQ A;  3F0A A;  1CBX A;  5KTD A;  3KQX A;  2YNC C;  3MGD A;  4CYO A;  3VWE A;  1IID A;  2D4O A;  1Y9W A;  1ON0 A;  2FSR A;  5CPA A;  2ZEM A;  4LQ6 A;  4UA3 A;  4OME A;  2PRB A;  3LOD A;  3IEH A;  1YSJ A;  2POK A;  5D29 A;  1IB1 E;  5LYL A;  6CPA A;  2V8G A;  1YLO A;  1R43 A;  4P44 A;  4MI4 A;  1WWZ A;  4H89 A;  4PPZ A;  5J8F A;  5EMI A;  5BWA B;  4H2K A;  1PUA A;  3P2H A;  4QC6 A;  4R6T A;  4E0A A;  4UEE A;  4B10 A;  2ZOG A;  2GFQ A;  2GRE A;  3DR8 A;  4IAV A;  4MCQ A;  4UIB A;  2VL1 A;  2RC4 A;  1HEE A;  3H8G A;  3FNC A;  1VHE A;  2Q44 A;  2ODF A;  3MN8 A;  5DS0 A;  4FWU A;  3LMS A;  1IOF A;  3R9G A;  2P6G A;  3CXP A;  4Z65 A;  3OWC A;  2B5G B;  2G0B A;  4R3L A;  3VWD A;  4GM5 A;  1LAP A;  3SXN A;  4QUS A;  5G20 A;  1AYE A;  2PR8 A;  4BIN A;  1Z4R A;  4CGN A;  4GS4 A;  4NGT A;  2CNT A;  4W9Y A;  4A30 A;  2BUE A;  1WK4 A;  4H6U A;  3KKW A;  4NGP A;  4ZY0 A;  3IIB A;  1XF8 A;  2IJZ A;  3UY5 A;  2VBQ A;  3PBB A;  4AVB A;  3RO0 A;  3RNZ A;  2IQ6 A;  4X8I A;  1S7N A;  2AFZ A;  4MCR A;  4B11 A;  4KSI A;  4B12 A;  1QSN A;  2P0W A;  3KHZ A;  3PZJ A;  1YVO A;  2CNS A;  4CRY B;  1YRE A;  3EO4 A;  4AVA A;  1GYT A;  4NFR A;  4YFJ A;  3W6S A;  4ZX8 A;  1YQE A;  3FIX A;  2Q51 A;  3G3S A;  2EWB A;  4ONU A;  3TO9 A;  3B3V A;  4JLY A;  3I9S A;  3DNS A;  2ARH A;  3NH4 A;  5FVJ A;  4H6Z A;  4KS9 A;  2ZEP A;  4WJB A;  3TOB A;  2WZN A;  3TT2 A;  4CYP A;  3HUV A;  2NMT A;  3PGP A;  5HXD A;  2C6P A;  1YME A;  5ELY A;  2PJ5 A;  2V77 A;  2FIA A;  1YW6 A;  3CDX A;  4EVY A;  1H8L A;  1YR0 A;  1KUY A;  3ISX A;  1Y0Y A;  2ANP A;  2QEC A;  2B4D B;  3QAY A;  4OC5 A;  5HMN A;  4MFJ A;  3B3C A;  2Q4V A;  4U9Z A;  1ZLI A;  2Q04 A;  4ZX9 A;  1NSL A;  4AG9 A;  2OZH A;  4A39 A;  3B2Y A;  2VI7 A;  3D68 A;  1ELM P;  4A95 A;  2VXK A;  2PE3 A;  2DPT A;  3P2F A;  5F48 A;  3RBU A;  2X7B A;  2XEG A;  3B3W A;  4Y49 B;  3K2K A;  4OC1 A;  2OZG A;  3RZA A;  2FCK A;  3ZJ0 A;  4PQA A;  3DR6 A;  2PC1 A;  1MK4 A;  2O4H A;  3I1U A;  3S9N A;  1XRY A;  4MMO A;  5EBV A;  5AG6 A;  5LYD A;  1I1D A;  2HB6 A;  2PJ8 A;  4F0X A;  4Y49 C;  4JJX A;  2REE A;  3CT9 A;  4P4I A;  1VHS A;  3D4U A;  4JYW A;  3S6K A;  4CAF A;  2BEI A;  4CGP A;  1XFO A;  2EBJ A;  5JQ4 A;  1S3Z A;  4NGS A;  3V7Z A;  4R9M A;  3IFE A;  3QNV A;  5IV0 A;  4MHD A;  1DTD A;  5CNP A;  2KCW A;  4UCM A;  4KVM E;  3NFZ A;  3A9L A;  4MFZ A;  2G9D A;  2BO9 A;  2C6G A;  1V0C A;  3PB9 X;  2DXQ A;  2WUU A;  2EUI A;  1NE9 A;  3GLJ A;  1Y7E A;  4KOX A;  2QVP A;  4UWJ A;  2VZZ A;  5F47 A;  3H4Q A;  2Z11 A;  4EFD A;  2EO8 A;  4U9Y A;  2R8V A;  2PIY A;  4JWP A;  4PSW A;  2PJA A;  2B5G A;  3TE4 A;  1F2O A;  4CPA A;  4KLW A;  4CAW A;  3FB3 A;  1TIQ A;  4X5K A;  1Z9U A;  2D4P A;  1IGB A;  2ZEE A;  3BHX A;  5K8O A;  4UCN A;  2GU2 A;  4B6Z A;  5AGE A;  3ISZ A;  1MJA A;  3S9L A;  1FY7 A;  4NSQ A;  3WC5 A;  2ZEF A;  2PJ2 A;  1XJO A;  4G1P A;  4NXY A;  2GE3 A;  1YX0 A;  2OU2 A;  4UEZ A;  4A94 A;  4F9U A;  5ISV A;  3EC4 A;  1IIC A;  4LX9 A;  2AFU A;  3S6F A;  1YVK A;  4P45 A;  3T9Y A;  1MJB A;  5LRK A;  4CGM A;  2OR4 A;  4ZYQ A;  3KQZ A;  1CP7 A;  1XE4 A;  2PJ9 A;  5LYI A;  1M4D A;  2B3V A;  4NCZ A;  1UFH A;  2Z0Z A;  3D8P A;  4OAE A;  2B4B A;  3NE8 A;  4BBH A;  1B6B A;  2I79 A;  1F2P A;  3KL9 A;  2RB7 A;  2Z3L A;  4PXD A;  2AE6 A;  2XEF A;  2YNE A;  4MHY A;  2Z3O A;  4KSF A;  4KOW A;  4XNH B;  4BD9 A;  4C2X A;  2JBJ A;  1Z5R A;  3IWG A;  1ARM A;  4AG7 A;  4MBU A;  4QBJ A;  5CBM A;  2BSW A;  5LRG A;  3I3G A;  3GB0 A;  3D2P A;  2B4D A;  3D2M A;  5KTC A;  2ZED A;  4XNH C;  3SJE A;  4OC3 A;  3FXT A;  3N7Z A;  4A2Z A;  1BLL E;  2Q0Y A;  2F5I A;  3B35 A;  4MFQ A;  3VH9 A;  4UCP A;  4NJR A;  3WT4 A;  2JDC A;  2PJ3 A;  3SHP A;  3NH8 A;  4L89 A;  4KLV A;  3TCV A;  2H5M A;  3KI9 A;  1Q2D A;  4FD7 A;  1Z2L A;  3NA6 A;  4OKO A;  1M44 A;  1CP6 A;  5KTA A;  3FEE A;  4MFK A;  3CXS A;  3PEI A;  1ZO0 A;  4KUA A;  4B13 A;  1QMU A;  2C1C A;  3IC1 A;  4GXH A;  4KOV A;  3CZX A;  3VAR A;  1YLE A;  4UF4 A;  4R87 A;  3DLJ A;  3WAB A;  1Z8L A;  4OAD A;  5IB0 A;  4ZY1 A;  4KOR A;  5JM6 A;  4R7M A;  4U5Y A;  2PR1 A;  4UEF A;  4AXV A;  1Z8W A;  3BLN A;  3B7I A;  4Q7A A;  3T8W A;  4KOT A;  4KSA A;  4P6Y A;  4KOS A;  1QQ9 A;  2PRQ A;  5JGF A;  2G3T A;  5DWM A;  3RYO A;  2PJ4 A;  4MHZ A;  2J8R A;  1YGH A;  5C88 A;  3EXN A;  4R76 A;  4PXC A;  3ZZI A;  3IO1 A;  3S6G A;  4ZGY B;  3PFO A;  5K8P A;  1XIX A;  2JLM A;  1VIX A;  2BL1 A;  5F09 A;  5IB9 A;  2PQ8 A;  5JPH A;  4JXR A;  3BI1 A;  2I3C A;  4A31 A;  2K5T A;  3FRM A;  5G1Z A;  3S6H A;  3BJ8 A;  4KVO E;  2OH1 A;  4C7I A;  1Y7R A;  2DF5 A;  5G21 A;  2REF A;  3T90 A;  3R9E A;  4YWY A;  1S7L A;  2ZEN A;  4ORF A;  4PV6 A;  1J4J A;  3LD2 A;  1LFW A;  1K4J A;  2CXA A;  4QVT A;  4ZI6 A;  2OB0 A;  4A33 A;  4MHN A;  3NE7 A;  2YNC A;  1CPS A;  2J8M A;  3D7G A;  2HQY A;  3PP9 A;  3SJF A;  1SQH A;  4PSX A;  1M4I A;  3KHX A;  3PB4 X;  2EVN A;  4PXE A;  4BMH A;  3B3T A;  2HUZ A;  3TC8 A;  1KWM A;  3VAT A;  4AB7 A;  1TF9 A;  1X12 A;  2FE7 A;  2G3A A;  4P4J A;  1LOK A;  3DGV A;  3G8W A;  3BXM A;  4HNY B;  1YW4 A;  1TF8 A;  2JEV A;  2O28 A;  4NF1 A;  4QB9 A;  1HDU A;  2VZY A;  4JXQ A;  3RAM A;  1QSM A;  2ZEL A;  2JDD A;  2ZXV A;  3W91 A;  1PU9 A;  3IGR A;  3R95 A;  3R96 A;  2BOA A;  1VKC A;  2IL4 A;  2ZEH A;  3QB8 A;  2JBK A;  5AG5 A;  5G22 A;  1Q2Y A;  2GLJ A;  4F0Y A;  4ZBG A;  5C82 A;  3D66 A;  4ZY2 A;  4FD5 A;  3NH5 A;  3W6X A;  2GIV A;  4C7H A;  1Z4E A;  3FEC A;  3IJ3 A;  2PDO A;  4M85 A;  5AG4 A;  3FX6 A;  5H86 A;  1BPN A;  1CJW A;  3GY9 A;  1BOB A;  2IMO A;  2Q4Y A;  4L8A A;  2ZPA A;  4PK2 A;  1NMT A;  1RXT A;  2C27 A; 
#chains in the Genus database with same CATH homology
 1CX8 A;  2F8H A;  2PJ1 A;  1HDQ A;  3FJU A;  4UIA A;  1TKF A;  2CF4 A;  5LYF A;  4DYO A;  3B3S A;  2PJ6 A;  3PB6 X;  2PCU A;  4P4B A;  4YU9 A;  2O53 A;  1FT7 A;  1NSA A;  4PXB A;  4O23 A;  2ZOF A;  1XBU A;  2PVV A;  2QYV A;  4NGN A;  1EE3 P;  1F57 A;  2EK8 A;  1RTQ A;  2V8H A;  2NSM A;  2PJ7 A;  2QJ8 A;  5D8N A;  1UWY A;  3D67 A;  1VGY A;  4MXU A;  5K8N A;  2HC9 A;  2PJB A;  1AMP A;  1CPX A;  4MCP A;  4OC2 A;  3N5F A;  4ONW A;  1Y0R A;  2Q4Z A;  2V8D A;  2NYQ A;  4OC0 A;  3JRU A;  3PB7 X;  1TKH A;  4NJQ A;  4P4F A;  2OOT A;  4RUH A;  3FF3 A;  2AFS A;  5JH9 A;  4NGR A;  1JQG A;  4JZ0 A;  2WYR A;  4OIW A;  1FNO A;  1LAM A;  2F7V A;  4EME A;  4F9V A;  4FBE A;  7CPA A;  4IK2 A;  2ABZ A;  3D7D A;  1BPM A;  1ZG7 A;  3SI0 A;  4A38 A;  4EWT A;  4TWE A;  1ZLH A;  3CPA A;  4NGQ A;  2XEI A;  4OID A;  3FMC A;  3S9M A;  3WC6 A;  4P10 A;  1PYT B;  3K9T A;  4OP4 A;  5HVF A;  3FH4 A;  2BCO A;  3FED A;  5HVH A;  2AFX A;  2V8V A;  1TKJ A;  4LQG A;  4IHM A;  2FVG A;  2CTC A;  1VHO A;  3KR4 A;  4A94 A;  3IWW A;  3PFE A;  1LCP A;  3WC7 A;  3H8E A;  2AFO A;  3KR5 A;  4MCS A;  1TXR A;  4A37 A;  3LWU A;  3PBE A;  1XMB A;  4TNU A;  1BAV A;  2ZEO A;  3SJX A;  5I4M A;  3MRU A;  3SJG A;  3HLP A;  3KZW A;  3KGQ A;  1ELL P;  1M4L A;  4DUK A;  5LRJ A;  4X2T A;  8CPA A;  2PIZ A;  4DJL A;  2PVW A;  3SI2 A;  4FAI A;  4P4E A;  4F8Z A;  3PB8 X;  3H8F A;  2PJC A;  3BI0 A;  2AFW A;  3D7H A;  3SI1 A;  5K8M A;  2RFH A;  3KAS A;  2PJ0 A;  4OC4 A;  2Q43 A;  1PCA A;  1CG2 A;  4P4D A;  4WWV A;  1OBR A;  3TX8 A;  2C6C A;  2J9A A;  2GLF A;  4X3R A;  4FUU A;  2EK9 A;  3D7F A;  5HVG A;  1IY7 A;  1ARL A;  3L2N A;  4MRI A;  2CIJ A;  1DE4 C;  2AFM A;  1LAN A;  4MHP A;  1ZG8 A;  2CTB A;  2XEJ A;  2ZEG A;  3FVL A;  5J1Q A;  4K3N A;  4R8F A;  3PRT A;  3CPX A;  5THW A;  3V38 A;  4NGM A;  1ZG9 A;  1Q7L A;  2DEA A;  3GUX A;  1R3N A;  2JEW A;  1CBX A;  3KQX A;  5CPA A;  2ZEM A;  4OME A;  3IEH A;  1YSJ A;  2POK A;  5D29 A;  5LYL A;  6CPA A;  2V8G A;  1YLO A;  1R43 A;  4P44 A;  4PPZ A;  4H2K A;  4R6T A;  4UEE A;  2ZOG A;  2GRE A;  4IAV A;  4MCQ A;  4UIB A;  2VL1 A;  1HEE A;  3H8G A;  1VHE A;  3MN8 A;  5DS0 A;  4FWU A;  3LMS A;  4Z65 A;  4GM5 A;  1LAP A;  1AYE A;  4NGT A;  4W9Y A;  4NGP A;  4ZY0 A;  3IIB A;  2IJZ A;  3PBB A;  2IQ6 A;  4X8I A;  2AFZ A;  4MCR A;  4KSI A;  3KHZ A;  1GYT A;  4NFR A;  4ZX8 A;  2Q51 A;  2EWB A;  3B3V A;  3NH4 A;  2ZEP A;  4WJB A;  2WZN A;  3HUV A;  5HXD A;  2C6P A;  1YME A;  5ELY A;  2PJ5 A;  2V77 A;  1YW6 A;  3CDX A;  1H8L A;  3ISX A;  1Y0Y A;  2ANP A;  4OC5 A;  3B3C A;  1ZLI A;  4ZX9 A;  4A39 A;  3B2Y A;  3D68 A;  1ELM P;  2PE3 A;  3RBU A;  2XEG A;  3B3W A;  3K2K A;  4OC1 A;  3RZA A;  4PQA A;  2O4H A;  3I1U A;  3S9N A;  1XRY A;  4MMO A;  5LYD A;  2PJ8 A;  2HB6 A;  3CT9 A;  4P4I A;  3D4U A;  4JYW A;  1XFO A;  3V7Z A;  4NGS A;  3IFE A;  3QNV A;  1DTD A;  3NFZ A;  2G9D A;  2BO9 A;  2C6G A;  3PB9 X;  3GLJ A;  1Y7E A;  2QVP A;  4EFD A;  2PIY A;  2PJA A;  1F2O A;  4CPA A;  1IGB A;  2ZEE A;  3BHX A;  5K8O A;  2GU2 A;  4B6Z A;  3ISZ A;  3S9L A;  3WC5 A;  2ZEF A;  2PJ2 A;  1XJO A;  4G1P A;  4UEZ A;  4F9U A;  2AFU A;  4P45 A;  5LRK A;  2OR4 A;  4ZYQ A;  3KQZ A;  1CP7 A;  2PJ9 A;  5LYI A;  1F2P A;  3KL9 A;  2RB7 A;  4PXD A;  2XEF A;  4MHY A;  4BD9 A;  2JBJ A;  1Z5R A;  1ARM A;  5CBM A;  5LRG A;  3GB0 A;  2ZED A;  3SJE A;  4OC3 A;  1BLL E;  3VH9 A;  3B35 A;  4NJR A;  3WT4 A;  2PJ3 A;  3NH8 A;  3KI9 A;  1Z2L A;  3NA6 A;  4OKO A;  1CP6 A;  3FEE A;  3PEI A;  1QMU A;  2C1C A;  3IC1 A;  3VAR A;  4UF4 A;  3WAB A;  3DLJ A;  1Z8L A;  4ZY1 A;  5JM6 A;  4R7M A;  4AXV A;  4UEF A;  4Q7A A;  3T8W A;  3B7I A;  4P6Y A;  1QQ9 A;  2PRQ A;  5JGF A;  2PJ4 A;  4MHZ A;  4R76 A;  4PXC A;  3IO1 A;  3PFO A;  5K8P A;  1VIX A;  5F09 A;  5IB9 A;  3BI1 A;  2I3C A;  4YWY A;  2ZEN A;  1LFW A;  4ZI6 A;  4MHN A;  1CPS A;  3D7G A;  3SJF A;  3KHX A;  3PB4 X;  4PXE A;  3B3T A;  3TC8 A;  3VAT A;  1KWM A;  1TF9 A;  4P4J A;  1LOK A;  3DGV A;  3BXM A;  1YW4 A;  1TF8 A;  1HDU A;  3RAM A;  2ZEL A;  2BOA A;  2ZEH A;  2JBK A;  2GLJ A;  3D66 A;  4ZY2 A;  3NH5 A;  3FEC A;  3IJ3 A;  3FX6 A;  1BPN A;  2IMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...