2AFSA

Crystal structure of the genetic mutant r54w of human glutaminyl cyclase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALWQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title Crystal structures of human glutaminyl cyclase, an enzyme responsible for protein N-terminal pyroglutamate formation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 108
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2afsA00
4OC5A 3BHXA 2PVWA 2VL1A 1KWMA 3SI2A 3PB7X 2AFMA 1RTQA 3N5FA 2O4HA 5LRGA 2PJCA 2CF4A 2AFXA 1R3NA 1CX8A 2PJ7A 3KGQA 5CPAA 3IWWA 1PCAA 2HC9A 2ZOFA 2PJ9A 1BLLE 4B6ZA 1Y0YA 2GLFA 3D7GA 3LMSA 3WABA 2ZENA 2ZEEA 1BPNA 1CPXA 2J9AA 4UIBA 3D7DA 4PXCA 2C6PA 2NSMA 2GLJA 4LQGA 3TC8A 3DLJA 1XJOA 3JRUA 3B35A 5LYFA 4NGPA 5HVHA 4EFDA 4UEFA 3FMCA 2ZEMA 5DS0A 3D67A 4RUHA 2QYVA 4F8ZA 4P4EA 2F8HA 5HVGA 3S9LA 1LCPA 3D68A 8CPAA 4P45A 2PIYA 2V8DA 4OC4A 3QNVA 1Z8LA 4OIDA 3S9NA 4P4DA 3L2NA 4ONWA 3PFOA 4P4FA 2AFZA 3H8GA 3IJ3A 4MMOA 3PB9X 1ELLP 4NFRA 2V8GA 2BOAA 1UWYA 3ISZA 3PRTA 4EWTA 3V38A 1VGYA 2EK8A 3KHZA 1Y0RA 4DJLA 1QMUA 4MRIA 4H2KA 1CBXA 1H8LA 1CP7A 4MHZA 4ZX9A 2PCUA 2ZEFA 5HXDA 1DTDA 2GU2A 5K8NA 3SJFA 4OC1A 2Q43A 1CP6A 1YW4A 4PXDA 2V77A 3FVLA 3RBUA 1HEEA 2F7VA 4OMEA 4IK2A 2QJ8A 4JYWA 2RFHA 3NA6A 3SJEA 2BO9A 4DUKA 4NGRA 3PB6X 4MCPA 5I4MA 4NJRA 3ISXA 5F09A 1BPMA 4OIWA 2V8HA 2PJ3A 3H8EA 1YW6A 2POKA 4OC3A 1F2PA 3K2KA 3BI0A 4MCSA 2IMOA 1R43A 3KI9A 1FNOA 3FX6A 2JEWA 3B7IA 4X3RA 4P4JA 6CPAA 2ZEPA 4ZY1A 2GREA 1VIXA 2PJ5A 2EK9A 2OR4A 2XEJA 4NGMA 2C1CA 2PJ8A 4FWUA 5D29A 2PJ6A 3WC5A 1JQGA 4WWVA 2PE3A 4P10A 4G1PA 4A39A 2XEFA 5D8NA 5JM6A 1ZLHA 4PPZA 2ZEHA 2ZOGA 3TX8A 1AYEA 4P4IA 1LAPA 1VHOA 1TF9A 4IHMA 4TNUA 1XFOA 3IFEA 2I3CA 4MHYA 1Z2LA 1XRYA 3PEIA 3NH4A 1XMBA 2DEAA 4UEZA 3FH4A 2HB6A 3KR4A 4IAVA 1EE3P 4MHNA 3CPAA 5LRJA 3V7ZA 7CPAA 4PQAA 4P44A 1NSAA 3PBEA 2PJAA 3PFEA 3GLJA 3HUVA 4WJBA 4EMEA 1BAVA 1F2OA 2Q4ZA 2G9DA 1ELMP 3VARA 2PJ2A 3KHXA 3KR5A 4KSIA 2XEGA 1VHEA 4AXVA 1YMEA 3D7FA 2AFWA 2AFOA 4NGNA 4OP4A 4DYOA 2BCOA 5LYLA 3BI1A 3SI1A 4Z65A 2ANPA 2ABZA 1YLOA 2Q51A 3FF3A 3FEEA 4OC0A 3D4UA 2ZEDA 4R7MA 2ZEOA 4ZY2A 2NYQA 2PJBA 3VH9A 2FVGA 2IJZA 3BXMA 2PJ4A 3IC1A 4JZ0A 2EWBA 4BD9A 1IGBA 3CDXA 4P4BA 1ARLA 1Q7LA 3SJGA 4W9YA 3PB4X 1PYTB 2ZEGA 2PJ0A 1ZG9A 3IEHA 1GYTA 2PRQA 3K9TA 3PBBA 2RB7A 4NGSA 3KQZA 3KZWA 2PJ1A 1HDQA 2QVPA 5K8MA 3B3WA 1FT7A 4FAIA 2ZELA 1TKHA 5HVFA 4F9UA 2PIZA 5LRKA 2AFUA 2XEIA 1CG2A 1TF8A 1TKFA 3HLPA 3CPXA 4CPAA 1QQ9A 1ZG7A 4FUUA 3WC6A 3SJXA 4O23A 1XBUA 1CPSA 3B3VA 4PXBA 4MXUA 1HDUA 3FJUA 2CTBA 4A94A 2WYRA 2AFSA 3GB0A 4YWYA 4X8IA 3MN8A 5JGFA 1F57A 3WT4A 3B3CA 4PXEA 1ARMA 4R8FA 3RZAA 4OC2A 1ZLIA 4MCRA 4Q7AA 2JBJA 3DGVA 5ELYA 2CTCA 1LANA 4OKOA 3D66A 2CIJA 1ZG8A 3D7HA 4A37A 4P6YA 3VATA 2PVVA 5K8PA 4ZX8A 1TXRA 5THWA 1YSJA 4X2TA 3B2YA 3KASA 4MCQA 3NH5A 4F9VA 5CBMA 4ZI6A 2OOTA 4ZY0A 3LWUA 2WZNA 4TWEA 1DE4C 4YU9A 3I1UA 1LOKA 4NGQA 5JH9A 3RAMA 2IQ6A 1OBRA 1TKJA 3B3SA 1AMPA 5J1QA 2O53A 4K3NA 1IY7A 3SI0A 1LAMA 3KQXA 5LYDA 1Y7EA 4NJQA 3B3TA 3IIBA 4UIAA 5LYIA 3MRUA 2V8VA 3CT9A 4GM5A 4R76A 4A38A 4UEEA 4ZYQA 3NH8A 3GUXA 1LFWA 3FEDA 4FBEA 2C6GA 3WC7A 3T8WA 2C6CA 3H8FA 3S9MA 4UF4A 3PB8X 5IB9A 2JBKA 3NFZA 5K8OA 3IO1A 4NGTA 1M4LA 1Z5RA 4MHPA 3FECA 4R6TA 3KL9A
chains in the Genus database with same CATH superfamily
4CRZB 4UWJA 4YRHA 1SQHA 1I21A 2P6GA 3BHXA 4L8AA 1QSTA 2PVWA 4OC5A 3GYAA 4ZBGA 5H86A 5JPHA 3EO4A 4CAVA 3H5ZA 1QSOA 2O28A 2VL1A 3PZJA 1KWMA 1VKCA 2FE7A 4H6ZA 4M85A 1NSLA 1N71A 5ISVA 3SI2A 3PB7X 2AFMA 2ZW6A 2ZW7A 2ZPAA 1RTQA 4OAEA 1R57A 1IIDA 3N5FA 2J8MA 2O4HA 5LRGA 2JDCA 2PJCA 3TOAA 2CF4A 1IOIA 3T9YA 2AFXA 1R3NA 2WUUA 1CX8A 2PJ7A 2KCWA 4KUAA 3KGQA 3QAHA 1KUVA 5CPAA 3IWWA 3UY5A 1PCAA 2HC9A 1LRZA 4FD6A 2B5GA 2P0WA 2ZOFA 3TO6A 2PJ9A 4MHDA 4UFXA 4U9ZA 1BLLE 2G3TA 4B6ZA 4CYPA 1Y0YA 2GLFA 4KSAA 4UBRA 3D7GA 3C26A 3LMSA 3TO7A 3RNZA 2JEVA 3MGDA 3WABA 1ZO0A 3R96A 2ZENA 2ZEEA 1BPNA 2Z10A 3FNCA 1CPXA 2VXKA 2J9AA 5G1ZA 4UIBA 5A28A 3D7DA 4PXCA 2C6PA 2FS5A 2NMTA 2NSMA 4DNCA 2GLJA 4LQGA 2PSWA 1MJBA 2VZYA 3TC8A 3TO9A 3DLJA 1XJOA 3JRUA 3B35A 5LYFA 3KKWA 4NGPA 5HVHA 4JLYA 4EFDA 4UEFA 3FMCA 2ZEMA 4U5YA 5DS0A 4F0XA 2WPWA 3D67A 4RUHA 2QIRA 2QYVA 1AUGA 4IF5A 5AGEA 4F8ZA 1XE4A 4P4EA 4Q36A 2F8HA 4QBJA 5HVGA 3S9LA 1LCPA 3D68A 3FIXA 2CXAA 8CPAA 4P45A 3RO0A 4R3KA 2PIYA 4XNHC 4MI4A 2V8DA 1RO5A 4OC4A 3QNVA 3H4QA 1Z8LA 4OIDA 5EC4A 3S9NA 4P4DA 4GXHA 3L2NA 4ONWA 3TOBA 3PFOA 1P0HA 2Q4VA 2Z3MA 2AFZA 3H8GA 3IJ3A 4MMOA 3PB9X 4P4FA 1ELLP 2CY2A 5C82A 4NFRA 2V8GA 4HPSA 2BOAA 1UWYA 3I9SA 4F6AA 4MY0A 1V0CA 4E2AA 3ISZA 3PRTA 4B14A 4EWTA 4Y49C 3V38A 5F46A 4MFKA 1VGYA 2EK8A 4QVTA 3KHZA 1Y0RA 1Y7RA 1CJWA 2Q7SA 2EUIA 1QMUA 2F5IA 4MRIA 4JD6A 5EMIA 4DJLA 4H2KA 2B58A 4UFWA 1CBXA 1GHEA 1H8LA 1CP7A 4CGNA 4MHZA 4ZX9A 1M44A 2PCUA 2ZEFA 5HXDA 1XOVA 3W6SA 1DTDA 2B4BA 2GU2A 5K8NA 3SJFA 4OC1A 2Q43A 4A31A 5F49A 1CP6A 1YW4A 4PXDA 2V77A 2ZXVA 3FVLA 3RBUA 3F0AA 1HEEA 2F7VA 4JJXA 3CXSA 3G3SA 2G0BA 4OMEA 4IK2A 4EVYA 2OZHA 3I3GA 2QJ8A 1YR0A 4JYWA 2RFHA 3R95A 4B5OA 1YGHA 3NA6A 3SJEA 2BO9A 4DUKA 4NGRA 3PB6X 4MCPA 2Q04A 4NJRA 5I4MA 1ON0A 5G20A 3B8GA 4B5PB 3ISXA 3D2PA 5F09A 1BPMA 3TE4A 4OIWA 2QECA 2V8HA 3CZXA 4KOVA 4LQ6A 2D4PA 4J3GA 4JXRA 2Z3KA 2R98A 3F8KA 1QSNA 3ZJ0A 2PJ3A 4C2XA 3H8EA 4UCMA 4KOSA 1Z8WA 4K30A 1YW6A 4R9MA 2POKA 5A27A 4OC3A 1YK3A 3TT2A 2YGWA 2DXQA 1F2PA 5AG6A 2OB0A 4U9YA 4XPDB 3QB8A 3K2KA 3BI0A 4MCSA 2IMOA 1NE9A 1R43A 3KI9A 4C2ZA 1FNOA 3SXNA 3FX6A 3VWEA 5H84A 2JEWA 3B7IA 4UCPA 4P4JA 4X3RA 6CPAA 2ZEPA 4ZY1A 2GREA 1IU8A 1QSRA 1VIXA 2P6FA 2PJ5A 2EK9A 2OR4A 2OZGA 2XEJA 3FRMA 4OADA 1M4DA 4NGMA 4UCNA 4B13A 2C1CA 2AJ6A 2PJ8A 4FWUA 1KUYA 1YVOA 2HQYA 1MJ9A 2Q44A 1P4NA 4KSFA 3TCVA 5J8CA 5D29A 4CAEA 2PJ6A 3WC5A 1JQGA 5KTAA 4WWVA 2PE3A 4I49A 3F5BA 3G8WA 4YFJA 4P10A 4G1PA 4A39A 2XEFA 2Q0YA 5D8NA 5JM6A 1IICA 1ZLHA 3IWEA 2FIWA 4PPZA 4KOTA 1Z9UA 1L0CA 2ZEHA 2ZOGA 2FL4A 4LUAA 3TX8A 1AYEA 2Y0MA 4P4IA 4XPKA 5EBVA 4MFQA 2YNCA 1LAPA 1VHOA 4NXYA 1TF9A 4IHMA 4TNUA 4KS9A 1XFOA 3IFEA 4BMHA 2I3CA 4II9A 4MHYA 1Z2LA 1XRYA 1YREA 3PEIA 3NH4A 1XMBA 2DEAA 1JWQA 2WPXA 4UEZA 2RC4A 4B11A 3FH4A 2HB6A 3KR4A 4IAVA 3EC4A 1IOFA 1EE3P 4L89A 2CNSA 3CPAA 4MHNA 3SHPA 4FD7A 1U6MA 1YX0A 4MY3A 4PQAA 4P44A 5LRJA 1NSAA 3PBEA 3V7ZA 7CPAA 1S7KA 2ZW4A 1WWZA 2PJAA 1FY7A 4AVCA 1IYKA 3PFEA 3GLJA 3HUVA 4YGOA 2Z11A 4WJBA 4XNHB 2H5MA 4EMEA 2C27A 1BAVA 1F2OA 3PGPA 4MBUA 4KVME 3FB3A 3SXOA 4M6GA 2ATRA 2Q4ZA 2J8RA 2G9DA 1ELMP 2DPSA 2DPTA 3A9LA 3IGRA 3PP9A 5AG5A 1M4IA 3VARA 2PJ2A 3KHXA 4CGPA 4R57A 4A2ZA 4CGOA 2REFA 4CS0B 2B3UA 1Q2DA 3KR5A 4NF1A 4KSIA 4M6IA 2XEGA 1IYLA 2VZZA 3DSBA 3LODA 5FVJA 4B5PA 1VHEA 4AXVA 1YMEA 2OU2A 4Y49B 2VEZA 2AFWA 3D7FA 2AFOA 4NGNA 4OP4A 4DYOA 2Z3LA 2BCOA 4PK3A 5LYLA 1PU9A 1Z8XA 2CNMA 3BI1A 4QUSA 3TFYA 2G3AA 4IUSA 3S6KA 3SI1A 2VBQA 4QC6A 4Z65A 2JDDA 4MFPA 3P2HA 4R87A 2ANPA 4CYOA 2ABZA 1YLOA 2Z3OA 2Q51A 4HNWB 3FF3A 2BUEA 4KOWA 3FEEA 4C68A 3BJ8A 5BWAB 4M3SA 1M1DA 4OC0A 4RI1A 2FXFA 3D4UA 5IV0A 2ZEDA 1BO4A 4R7MA 2ZEOA 2A4NA 2NYQA 2PJBA 4ZY2A 3K9UA 3VH9A 2FVGA 3GY9A 2IJZA 1S3ZA 3BXMA 4AVBA 4B12A 2PJ4A 1B87A 3IC1A 4KUBA 4JZ0A 2EWBA 3P2FA 4BD9A 1Y9KA 1IGBA 4HKFA 3CDXA 1I1DA 4P4BA 1ARLA 2IL4A 4OLLA 4C2YA 1Q7LA 3SJGA 1YVKA 1KUXA 2R8VA 4W9YA 4AG9A 3PB4X 1CM0A 3FYNA 1PYTB 4KVOE 3BJ7A 2ZEGA 2HV2A 2PJ0A 2B4DB 3E0KA 3GKRA 1I12A 1ZG9A 4HNYB 3IEHA 3IU1A 4CYNA 1GYTA 2PRQA 4RN7A 2ZW5A 3K9TA 3PBBA 2RB7A 4NGSA 2YNDA 3KQZA 3KZWA 4NSQA 3W6XA 2HUZA 4E0AA 4CYQA 2PJ1A 1HDQA 2QVPA 4JWPA 5K8MA 2R7HA 3B3WA 5AG4A 2OZUA 3N7ZA 4PV6A 1FT7A 3QAYA 5KTDA 4FAIA 1QSMA 4NCZA 4KVXA 4UFVA 4MFLA 2ZELA 1TKHA 5HVFA 4F9UA 2DF5A 2PIZA 5LRKA 3JUWA 1K4JA 3S6HA 1XMTA 2AFUA 2XEIA 1CG2A 2PDOA 1TF8A 1TKFA 3OWCA 3HLPA 3R9EA 4CRYB 1Z4EA 3CPXA 4LX9A 1QQ9A 1XF8A 5CNPA 3FBUA 3T90A 4AG7A 2PRBA 4CPAA 3DNSA 1ZG7A 5G21A 4FUUA 4PSXA 3WC6A 3SJXA 4O23A 2GE3A 1XBUA 4KLWA 4JXQA 4MJ8A 1CPSA 4KZTA 5E96A 3B3VA 4PXBA 4BINA 4MXUA 5JQ4A 1HDUA 3FJUA 2P6EA 2CTBA 2FSRA 1B6BA 5HMNA 2BSWA 3BLNA 1Z4RA 4A94A 2OH1A 2WYRA 1BOBA 5DWNA 5KTCA 4XPLA 2FT0A 5F47A 2AFSA 3GB0A 4CAWA 4YWYA 4ZGYB 4X8IA 3MN8A 5JGFA 4M6HA 1X10A 4FD5A 4ONUA 1F57A 2I79A 4X5KA 4CGLA 3WT4A 3B3CA 3D2MA 4PXEA 1ARMA 4R8FA 1S7LA 3RZAA 4CGMA 4OC2A 1ZLIA 4MCRA 1PUAA 4Q7AA 2JBJA 4PSWA 3CXPA 1MJAA 3DGVA 3WR7A 5ELYA 2D4OA 1UFHA 4KLVA 4BBHA 2VQYA 4AVAA 3GIUA 3LD2A 2CTCA 1LANA 2PC1A 4KOYA 4OKOA 3D66A 2CIJA 1ZG8A 1TIQA 1S60A 2I00A 3D7HA 2Z3PA 2EVNA 4MFJA 4A37A 3RYOA 4P6YA 5AG7A 4GS4A 4PK2A 5C88A 1RXTA 2PQ8A 3VATA 2PVVA 2FIAA 4FD4A 4ZX8A 5K8PA 1TXRA 5THWA 2K5TA 5G22A 1YSJA 4X2TA 1Q2YA 2FCKA 3B2YA 2B5GB 3KASA 4MCQA 1YQEA 1S7NA 2CNTA 2PR8A 2YNEA 1NMTA 3NH5A 2JLMA 4F9VA 4CAFA 1A2ZA 5CBMA 1M4GA 4ZI6A 5HH1A 1IB1E 1XEBA 2OOTA 4ZY0A 2EBJA 1MK4A 1Q2CA 3IWGA 2YNCC 5GCNA 3S6FA 4HNXB 4A33A 1YLEA 3LWUA 3ZZIA 2WZNA 3LACA 4TWEA 4A32A 3DR8A 1DE4C 5J8FA 2GIVA 4YU9A 3VWDA 1KZFA 3R9GA 2Z0ZA 3I1UA 3R9FA 1LOKA 2J8NA 4C7IA 4MFZA 2AE6A 4NGQA 2B4DA 5JH9A 3RAMA 5F48A 2IQ6A 1J4JA 5I0CA 4ORFA 1OBRA 1TKJA 3B3SA 2Z3NA 1S5KA 4C7HA 1AMPA 5J1QA 2O53A 4K3NA 4H89A 1IY7A 3SI0A 1LAMA 2BL1A 3KQXA 4F0YA 5LYDA 1Y7EA 4NJQA 3B3TA 2GANA 3IIBA 4UIAA 3FXTA 4UWIA 3NE8A 5LYIA 4E8OA 3MRUA 2V8VA 4B10A 2B3VA 3CT9A 4GM5A 4R76A 2REEA 4A38A 3W91A 3CXQA 4UEEA 4KORA 4QB9A 4ZYQA 2VI7A 1OZPA 2QMLA 4R3LA 1S7FA 4H6UA 3NH8A 2WSAA 3GUXA 4NEXA 1LFWA 1XIXA 3FEDA 4FBEA 2C6GA 4AB7A 1WK4A 2GFQA 3WC7A 3IU2A 3T8WA 5IB0A 4RS2A 2ARHA 3R1KA 4KOUA 2C6CA 3H8FA 3S9MA 3S6GA 2Q4YA 4UF4A 3PB8X 2PR1A 2X7BA 5IB9A 1Z8TA 4Q38A 5IX3A 4A95A 2JBKA 1VHSA 1Y9WA 4KOXA 3NFZA 2R1IA 3JVNA 2ODFA 5K8OA 3EFAA 3NE7A 3IO1A 4A30A 4UA3A 3JTKA 3TTHA 4NGTA 2Q7BA 3D3SA 1M4LA 3DDDA 1Z5RA 3EY5A 3D8PA 3EXNA 4MHPA 3FECA 4R6TA 4CAXA 2BEIA 3KL9A 3V8IA 5DWMA 4XPDC 1X12A 2EO8A 3DR6A
chains in the Genus database with same CATH topology
4OC5A 3BHXA 2PVWA 2VL1A 1KWMA 3SI2A 3PB7X 2AFMA 1RTQA 3N5FA 2O4HA 5LRGA 2PJCA 2CF4A 2AFXA 1R3NA 1CX8A 2PJ7A 3KGQA 5CPAA 3IWWA 1PCAA 2HC9A 2ZOFA 2PJ9A 1BLLE 4B6ZA 1Y0YA 2GLFA 3D7GA 3LMSA 3WABA 2ZENA 2ZEEA 1BPNA 1CPXA 2J9AA 4UIBA 3D7DA 4PXCA 2C6PA 2NSMA 2GLJA 4LQGA 3TC8A 3DLJA 1XJOA 3JRUA 3B35A 5LYFA 4NGPA 5HVHA 4EFDA 4UEFA 3FMCA 2ZEMA 5DS0A 3D67A 4RUHA 2QYVA 4F8ZA 4P4EA 2F8HA 5HVGA 3S9LA 1LCPA 3D68A 8CPAA 4P45A 2PIYA 2V8DA 4OC4A 3QNVA 1Z8LA 4OIDA 3S9NA 4P4DA 3L2NA 4ONWA 3PFOA 4P4FA 2AFZA 3H8GA 3IJ3A 4MMOA 3PB9X 1ELLP 4NFRA 2V8GA 2BOAA 1UWYA 3ISZA 3PRTA 4EWTA 3V38A 1VGYA 2EK8A 3KHZA 1Y0RA 4DJLA 1QMUA 4MRIA 4H2KA 1CBXA 1H8LA 1CP7A 4MHZA 4ZX9A 2PCUA 2ZEFA 5HXDA 1DTDA 2GU2A 5K8NA 3SJFA 4OC1A 2Q43A 1CP6A 1YW4A 4PXDA 2V77A 3FVLA 3RBUA 1HEEA 2F7VA 4OMEA 4IK2A 2QJ8A 4JYWA 2RFHA 3NA6A 3SJEA 2BO9A 4DUKA 4NGRA 3PB6X 4MCPA 5I4MA 4NJRA 3ISXA 5F09A 1BPMA 4OIWA 2V8HA 2PJ3A 3H8EA 1YW6A 2POKA 4OC3A 1F2PA 3K2KA 3BI0A 4MCSA 2IMOA 1R43A 3KI9A 1FNOA 3FX6A 2JEWA 3B7IA 4X3RA 4P4JA 6CPAA 2ZEPA 4ZY1A 2GREA 1VIXA 2PJ5A 2EK9A 2OR4A 2XEJA 4NGMA 2C1CA 2PJ8A 4FWUA 5D29A 2PJ6A 3WC5A 1JQGA 4WWVA 2PE3A 4P10A 4G1PA 4A39A 2XEFA 5D8NA 5JM6A 1ZLHA 4PPZA 2ZEHA 2ZOGA 3TX8A 1AYEA 4P4IA 1LAPA 1VHOA 1TF9A 4IHMA 4TNUA 1XFOA 3IFEA 2I3CA 4MHYA 1Z2LA 1XRYA 3PEIA 3NH4A 1XMBA 2DEAA 4UEZA 3FH4A 2HB6A 3KR4A 4IAVA 1EE3P 4MHNA 3CPAA 5LRJA 3V7ZA 7CPAA 4PQAA 4P44A 1NSAA 3PBEA 2PJAA 3PFEA 3GLJA 3HUVA 4WJBA 4EMEA 1BAVA 1F2OA 2Q4ZA 2G9DA 1ELMP 3VARA 2PJ2A 3KHXA 3KR5A 4KSIA 2XEGA 1VHEA 4AXVA 1YMEA 3D7FA 2AFWA 2AFOA 4NGNA 4OP4A 4DYOA 2BCOA 5LYLA 3BI1A 3SI1A 4Z65A 2ANPA 2ABZA 1YLOA 2Q51A 3FF3A 3FEEA 4OC0A 3D4UA 2ZEDA 4R7MA 2ZEOA 4ZY2A 2NYQA 2PJBA 3VH9A 2FVGA 2IJZA 3BXMA 2PJ4A 3IC1A 4JZ0A 2EWBA 4BD9A 1IGBA 3CDXA 4P4BA 1ARLA 1Q7LA 3SJGA 4W9YA 3PB4X 1PYTB 2ZEGA 2PJ0A 1ZG9A 3IEHA 1GYTA 2PRQA 3K9TA 3PBBA 2RB7A 4NGSA 3KQZA 3KZWA 2PJ1A 1HDQA 2QVPA 5K8MA 3B3WA 1FT7A 4FAIA 2ZELA 1TKHA 5HVFA 4F9UA 2PIZA 5LRKA 2AFUA 2XEIA 1CG2A 1TF8A 1TKFA 3HLPA 3CPXA 4CPAA 1QQ9A 1ZG7A 4FUUA 3WC6A 3SJXA 4O23A 1XBUA 1CPSA 3B3VA 4PXBA 4MXUA 1HDUA 3FJUA 2CTBA 4A94A 2WYRA 2AFSA 3GB0A 4YWYA 4X8IA 3MN8A 5JGFA 1F57A 3WT4A 3B3CA 4PXEA 1ARMA 4R8FA 3RZAA 4OC2A 1ZLIA 4MCRA 4Q7AA 2JBJA 3DGVA 5ELYA 2CTCA 1LANA 4OKOA 3D66A 2CIJA 1ZG8A 3D7HA 4A37A 4P6YA 3VATA 2PVVA 5K8PA 4ZX8A 1TXRA 5THWA 1YSJA 4X2TA 3B2YA 3KASA 4MCQA 3NH5A 4F9VA 5CBMA 4ZI6A 2OOTA 4ZY0A 3LWUA 2WZNA 4TWEA 1DE4C 4YU9A 3I1UA 1LOKA 4NGQA 5JH9A 3RAMA 2IQ6A 1OBRA 1TKJA 3B3SA 1AMPA 5J1QA 2O53A 4K3NA 1IY7A 3SI0A 1LAMA 3KQXA 5LYDA 1Y7EA 4NJQA 3B3TA 3IIBA 4UIAA 5LYIA 3MRUA 2V8VA 3CT9A 4GM5A 4R76A 4A38A 4UEEA 4ZYQA 3NH8A 3GUXA 1LFWA 3FEDA 4FBEA 2C6GA 3WC7A 3T8WA 2C6CA 3H8FA 3S9MA 4UF4A 3PB8X 5IB9A 2JBKA 3NFZA 5K8OA 3IO1A 4NGTA 1M4LA 1Z5RA 4MHPA 3FECA 4R6TA 3KL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OC5 A;  3BHX A;  2PVW A;  2VL1 A;  1KWM A;  3SI2 A;  3PB7 X;  2AFM A;  1RTQ A;  3N5F A;  2O4H A;  5LRG A;  2PJC A;  2CF4 A;  2AFX A;  1R3N A;  1CX8 A;  2PJ7 A;  3KGQ A;  5CPA A;  3IWW A;  1PCA A;  2HC9 A;  2ZOF A;  2PJ9 A;  1BLL E;  4B6Z A;  1Y0Y A;  2GLF A;  3D7G A;  3LMS A;  3WAB A;  2ZEN A;  2ZEE A;  1BPN A;  1CPX A;  2J9A A;  4UIB A;  3D7D A;  4PXC A;  2C6P A;  2NSM A;  2GLJ A;  4LQG A;  3TC8 A;  3DLJ A;  1XJO A;  3JRU A;  3B35 A;  5LYF A;  4NGP A;  5HVH A;  4EFD A;  4UEF A;  3FMC A;  2ZEM A;  5DS0 A;  3D67 A;  4RUH A;  2QYV A;  4F8Z A;  4P4E A;  2F8H A;  5HVG A;  3S9L A;  1LCP A;  3D68 A;  8CPA A;  4P45 A;  2PIY A;  2V8D A;  4OC4 A;  3QNV A;  1Z8L A;  4OID A;  3S9N A;  4P4D A;  3L2N A;  4ONW A;  3PFO A;  4P4F A;  2AFZ A;  3H8G A;  3IJ3 A;  4MMO A;  3PB9 X;  1ELL P;  4NFR A;  2V8G A;  2BOA A;  1UWY A;  3ISZ A;  3PRT A;  4EWT A;  3V38 A;  1VGY A;  2EK8 A;  3KHZ A;  1Y0R A;  4DJL A;  1QMU A;  4MRI A;  4H2K A;  1CBX A;  1H8L A;  1CP7 A;  4MHZ A;  4ZX9 A;  2PCU A;  2ZEF A;  5HXD A;  1DTD A;  2GU2 A;  5K8N A;  3SJF A;  4OC1 A;  2Q43 A;  1CP6 A;  1YW4 A;  4PXD A;  2V77 A;  3FVL A;  3RBU A;  1HEE A;  2F7V A;  4OME A;  4IK2 A;  2QJ8 A;  4JYW A;  2RFH A;  3NA6 A;  3SJE A;  2BO9 A;  4DUK A;  4NGR A;  3PB6 X;  4MCP A;  5I4M A;  4NJR A;  3ISX A;  5F09 A;  1BPM A;  4OIW A;  2V8H A;  2PJ3 A;  3H8E A;  1YW6 A;  2POK A;  4OC3 A;  1F2P A;  3K2K A;  3BI0 A;  4MCS A;  2IMO A;  1R43 A;  3KI9 A;  1FNO A;  3FX6 A;  2JEW A;  3B7I A;  4X3R A;  4P4J A;  6CPA A;  2ZEP A;  4ZY1 A;  2GRE A;  1VIX A;  2PJ5 A;  2EK9 A;  2OR4 A;  2XEJ A;  4NGM A;  2C1C A;  2PJ8 A;  4FWU A;  5D29 A;  2PJ6 A;  3WC5 A;  1JQG A;  4WWV A;  2PE3 A;  4P10 A;  4G1P A;  4A39 A;  2XEF A;  5D8N A;  5JM6 A;  1ZLH A;  4PPZ A;  2ZEH A;  2ZOG A;  3TX8 A;  1AYE A;  4P4I A;  1LAP A;  1VHO A;  1TF9 A;  4IHM A;  4TNU A;  1XFO A;  3IFE A;  2I3C A;  4MHY A;  1Z2L A;  1XRY A;  3PEI A;  3NH4 A;  1XMB A;  2DEA A;  4UEZ A;  3FH4 A;  2HB6 A;  3KR4 A;  4IAV A;  1EE3 P;  4MHN A;  3CPA A;  5LRJ A;  3V7Z A;  7CPA A;  4PQA A;  4P44 A;  1NSA A;  3PBE A;  2PJA A;  3PFE A;  3GLJ A;  3HUV A;  4WJB A;  4EME A;  1BAV A;  1F2O A;  2Q4Z A;  2G9D A;  1ELM P;  3VAR A;  2PJ2 A;  3KHX A;  3KR5 A;  4KSI A;  2XEG A;  1VHE A;  4AXV A;  1YME A;  3D7F A;  2AFW A;  2AFO A;  4NGN A;  4OP4 A;  4DYO A;  2BCO A;  5LYL A;  3BI1 A;  3SI1 A;  4Z65 A;  2ANP A;  2ABZ A;  1YLO A;  2Q51 A;  3FF3 A;  3FEE A;  4OC0 A;  3D4U A;  2ZED A;  4R7M A;  2ZEO A;  4ZY2 A;  2NYQ A;  2PJB A;  3VH9 A;  2FVG A;  2IJZ A;  3BXM A;  2PJ4 A;  3IC1 A;  4JZ0 A;  2EWB A;  4BD9 A;  1IGB A;  3CDX A;  4P4B A;  1ARL A;  1Q7L A;  3SJG A;  4W9Y A;  3PB4 X;  1PYT B;  2ZEG A;  2PJ0 A;  1ZG9 A;  3IEH A;  1GYT A;  2PRQ A;  3K9T A;  3PBB A;  2RB7 A;  4NGS A;  3KQZ A;  3KZW A;  2PJ1 A;  1HDQ A;  2QVP A;  5K8M A;  3B3W A;  1FT7 A;  4FAI A;  2ZEL A;  1TKH A;  5HVF A;  4F9U A;  2PIZ A;  5LRK A;  2AFU A;  2XEI A;  1CG2 A;  1TF8 A;  1TKF A;  3HLP A;  3CPX A;  4CPA A;  1QQ9 A;  1ZG7 A;  4FUU A;  3WC6 A;  3SJX A;  4O23 A;  1XBU A;  1CPS A;  3B3V A;  4PXB A;  4MXU A;  1HDU A;  3FJU A;  2CTB A;  4A94 A;  2WYR A;  2AFS A;  3GB0 A;  4YWY A;  4X8I A;  3MN8 A;  5JGF A;  1F57 A;  3WT4 A;  3B3C A;  4PXE A;  1ARM A;  4R8F A;  3RZA A;  4OC2 A;  1ZLI A;  4MCR A;  4Q7A A;  2JBJ A;  3DGV A;  5ELY A;  2CTC A;  1LAN A;  4OKO A;  3D66 A;  2CIJ A;  1ZG8 A;  3D7H A;  4A37 A;  4P6Y A;  3VAT A;  2PVV A;  5K8P A;  4ZX8 A;  1TXR A;  5THW A;  1YSJ A;  4X2T A;  3B2Y A;  3KAS A;  4MCQ A;  3NH5 A;  4F9V A;  5CBM A;  4ZI6 A;  2OOT A;  4ZY0 A;  3LWU A;  2WZN A;  4TWE A;  1DE4 C;  4YU9 A;  3I1U A;  1LOK A;  4NGQ A;  5JH9 A;  3RAM A;  2IQ6 A;  1OBR A;  1TKJ A;  3B3S A;  1AMP A;  5J1Q A;  2O53 A;  4K3N A;  1IY7 A;  3SI0 A;  1LAM A;  3KQX A;  5LYD A;  1Y7E A;  4NJQ A;  3B3T A;  3IIB A;  4UIA A;  5LYI A;  3MRU A;  2V8V A;  3CT9 A;  4GM5 A;  4R76 A;  4A38 A;  4UEE A;  4ZYQ A;  3NH8 A;  3GUX A;  1LFW A;  3FED A;  4FBE A;  2C6G A;  3WC7 A;  3T8W A;  2C6C A;  3H8F A;  3S9M A;  4UF4 A;  3PB8 X;  5IB9 A;  2JBK A;  3NFZ A;  5K8O A;  3IO1 A;  4NGT A;  1M4L A;  1Z5R A;  4MHP A;  3FEC A;  4R6T A;  3KL9 A; 
#chains in the Genus database with same CATH topology
 4CRZ B;  4UWJ A;  4YRH A;  1SQH A;  1I21 A;  2P6G A;  3BHX A;  4L8A A;  1QST A;  2PVW A;  4OC5 A;  3GYA A;  4ZBG A;  5H86 A;  5JPH A;  3EO4 A;  4CAV A;  3H5Z A;  1QSO A;  2O28 A;  2VL1 A;  3PZJ A;  1KWM A;  1VKC A;  2FE7 A;  4H6Z A;  4M85 A;  1NSL A;  1N71 A;  5ISV A;  3SI2 A;  3PB7 X;  2AFM A;  2ZW6 A;  2ZW7 A;  2ZPA A;  1RTQ A;  4OAE A;  1R57 A;  1IID A;  3N5F A;  2J8M A;  2O4H A;  5LRG A;  2JDC A;  2PJC A;  3TOA A;  2CF4 A;  1IOI A;  3T9Y A;  2AFX A;  1R3N A;  2WUU A;  1CX8 A;  2PJ7 A;  2KCW A;  4KUA A;  3KGQ A;  3QAH A;  1KUV A;  5CPA A;  3IWW A;  3UY5 A;  1PCA A;  2HC9 A;  1LRZ A;  4FD6 A;  2B5G A;  2P0W A;  2ZOF A;  3TO6 A;  2PJ9 A;  4MHD A;  4UFX A;  4U9Z A;  1BLL E;  2G3T A;  4B6Z A;  4CYP A;  1Y0Y A;  2GLF A;  4KSA A;  4UBR A;  3D7G A;  3C26 A;  3LMS A;  3TO7 A;  3RNZ A;  2JEV A;  3MGD A;  3WAB A;  1ZO0 A;  3R96 A;  2ZEN A;  2ZEE A;  1BPN A;  2Z10 A;  3FNC A;  1CPX A;  2VXK A;  2J9A A;  5G1Z A;  4UIB A;  5A28 A;  3D7D A;  4PXC A;  2C6P A;  2FS5 A;  2NMT A;  2NSM A;  4DNC A;  2GLJ A;  4LQG A;  2PSW A;  1MJB A;  2VZY A;  3TC8 A;  3TO9 A;  3DLJ A;  1XJO A;  3JRU A;  3B35 A;  5LYF A;  3KKW A;  4NGP A;  5HVH A;  4JLY A;  4EFD A;  4UEF A;  3FMC A;  2ZEM A;  4U5Y A;  5DS0 A;  4F0X A;  2WPW A;  3D67 A;  4RUH A;  2QIR A;  2QYV A;  1AUG A;  4IF5 A;  5AGE A;  4F8Z A;  1XE4 A;  4P4E A;  4Q36 A;  2F8H A;  4QBJ A;  5HVG A;  3S9L A;  1LCP A;  3D68 A;  3FIX A;  2CXA A;  8CPA A;  4P45 A;  3RO0 A;  4R3K A;  2PIY A;  4XNH C;  4MI4 A;  2V8D A;  1RO5 A;  4OC4 A;  3QNV A;  3H4Q A;  1Z8L A;  4OID A;  5EC4 A;  3S9N A;  4P4D A;  4GXH A;  3L2N A;  4ONW A;  3TOB A;  3PFO A;  1P0H A;  2Q4V A;  2Z3M A;  2AFZ A;  3H8G A;  3IJ3 A;  4MMO A;  3PB9 X;  4P4F A;  1ELL P;  2CY2 A;  5C82 A;  4NFR A;  2V8G A;  4HPS A;  2BOA A;  1UWY A;  3I9S A;  4F6A A;  4MY0 A;  1V0C A;  4E2A A;  3ISZ A;  3PRT A;  4B14 A;  4EWT A;  4Y49 C;  3V38 A;  5F46 A;  4MFK A;  1VGY A;  2EK8 A;  4QVT A;  3KHZ A;  1Y0R A;  1Y7R A;  1CJW A;  2Q7S A;  2EUI A;  1QMU A;  2F5I A;  4MRI A;  4JD6 A;  5EMI A;  4DJL A;  4H2K A;  2B58 A;  4UFW A;  1CBX A;  1GHE A;  1H8L A;  1CP7 A;  4CGN A;  4MHZ A;  4ZX9 A;  1M44 A;  2PCU A;  2ZEF A;  5HXD A;  1XOV A;  3W6S A;  1DTD A;  2B4B A;  2GU2 A;  5K8N A;  3SJF A;  4OC1 A;  2Q43 A;  4A31 A;  5F49 A;  1CP6 A;  1YW4 A;  4PXD A;  2V77 A;  2ZXV A;  3FVL A;  3RBU A;  3F0A A;  1HEE A;  2F7V A;  4JJX A;  3CXS A;  3G3S A;  2G0B A;  4OME A;  4IK2 A;  4EVY A;  2OZH A;  3I3G A;  2QJ8 A;  1YR0 A;  4JYW A;  2RFH A;  3R95 A;  4B5O A;  1YGH A;  3NA6 A;  3SJE A;  2BO9 A;  4DUK A;  4NGR A;  3PB6 X;  4MCP A;  2Q04 A;  4NJR A;  5I4M A;  1ON0 A;  5G20 A;  3B8G A;  4B5P B;  3ISX A;  3D2P A;  5F09 A;  1BPM A;  3TE4 A;  4OIW A;  2QEC A;  2V8H A;  3CZX A;  4KOV A;  4LQ6 A;  2D4P A;  4J3G A;  4JXR A;  2Z3K A;  2R98 A;  3F8K A;  1QSN A;  3ZJ0 A;  2PJ3 A;  4C2X A;  3H8E A;  4UCM A;  4KOS A;  1Z8W A;  4K30 A;  1YW6 A;  4R9M A;  2POK A;  5A27 A;  4OC3 A;  1YK3 A;  3TT2 A;  2YGW A;  2DXQ A;  1F2P A;  5AG6 A;  2OB0 A;  4U9Y A;  4XPD B;  3QB8 A;  3K2K A;  3BI0 A;  4MCS A;  2IMO A;  1NE9 A;  1R43 A;  3KI9 A;  4C2Z A;  1FNO A;  3SXN A;  3FX6 A;  3VWE A;  5H84 A;  2JEW A;  3B7I A;  4UCP A;  4P4J A;  4X3R A;  6CPA A;  2ZEP A;  4ZY1 A;  2GRE A;  1IU8 A;  1QSR A;  1VIX A;  2P6F A;  2PJ5 A;  2EK9 A;  2OR4 A;  2OZG A;  2XEJ A;  3FRM A;  4OAD A;  1M4D A;  4NGM A;  4UCN A;  4B13 A;  2C1C A;  2AJ6 A;  2PJ8 A;  4FWU A;  1KUY A;  1YVO A;  2HQY A;  1MJ9 A;  2Q44 A;  1P4N A;  4KSF A;  3TCV A;  5J8C A;  5D29 A;  4CAE A;  2PJ6 A;  3WC5 A;  1JQG A;  5KTA A;  4WWV A;  2PE3 A;  4I49 A;  3F5B A;  3G8W A;  4YFJ A;  4P10 A;  4G1P A;  4A39 A;  2XEF A;  2Q0Y A;  5D8N A;  5JM6 A;  1IIC A;  1ZLH A;  3IWE A;  2FIW A;  4PPZ A;  4KOT A;  1Z9U A;  1L0C A;  2ZEH A;  2ZOG A;  2FL4 A;  4LUA A;  3TX8 A;  1AYE A;  2Y0M A;  4P4I A;  4XPK A;  5EBV A;  4MFQ A;  2YNC A;  1LAP A;  1VHO A;  4NXY A;  1TF9 A;  4IHM A;  4TNU A;  4KS9 A;  1XFO A;  3IFE A;  4BMH A;  2I3C A;  4II9 A;  4MHY A;  1Z2L A;  1XRY A;  1YRE A;  3PEI A;  3NH4 A;  1XMB A;  2DEA A;  1JWQ A;  2WPX A;  4UEZ A;  2RC4 A;  4B11 A;  3FH4 A;  2HB6 A;  3KR4 A;  4IAV A;  3EC4 A;  1IOF A;  1EE3 P;  4L89 A;  2CNS A;  3CPA A;  4MHN A;  3SHP A;  4FD7 A;  1U6M A;  1YX0 A;  4MY3 A;  4PQA A;  4P44 A;  5LRJ A;  1NSA A;  3PBE A;  3V7Z A;  7CPA A;  1S7K A;  2ZW4 A;  1WWZ A;  2PJA A;  1FY7 A;  4AVC A;  1IYK A;  3PFE A;  3GLJ A;  3HUV A;  4YGO A;  2Z11 A;  4WJB A;  4XNH B;  2H5M A;  4EME A;  2C27 A;  1BAV A;  1F2O A;  3PGP A;  4MBU A;  4KVM E;  3FB3 A;  3SXO A;  4M6G A;  2ATR A;  2Q4Z A;  2J8R A;  2G9D A;  1ELM P;  2DPS A;  2DPT A;  3A9L A;  3IGR A;  3PP9 A;  5AG5 A;  1M4I A;  3VAR A;  2PJ2 A;  3KHX A;  4CGP A;  4R57 A;  4A2Z A;  4CGO A;  2REF A;  4CS0 B;  2B3U A;  1Q2D A;  3KR5 A;  4NF1 A;  4KSI A;  4M6I A;  2XEG A;  1IYL A;  2VZZ A;  3DSB A;  3LOD A;  5FVJ A;  4B5P A;  1VHE A;  4AXV A;  1YME A;  2OU2 A;  4Y49 B;  2VEZ A;  2AFW A;  3D7F A;  2AFO A;  4NGN A;  4OP4 A;  4DYO A;  2Z3L A;  2BCO A;  4PK3 A;  5LYL A;  1PU9 A;  1Z8X A;  2CNM A;  3BI1 A;  4QUS A;  3TFY A;  2G3A A;  4IUS A;  3S6K A;  3SI1 A;  2VBQ A;  4QC6 A;  4Z65 A;  2JDD A;  4MFP A;  3P2H A;  4R87 A;  2ANP A;  4CYO A;  2ABZ A;  1YLO A;  2Z3O A;  2Q51 A;  4HNW B;  3FF3 A;  2BUE A;  4KOW A;  3FEE A;  4C68 A;  3BJ8 A;  5BWA B;  4M3S A;  1M1D A;  4OC0 A;  4RI1 A;  2FXF A;  3D4U A;  5IV0 A;  2ZED A;  1BO4 A;  4R7M A;  2ZEO A;  2A4N A;  2NYQ A;  2PJB A;  4ZY2 A;  3K9U A;  3VH9 A;  2FVG A;  3GY9 A;  2IJZ A;  1S3Z A;  3BXM A;  4AVB A;  4B12 A;  2PJ4 A;  1B87 A;  3IC1 A;  4KUB A;  4JZ0 A;  2EWB A;  3P2F A;  4BD9 A;  1Y9K A;  1IGB A;  4HKF A;  3CDX A;  1I1D A;  4P4B A;  1ARL A;  2IL4 A;  4OLL A;  4C2Y A;  1Q7L A;  3SJG A;  1YVK A;  1KUX A;  2R8V A;  4W9Y A;  4AG9 A;  3PB4 X;  1CM0 A;  3FYN A;  1PYT B;  4KVO E;  3BJ7 A;  2ZEG A;  2HV2 A;  2PJ0 A;  2B4D B;  3E0K A;  3GKR A;  1I12 A;  1ZG9 A;  4HNY B;  3IEH A;  3IU1 A;  4CYN A;  1GYT A;  2PRQ A;  4RN7 A;  2ZW5 A;  3K9T A;  3PBB A;  2RB7 A;  4NGS A;  2YND A;  3KQZ A;  3KZW A;  4NSQ A;  3W6X A;  2HUZ A;  4E0A A;  4CYQ A;  2PJ1 A;  1HDQ A;  2QVP A;  4JWP A;  5K8M A;  2R7H A;  3B3W A;  5AG4 A;  2OZU A;  3N7Z A;  4PV6 A;  1FT7 A;  3QAY A;  5KTD A;  4FAI A;  1QSM A;  4NCZ A;  4KVX A;  4UFV A;  4MFL A;  2ZEL A;  1TKH A;  5HVF A;  4F9U A;  2DF5 A;  2PIZ A;  5LRK A;  3JUW A;  1K4J A;  3S6H A;  1XMT A;  2AFU A;  2XEI A;  1CG2 A;  2PDO A;  1TF8 A;  1TKF A;  3OWC A;  3HLP A;  3R9E A;  4CRY B;  1Z4E A;  3CPX A;  4LX9 A;  1QQ9 A;  1XF8 A;  5CNP A;  3FBU A;  3T90 A;  4AG7 A;  2PRB A;  4CPA A;  3DNS A;  1ZG7 A;  5G21 A;  4FUU A;  4PSX A;  3WC6 A;  3SJX A;  4O23 A;  2GE3 A;  1XBU A;  4KLW A;  4JXQ A;  4MJ8 A;  1CPS A;  4KZT A;  5E96 A;  3B3V A;  4PXB A;  4BIN A;  4MXU A;  5JQ4 A;  1HDU A;  3FJU A;  2P6E A;  2CTB A;  2FSR A;  1B6B A;  5HMN A;  2BSW A;  3BLN A;  1Z4R A;  4A94 A;  2OH1 A;  2WYR A;  1BOB A;  5DWN A;  5KTC A;  4XPL A;  2FT0 A;  5F47 A;  2AFS A;  3GB0 A;  4CAW A;  4YWY A;  4ZGY B;  4X8I A;  3MN8 A;  5JGF A;  4M6H A;  1X10 A;  4FD5 A;  4ONU A;  1F57 A;  2I79 A;  4X5K A;  4CGL A;  3WT4 A;  3B3C A;  3D2M A;  4PXE A;  1ARM A;  4R8F A;  1S7L A;  3RZA A;  4CGM A;  4OC2 A;  1ZLI A;  4MCR A;  1PUA A;  4Q7A A;  2JBJ A;  4PSW A;  3CXP A;  1MJA A;  3DGV A;  3WR7 A;  5ELY A;  2D4O A;  1UFH A;  4KLV A;  4BBH A;  2VQY A;  4AVA A;  3GIU A;  3LD2 A;  2CTC A;  1LAN A;  2PC1 A;  4KOY A;  4OKO A;  3D66 A;  2CIJ A;  1ZG8 A;  1TIQ A;  1S60 A;  2I00 A;  3D7H A;  2Z3P A;  2EVN A;  4MFJ A;  4A37 A;  3RYO A;  4P6Y A;  5AG7 A;  4GS4 A;  4PK2 A;  5C88 A;  1RXT A;  2PQ8 A;  3VAT A;  2PVV A;  2FIA A;  4FD4 A;  4ZX8 A;  5K8P A;  1TXR A;  5THW A;  2K5T A;  5G22 A;  1YSJ A;  4X2T A;  1Q2Y A;  2FCK A;  3B2Y A;  2B5G B;  3KAS A;  4MCQ A;  1YQE A;  1S7N A;  2CNT A;  2PR8 A;  2YNE A;  1NMT A;  3NH5 A;  2JLM A;  4F9V A;  4CAF A;  1A2Z A;  5CBM A;  1M4G A;  4ZI6 A;  5HH1 A;  1IB1 E;  1XEB A;  2OOT A;  4ZY0 A;  2EBJ A;  1MK4 A;  1Q2C A;  3IWG A;  2YNC C;  5GCN A;  3S6F A;  4HNX B;  4A33 A;  1YLE A;  3LWU A;  3ZZI A;  2WZN A;  3LAC A;  4TWE A;  4A32 A;  3DR8 A;  1DE4 C;  5J8F A;  2GIV A;  4YU9 A;  3VWD A;  1KZF A;  3R9G A;  2Z0Z A;  3I1U A;  3R9F A;  1LOK A;  2J8N A;  4C7I A;  4MFZ A;  2AE6 A;  4NGQ A;  2B4D A;  5JH9 A;  3RAM A;  5F48 A;  2IQ6 A;  1J4J A;  5I0C A;  4ORF A;  1OBR A;  1TKJ A;  3B3S A;  2Z3N A;  1S5K A;  4C7H A;  1AMP A;  5J1Q A;  2O53 A;  4K3N A;  4H89 A;  1IY7 A;  3SI0 A;  1LAM A;  2BL1 A;  3KQX A;  4F0Y A;  5LYD A;  1Y7E A;  4NJQ A;  3B3T A;  2GAN A;  3IIB A;  4UIA A;  3FXT A;  4UWI A;  3NE8 A;  5LYI A;  4E8O A;  3MRU A;  2V8V A;  4B10 A;  2B3V A;  3CT9 A;  4GM5 A;  4R76 A;  2REE A;  4A38 A;  3W91 A;  3CXQ A;  4UEE A;  4KOR A;  4QB9 A;  4ZYQ A;  2VI7 A;  1OZP A;  2QML A;  4R3L A;  1S7F A;  4H6U A;  3NH8 A;  2WSA A;  3GUX A;  4NEX A;  1LFW A;  1XIX A;  3FED A;  4FBE A;  2C6G A;  4AB7 A;  1WK4 A;  2GFQ A;  3WC7 A;  3IU2 A;  3T8W A;  5IB0 A;  4RS2 A;  2ARH A;  3R1K A;  4KOU A;  2C6C A;  3H8F A;  3S9M A;  3S6G A;  2Q4Y A;  4UF4 A;  3PB8 X;  2PR1 A;  2X7B A;  5IB9 A;  1Z8T A;  4Q38 A;  5IX3 A;  4A95 A;  2JBK A;  1VHS A;  1Y9W A;  4KOX A;  3NFZ A;  2R1I A;  3JVN A;  2ODF A;  5K8O A;  3EFA A;  3NE7 A;  3IO1 A;  4A30 A;  4UA3 A;  3JTK A;  3TTH A;  4NGT A;  2Q7B A;  3D3S A;  1M4L A;  3DDD A;  1Z5R A;  3EY5 A;  3D8P A;  3EXN A;  4MHP A;  3FEC A;  4R6T A;  4CAX A;  2BEI A;  3KL9 A;  3V8I A;  5DWM A;  4XPD C;  1X12 A;  2EO8 A;  3DR6 A; 
#chains in the Genus database with same CATH homology
 4OC5 A;  3BHX A;  2PVW A;  2VL1 A;  1KWM A;  3SI2 A;  3PB7 X;  2AFM A;  1RTQ A;  3N5F A;  2O4H A;  5LRG A;  2PJC A;  2CF4 A;  2AFX A;  1R3N A;  1CX8 A;  2PJ7 A;  3KGQ A;  5CPA A;  3IWW A;  1PCA A;  2HC9 A;  2ZOF A;  2PJ9 A;  1BLL E;  4B6Z A;  1Y0Y A;  2GLF A;  3D7G A;  3LMS A;  3WAB A;  2ZEN A;  2ZEE A;  1BPN A;  1CPX A;  2J9A A;  4UIB A;  3D7D A;  4PXC A;  2C6P A;  2NSM A;  2GLJ A;  4LQG A;  3TC8 A;  3DLJ A;  1XJO A;  3JRU A;  3B35 A;  5LYF A;  4NGP A;  5HVH A;  4EFD A;  4UEF A;  3FMC A;  2ZEM A;  5DS0 A;  3D67 A;  4RUH A;  2QYV A;  4F8Z A;  4P4E A;  2F8H A;  5HVG A;  3S9L A;  1LCP A;  3D68 A;  8CPA A;  4P45 A;  2PIY A;  2V8D A;  4OC4 A;  3QNV A;  1Z8L A;  4OID A;  3S9N A;  4P4D A;  3L2N A;  4ONW A;  3PFO A;  4P4F A;  2AFZ A;  3H8G A;  3IJ3 A;  4MMO A;  3PB9 X;  1ELL P;  4NFR A;  2V8G A;  2BOA A;  1UWY A;  3ISZ A;  3PRT A;  4EWT A;  3V38 A;  1VGY A;  2EK8 A;  3KHZ A;  1Y0R A;  4DJL A;  1QMU A;  4MRI A;  4H2K A;  1CBX A;  1H8L A;  1CP7 A;  4MHZ A;  4ZX9 A;  2PCU A;  2ZEF A;  5HXD A;  1DTD A;  2GU2 A;  5K8N A;  3SJF A;  4OC1 A;  2Q43 A;  1CP6 A;  1YW4 A;  4PXD A;  2V77 A;  3FVL A;  3RBU A;  1HEE A;  2F7V A;  4OME A;  4IK2 A;  2QJ8 A;  4JYW A;  2RFH A;  3NA6 A;  3SJE A;  2BO9 A;  4DUK A;  4NGR A;  3PB6 X;  4MCP A;  5I4M A;  4NJR A;  3ISX A;  5F09 A;  1BPM A;  4OIW A;  2V8H A;  2PJ3 A;  3H8E A;  1YW6 A;  2POK A;  4OC3 A;  1F2P A;  3K2K A;  3BI0 A;  4MCS A;  2IMO A;  1R43 A;  3KI9 A;  1FNO A;  3FX6 A;  2JEW A;  3B7I A;  4X3R A;  4P4J A;  6CPA A;  2ZEP A;  4ZY1 A;  2GRE A;  1VIX A;  2PJ5 A;  2EK9 A;  2OR4 A;  2XEJ A;  4NGM A;  2C1C A;  2PJ8 A;  4FWU A;  5D29 A;  2PJ6 A;  3WC5 A;  1JQG A;  4WWV A;  2PE3 A;  4P10 A;  4G1P A;  4A39 A;  2XEF A;  5D8N A;  5JM6 A;  1ZLH A;  4PPZ A;  2ZEH A;  2ZOG A;  3TX8 A;  1AYE A;  4P4I A;  1LAP A;  1VHO A;  1TF9 A;  4IHM A;  4TNU A;  1XFO A;  3IFE A;  2I3C A;  4MHY A;  1Z2L A;  1XRY A;  3PEI A;  3NH4 A;  1XMB A;  2DEA A;  4UEZ A;  3FH4 A;  2HB6 A;  3KR4 A;  4IAV A;  1EE3 P;  4MHN A;  3CPA A;  5LRJ A;  3V7Z A;  7CPA A;  4PQA A;  4P44 A;  1NSA A;  3PBE A;  2PJA A;  3PFE A;  3GLJ A;  3HUV A;  4WJB A;  4EME A;  1BAV A;  1F2O A;  2Q4Z A;  2G9D A;  1ELM P;  3VAR A;  2PJ2 A;  3KHX A;  3KR5 A;  4KSI A;  2XEG A;  1VHE A;  4AXV A;  1YME A;  3D7F A;  2AFW A;  2AFO A;  4NGN A;  4OP4 A;  4DYO A;  2BCO A;  5LYL A;  3BI1 A;  3SI1 A;  4Z65 A;  2ANP A;  2ABZ A;  1YLO A;  2Q51 A;  3FF3 A;  3FEE A;  4OC0 A;  3D4U A;  2ZED A;  4R7M A;  2ZEO A;  4ZY2 A;  2NYQ A;  2PJB A;  3VH9 A;  2FVG A;  2IJZ A;  3BXM A;  2PJ4 A;  3IC1 A;  4JZ0 A;  2EWB A;  4BD9 A;  1IGB A;  3CDX A;  4P4B A;  1ARL A;  1Q7L A;  3SJG A;  4W9Y A;  3PB4 X;  1PYT B;  2ZEG A;  2PJ0 A;  1ZG9 A;  3IEH A;  1GYT A;  2PRQ A;  3K9T A;  3PBB A;  2RB7 A;  4NGS A;  3KQZ A;  3KZW A;  2PJ1 A;  1HDQ A;  2QVP A;  5K8M A;  3B3W A;  1FT7 A;  4FAI A;  2ZEL A;  1TKH A;  5HVF A;  4F9U A;  2PIZ A;  5LRK A;  2AFU A;  2XEI A;  1CG2 A;  1TF8 A;  1TKF A;  3HLP A;  3CPX A;  4CPA A;  1QQ9 A;  1ZG7 A;  4FUU A;  3WC6 A;  3SJX A;  4O23 A;  1XBU A;  1CPS A;  3B3V A;  4PXB A;  4MXU A;  1HDU A;  3FJU A;  2CTB A;  4A94 A;  2WYR A;  2AFS A;  3GB0 A;  4YWY A;  4X8I A;  3MN8 A;  5JGF A;  1F57 A;  3WT4 A;  3B3C A;  4PXE A;  1ARM A;  4R8F A;  3RZA A;  4OC2 A;  1ZLI A;  4MCR A;  4Q7A A;  2JBJ A;  3DGV A;  5ELY A;  2CTC A;  1LAN A;  4OKO A;  3D66 A;  2CIJ A;  1ZG8 A;  3D7H A;  4A37 A;  4P6Y A;  3VAT A;  2PVV A;  5K8P A;  4ZX8 A;  1TXR A;  5THW A;  1YSJ A;  4X2T A;  3B2Y A;  3KAS A;  4MCQ A;  3NH5 A;  4F9V A;  5CBM A;  4ZI6 A;  2OOT A;  4ZY0 A;  3LWU A;  2WZN A;  4TWE A;  1DE4 C;  4YU9 A;  3I1U A;  1LOK A;  4NGQ A;  5JH9 A;  3RAM A;  2IQ6 A;  1OBR A;  1TKJ A;  3B3S A;  1AMP A;  5J1Q A;  2O53 A;  4K3N A;  1IY7 A;  3SI0 A;  1LAM A;  3KQX A;  5LYD A;  1Y7E A;  4NJQ A;  3B3T A;  3IIB A;  4UIA A;  5LYI A;  3MRU A;  2V8V A;  3CT9 A;  4GM5 A;  4R76 A;  4A38 A;  4UEE A;  4ZYQ A;  3NH8 A;  3GUX A;  1LFW A;  3FED A;  4FBE A;  2C6G A;  3WC7 A;  3T8W A;  2C6C A;  3H8F A;  3S9M A;  4UF4 A;  3PB8 X;  5IB9 A;  2JBK A;  3NFZ A;  5K8O A;  3IO1 A;  4NGT A;  1M4L A;  1Z5R A;  4MHP A;  3FEC A;  4R6T A;  3KL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...