2AFXA

Crystal structure of human glutaminyl cyclase in complex with 1-benzylimidazole
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
329
structure length
323
Chain Sequence
b'ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title Crystal structures of human glutaminyl cyclase, an enzyme responsible for protein N-terminal pyroglutamate formation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 110
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2afxA00
4NGPA 2V77A 1EE3P 3FJUA 2V8DA 3WABA 1YW6A 2V8VA 1TKJA 5LRKA 4NJQA 4F9UA 8CPAA 1GYTA 3K2KA 2IQ6A 4JZ0A 3B35A 3PFOA 4UF4A 5THWA 4BD9A 2V8HA 2PVVA 2F7VA 2HC9A 4GM5A 1BPNA 1QQ9A 5K8PA 2J9AA 2PJ3A 1IY7A 3SI0A 1AMPA 3SJXA 4P4DA 3FMCA 4PXDA 4A39A 5K8NA 2PJ4A 1R43A 4ZY1A 1HEEA 2PE3A 2WYRA 2O4HA 2PJ0A 3SI2A 3NA6A 4OC5A 1TXRA 1HDQA 1LCPA 2ZEOA 1XBUA 2XEFA 5I4MA 3FF3A 3GLJA 3H8GA 2BCOA 3IWWA 2CTCA 4UEZA 3S9LA 3KR4A 4Z65A 1ARLA 3IIBA 4P44A 6CPAA 5HVGA 4A94A 4P10A 4NGNA 4NGQA 1YSJA 4F8ZA 2JEWA 4OKOA 2ZEGA 4MCQA 3PBEA 4ZY2A 1ZLHA 3FH4A 3CT9A 2V8GA 3SI1A 2PJ8A 3K9TA 3KI9A 3L2NA 3KL9A 1F2PA 3PEIA 2ZEPA 2DEAA 2EK9A 3CPXA 5JH9A 2PJ5A 2VL1A 3JRUA 2EWBA 3TX8A 5CBMA 5LRJA 2NYQA 3SJGA 2G9DA 4A38A 2PJAA 4OC1A 3IEHA 2AFMA 4YU9A 3D7DA 3H8EA 1LFWA 2C6CA 3IJ3A 4NFRA 4H2KA 1M4LA 5DS0A 2GLJA 1CPXA 1ARMA 3KQZA 1VHOA 5JGFA 4PQAA 4X3RA 4ZY0A 1JQGA 2AFOA 1ZG7A 4G1PA 4UIBA 3WC6A 1CP7A 3FEEA 3FECA 4IAVA 3LWUA 4MCRA 1CG2A 2ZOFA 5LRGA 2O53A 3B3VA 3KHZA 2ZOGA 3VATA 4K3NA 7CPAA 4R8FA 4B6ZA 1LOKA 1YW4A 3N5FA 3FEDA 3RBUA 3PB7X 4P4FA 3IFEA 3D4UA 1HDUA 1CP6A 3V7ZA 2QVPA 2HB6A 5D29A 3D67A 4NJRA 4IHMA 4IK2A 4TWEA 3ISXA 3MRUA 2ABZA 2JBJA 5HXDA 1YLOA 2QJ8A 3NH8A 4NGRA 4DUKA 2AFZA 3IC1A 1CBXA 4EFDA 3H8FA 4FUUA 5D8NA 1ELMP 3S9MA 4OIDA 2NSMA 1VGYA 3D68A 5ELYA 4EWTA 1VIXA 3D7FA 5LYFA 5LYLA 4KSIA 1TKFA 3B2YA 1Q7LA 2BOAA 2AFXA 4OC3A 2C6PA 4MCSA 1LAPA 5JM6A 2PJ2A 1AYEA 1PCAA 1Y0YA 1CPSA 3WC5A 1ZG9A 5HVFA 2GU2A 2RB7A 3PB6X 1LANA 3SJEA 3NFZA 5LYIA 5LYDA 2PCUA 1Y0RA 4Q7AA 4R76A 3BI1A 1XJOA 2PJ7A 3KASA 4A37A 3VH9A 2XEGA 5HVHA 2BO9A 2RFHA 3B3CA 5IB9A 4FWUA 1F57A 3BI0A 2AFWA 1F2OA 2CTBA 1TKHA 4MMOA 4MHPA 4W9YA 3WT4A 3CDXA 4R7MA 4DJLA 4P4IA 2PJCA 2IMOA 3PBBA 1ZG8A 4JYWA 2FVGA 2C6GA 3B3WA 1LAMA 4P6YA 2ZEHA 3NH4A 4RUHA 3D7GA 2ANPA 4FBEA 4WWVA 4PPZA 2XEIA 3KHXA 3KZWA 1XMBA 2Q4ZA 3B7IA 1XFOA 1Z2LA 3MN8A 5K8OA 4P45A 1R3NA 4ONWA 3FVLA 4OMEA 1Z5RA 1FNOA 3RZAA 3V38A 1TF9A 1OBRA 4MHYA 5CPAA 3SJFA 4O23A 4PXEA 5J1QA 4EMEA 1H8LA 3GB0A 3S9NA 3I1UA 3WC7A 4NGTA 3HUVA 4ZYQA 5K8MA 1KWMA 2AFSA 2PJBA 4X8IA 1Y7EA 4YWYA 2CIJA 4OC0A 3PFEA 2OOTA 3RAMA 3PB9X 1IGBA 2Q51A 4DYOA 4OC2A 4NGMA 3LMSA 3T8WA 4TNUA 4ZX8A 2Q43A 4CPAA 3NH5A 3PRTA 3BHXA 1NSAA 2ZEDA 4MRIA 1TF8A 1PYTB 2PJ1A 4OIWA 3DGVA 1ELLP 1XRYA 1BPMA 2F8HA 3KGQA 2ZEEA 4X2TA 1BLLE 1ZLIA 2I3CA 3KR5A 2PIYA 2PJ9A 3KQXA 4MHNA 1FT7A 4ZI6A 2ZEFA 3IO1A 2POKA 2ZENA 3TC8A 3DLJA 4PXCA 4WJBA 4MHZA 4UIAA 3VARA 1RTQA 3FX6A 4FAIA 4ZX9A 3QNVA 3D66A 1CX8A 4R6TA 2EK8A 4AXVA 3BXMA 1VHEA 2OR4A 3PB8X 2GREA 2PRQA 2CF4A 5F09A 1UWYA 3D7HA 4OP4A 1YMEA 4PXBA 4NGSA 2WZNA 3CPAA 1DTDA 2IJZA 1BAVA 3ISZA 1QMUA 4OC4A 3B3SA 3GUXA 4MXUA 2C1CA 4LQGA 4MCPA 2QYVA 3PB4X 2XEJA 4F9VA 4P4EA 2GLFA 4P4JA 3B3TA 3HLPA 4UEEA 2PVWA 1DE4C 2AFUA 2PJ6A 4P4BA 2JBKA 2ZELA 4UEFA 1Z8LA 2ZEMA 2PIZA
chains in the Genus database with same CATH superfamily
2VI7A 2JDCA 1YREA 2V77A 1EE3P 4NGPA 4MFQA 3EFAA 2R98A 3FJUA 5BWAB 4LUAA 4LX9A 5AG5A 3GKRA 5I0CA 4FD7A 5H84A 2V8DA 3LODA 3WABA 1YW6A 4CAWA 4A31A 2V8VA 4CRYB 1TKJA 4NF1A 3CXQA 5LRKA 4NJQA 4U5YA 4F9UA 3F8KA 8CPAA 4UCNA 1GYTA 1Z8XA 1MJ9A 3K2KA 3R1KA 2IQ6A 4KOTA 1IIDA 4JZ0A 2H5MA 3B35A 3PFOA 2Y0MA 4UF4A 2Z3OA 5THWA 4BD9A 3EXNA 4X5KA 2HQYA 1S3ZA 2HUZA 4XPKA 2V8HA 2PVVA 2NMTA 2F7VA 2Q4YA 2HC9A 3JVNA 1Z8WA 5ISVA 4GM5A 2GFQA 4AG7A 1BPNA 1QQ9A 1Q2CA 5K8PA 4B13A 2J9AA 2PJ3A 1IY7A 1I1DA 5GCNA 4UFWA 1SQHA 3SI0A 1AMPA 1QSTA 3SJXA 2DF5A 2WUUA 4KOVA 4MFPA 3CXPA 3FMCA 3PGPA 4P4DA 4PXDA 4MBUA 4A39A 5K8NA 2PJ4A 1R43A 1M44A 4ZY1A 1HEEA 2PE3A 2Z3MA 4QUSA 2WYRA 3SHPA 3R9FA 5C88A 2J8NA 4UWJA 2ZPAA 2O4HA 4YRHA 2PJ0A 3SI2A 3TCVA 1Y9KA 3NA6A 4OC5A 5J8CA 1TXRA 1HDQA 1LCPA 1Z4RA 2ZEOA 5IX3A 1IOFA 4HNWB 1XBUA 4NSQA 2XEFA 4OAEA 5I4MA 3FF3A 4MI4A 3GLJA 2I79A 3H8GA 3KKWA 2BCOA 4CGPA 1IYLA 3IWWA 2CTCA 2P0WA 2FL4A 4HKFA 1ZO0A 1QSMA 4UEZA 3G3SA 3S9LA 3KR4A 2ODFA 4M3SA 2PRBA 4Z65A 1ARLA 1B87A 3IIBA 4P44A 6CPAA 5HVGA 4A94A 4P10A 4NGNA 4A30A 3R96A 1A2ZA 4RI1A 4NGQA 1YSJA 3IWEA 3S6FA 4F8ZA 4AVCA 2JEWA 3BJ8A 1JWQA 3H4QA 2ZEGA 4OKOA 1YX0A 4MCQA 5EMIA 3PBEA 4ZBGA 5E96A 4ZY2A 1KZFA 1ZLHA 3FH4A 2B4DB 5J8FA 1IB1E 3CT9A 5F48A 2V8GA 3SI1A 4KS9A 4YFJA 2PJ8A 5JQ4A 1J4JA 4CYPA 1U6MA 3DSBA 5G20A 3K9TA 4UCMA 3VWDA 2JLMA 3KI9A 3L2NA 3KL9A 1M4IA 2ZW5A 3DDDA 1R57A 1F2PA 3PEIA 2BEIA 2QIRA 2B5GB 2ZEPA 2DEAA 2EK9A 3CPXA 4KOWA 5JH9A 2PJ5A 4IUSA 2VL1A 1S7LA 3JRUA 2EWBA 4EVYA 3TX8A 1S60A 4LQ6A 4M6GA 5CBMA 1YLEA 2CXAA 5LRJA 2NYQA 4B5OA 3SJGA 2G9DA 2EUIA 3I9SA 2G3TA 2I00A 2PJAA 4OC1A 3IEHA 4A38A 2AFMA 4YU9A 4JLYA 3D7DA 4UBRA 4CGOA 5IB0A 4ORFA 4CGNA 2ZXVA 3H8EA 1LFWA 3K9UA 2C6CA 3IJ3A 1X12A 4NFRA 4MFZA 4XNHC 4GS4A 4H2KA 2D4OA 5AG6A 3T90A 1M4LA 5DS0A 2GLJA 3SXNA 3P2FA 1CPXA 4E2AA 1ARMA 3KQZA 2IL4A 1Q2DA 1VHOA 4R3KA 5JGFA 3EY5A 4KUAA 2B4BA 4PQAA 2K5TA 4X3RA 4A33A 1Q2YA 4ZY0A 1JQGA 2AFOA 4AG9A 1ZG7A 4KOYA 4G1PA 4UIBA 4QC6A 3WC6A 4B11A 5DWNA 3FB3A 4ONUA 1CP7A 4U9YA 2FXFA 3FEEA 1B6BA 3FECA 4B12A 1WK4A 4IAVA 4KSAA 3LWUA 4MCRA 1CG2A 2F5IA 5CNPA 4CGMA 4Q36A 5C82A 2ZOFA 4H6UA 5F49A 5LRGA 2O53A 3NE8A 3B3VA 1Y9WA 2R1IA 2ZOGA 3KHZA 4KOXA 3VATA 1YR0A 4K3NA 7CPAA 1OZPA 1V0CA 4CYOA 4R8FA 2YNCC 4KLWA 3N7ZA 4KSFA 4PSXA 4BMHA 3FBUA 4KOUA 4B6ZA 1LOKA 1YW4A 3GYAA 3N5FA 4NCZA 2AJ6A 2ZW7A 3SXOA 3FEDA 2VZZA 4JXRA 2Q7BA 3RBUA 3PB7X 4P4FA 1BO4A 3IFEA 4CGLA 3D4UA 4K30A 2OZGA 3RYOA 2CNMA 1HDUA 4C68A 1M4GA 2DXQA 1CP6A 5G22A 4QBJA 3V7ZA 2QVPA 1KUYA 2HB6A 4XPDC 5D29A 3WR7A 3D67A 4Q38A 2YNDA 4NJRA 4IHMA 4IK2A 4TWEA 1S5KA 3D2MA 1XEBA 4MY3A 2DPSA 3ISXA 4L8AA 3MRUA 2ABZA 1N71A 2JBJA 3TOBA 2FS5A 5HXDA 1YLOA 4AVBA 2QJ8A 3IGRA 3NH8A 4NGRA 3R9EA 4DUKA 2AFZA 2G3AA 3IC1A 1CBXA 4EFDA 3V8IA 3FXTA 3H8FA 5F47A 4CAEA 4FUUA 4A2ZA 2PR8A 1ELMP 5D8NA 3S9MA 4OIDA 2Q04A 2NSMA 1VGYA 2PR1A 3D68A 4KUBA 1KUVA 5ELYA 4CYQA 3NE7A 4EWTA 1VIXA 3D7FA 1RO5A 5LYFA 5LYLA 4OADA 3BLNA 4JD6A 4KSIA 1TKFA 1L0CA 5AG7A 5AG4A 2OB0A 3B2YA 1BOBA 5HMNA 1FY7A 1Q7LA 2BOAA 3R95A 2AFXA 4C2ZA 1NE9A 4OC3A 2C6PA 4MCSA 4PK3A 1LAPA 5JM6A 1NMTA 4C2XA 2PJ2A 1AYEA 4KVOE 1PCAA 3D8PA 4KLVA 1Y0YA 3TOAA 1CPSA 3WC5A 4CS0B 4CYNA 1ZG9A 2D4PA 2GU2A 2RB7A 1S7KA 3PB6X 5HVFA 4B10A 2QMLA 1LANA 1RXTA 3SJEA 1QSOA 3NFZA 3TO7A 4F0XA 5LYIA 2REEA 5LYDA 5EC4A 3FIXA 2PCUA 3FNCA 3E0KA 1Y0RA 4Q7AA 3IU1A 4R76A 2P6GA 3BI1A 3QAHA 1XJOA 4IF5A 2Q4VA 2X7BA 4UCPA 1CM0A 2B3UA 2KCWA 4AVAA 1TIQA 2PJ7A 3DR6A 3KASA 1YK3A 1P4NA 4A37A 4R3LA 3VH9A 2GIVA 3W91A 2XEGA 5HVHA 1IOIA 1YGHA 4E0AA 1Y7RA 2BO9A 4R57A 2RFHA 3B3CA 2Z10A 5IB9A 2Z3LA 1MJBA 4FWUA 4Y49C 3W6XA 1F57A 2EBJA 3BI0A 2AFWA 1F2OA 2GE3A 3BJ7A 2CTBA 4MJ8A 2Z0ZA 4L89A 1I21A 1I12A 3DR8A 1TKHA 4MMOA 1YVKA 2G0BA 2PQ8A 4M85A 5KTDA 2FE7A 4MHPA 4W9YA 3WT4A 3CDXA 4R7MA 4CAXA 4DJLA 4P4IA 5G21A 2PJCA 2IMOA 2B3VA 3PBBA 4A95A 1WWZA 1ZG8A 4JYWA 4XPLA 3DNSA 3T9YA 2FVGA 2C6GA 3EC4A 3GIUA 3B3WA 4H6ZA 3H5ZA 1XMTA 2AE6A 2Z3PA 1Z9UA 1LAMA 4KZTA 1IU8A 4P6YA 4YGOA 4MHDA 2ZEHA 4M6HA 3NH4A 3W6SA 4KOSA 4PV6A 3TE4A 2FSRA 2OZHA 4RUHA 2VQYA 3D7GA 1XE4A 2ANPA 1LRZA 4FBEA 4WWVA 4RS2A 5G1ZA 4M6IA 2XEIA 3KHXA 3KZWA 4PPZA 5A27A 4MY0A 1XIXA 1XMBA 3ZJ0A 3ZZIA 4B5PA 4PK2A 1NSLA 4NXYA 2Q4ZA 2J8RA 4KVME 3B7IA 4GXHA 2JDDA 1S7FA 1XFOA 1Z2LA 3MN8A 5K8OA 3TT2A 3A9LA 4P45A 1R3NA 4ONWA 4MFLA 4H89A 4UWIA 4XNHB 4II9A 1MK4A 1M4DA 5FVJA 2R8VA 3FVLA 4OMEA 1Z5RA 2WPXA 1FNOA 3RZAA 3S6KA 4CAVA 3V38A 1TF9A 4FD4A 1OBRA 3I3GA 3JTKA 4MHYA 5CPAA 1VHSA 3SJFA 4O23A 2O28A 4PXEA 5J1QA 2Z11A 2B58A 2WPWA 3S6HA 3FRMA 3QB8A 2FIAA 5EBVA 4EMEA 1M1DA 2ATRA 2BUEA 2PSWA 1X10A 1H8LA 2P6FA 4HPSA 3D3SA 4R87A 4C7IA 2VXKA 3GB0A 3S9NA 3I1UA 3WC7A 3HUVA 4NGTA 4ZYQA 5K8MA 1KWMA 2AFSA 2PJBA 4X8IA 1Y7EA 1Z4EA 4YWYA 3G8WA 2Z3NA 1ON0A 4HNXB 2JEVA 4QB9A 2REFA 3OWCA 2A4NA 4KVXA 2CIJA 4OC0A 2WSAA 5KTCA 3C26A 2OZUA 3PFEA 2OOTA 3RAMA 3PB9X 4I49A 4PSWA 1IGBA 2Q51A 2YNCA 1QSNA 4DYOA 4OC2A 4NGMA 3TO9A 1VKCA 3LMSA 2ZW4A 3T8WA 2Q0YA 4TNUA 4ZX8A 2ZW6A 2Q43A 4CPAA 1Z8TA 1S7NA 2C27A 3NH5A 2CY2A 3EO4A 3PRTA 3S6GA 3UY5A 2FT0A 3BHXA 5DWMA 2EVNA 2R7HA 1NSAA 3D2PA 2OU2A 3TFYA 2ZEDA 1YQEA 2EO8A 3GY9A 4XPDB 4MRIA 1TF8A 1PYTB 2FIWA 2PJ1A 2VZYA 5IV0A 2BSWA 4OIWA 3DGVA 1IYKA 1ELLP 1XRYA 3MGDA 1BPMA 2F8HA 5AGEA 3CXSA 3KGQA 1P0HA 2ZEEA 4X2TA 3RNZA 1BLLE 1ZLIA 2I3CA 3KR5A 2CNSA 1K4JA 1YVOA 2PIYA 4JJXA 1XOVA 2PJ9A 3CZXA 4A32A 3F5BA 3KQXA 4MHNA 1FT7A 4ZI6A 1KUXA 1CJWA 5HH1A 2J8MA 4E8OA 2BL1A 2ZEFA 3IO1A 2POKA 3R9GA 3VWEA 2ZENA 3TC8A 2PDOA 3DLJA 4PXCA 4F0YA 2YGWA 4WJBA 4MHZA 4UIAA 3VARA 1RTQA 2FCKA 3FX6A 4FAIA 1PU9A 2PC1A 1PUAA 3QNVA 3D66A 1CX8A 4ZX9A 4BBHA 1IICA 4MFJA 2VEZA 4R6TA 2B4DA 2EK8A 5JPHA 4AXVA 4C7HA 3BXMA 2QECA 4RN7A 1VHEA 4UFXA 2Q44A 3TTHA 3FYNA 2CNTA 2OR4A 3PB8X 5H86A 4C2YA 1QSRA 2GREA 3QAYA 3LD2A 4F6AA 3IU2A 2B5GA 4FD6A 1XF8A 3LACA 2PRQA 2P6EA 2CF4A 3F0AA 3IWGA 3P2HA 3PP9A 4MFKA 1UWYA 5F09A 3D7HA 3TO6A 1MJAA 2YNEA 1YMEA 4OP4A 4PXBA 4CRZB 4NGSA 2WZNA 3CPAA 1DTDA 4DNCA 1AUGA 2IJZA 1BAVA 3ISZA 2VBQA 1QMUA 1UFHA 4OC4A 3B3SA 3GUXA 4MXUA 5F46A 2C1CA 4OLLA 2GANA 4LQGA 4BINA 5KTAA 4MCPA 4J3GA 2DPTA 2QYVA 3RO0A 3PB4X 2XEJA 4R9MA 4F9VA 2ARHA 4P4EA 4UA3A 4KORA 2GLFA 4QVTA 4JWPA 4HNYB 2RC4A 4P4JA 2OH1A 4B14A 4CAFA 3B3TA 4AB7A 2Z3KA 3HLPA 4UEEA 4U9ZA 2Q7SA 2HV2A 2PVWA 4UFVA 4B5PB 1DE4C 2AFUA 2PJ6A 3JUWA 4JXQA 2JBKA 4NEXA 4P4BA 5A28A 2ZELA 3PZJA 4UEFA 4FD5A 1GHEA 1Z8LA 2ZEMA 4Y49B 3B8GA 4ZGYB 2PIZA
chains in the Genus database with same CATH topology
4NGPA 2V77A 1EE3P 3FJUA 2V8DA 3WABA 1YW6A 2V8VA 1TKJA 5LRKA 4NJQA 4F9UA 8CPAA 1GYTA 3K2KA 2IQ6A 4JZ0A 3B35A 3PFOA 4UF4A 5THWA 4BD9A 2V8HA 2PVVA 2F7VA 2HC9A 4GM5A 1BPNA 1QQ9A 5K8PA 2J9AA 2PJ3A 1IY7A 3SI0A 1AMPA 3SJXA 4P4DA 3FMCA 4PXDA 4A39A 5K8NA 2PJ4A 1R43A 4ZY1A 1HEEA 2PE3A 2WYRA 2O4HA 2PJ0A 3SI2A 3NA6A 4OC5A 1TXRA 1HDQA 1LCPA 2ZEOA 1XBUA 2XEFA 5I4MA 3FF3A 3GLJA 3H8GA 2BCOA 3IWWA 2CTCA 4UEZA 3S9LA 3KR4A 4Z65A 1ARLA 3IIBA 4P44A 6CPAA 5HVGA 4A94A 4P10A 4NGNA 4NGQA 1YSJA 4F8ZA 2JEWA 4OKOA 2ZEGA 4MCQA 3PBEA 4ZY2A 1ZLHA 3FH4A 3CT9A 2V8GA 3SI1A 2PJ8A 3K9TA 3KI9A 3L2NA 3KL9A 1F2PA 3PEIA 2ZEPA 2DEAA 2EK9A 3CPXA 5JH9A 2PJ5A 2VL1A 3JRUA 2EWBA 3TX8A 5CBMA 5LRJA 2NYQA 3SJGA 2G9DA 4A38A 2PJAA 4OC1A 3IEHA 2AFMA 4YU9A 3D7DA 3H8EA 1LFWA 2C6CA 3IJ3A 4NFRA 4H2KA 1M4LA 5DS0A 2GLJA 1CPXA 1ARMA 3KQZA 1VHOA 5JGFA 4PQAA 4X3RA 4ZY0A 1JQGA 2AFOA 1ZG7A 4G1PA 4UIBA 3WC6A 1CP7A 3FEEA 3FECA 4IAVA 3LWUA 4MCRA 1CG2A 2ZOFA 5LRGA 2O53A 3B3VA 3KHZA 2ZOGA 3VATA 4K3NA 7CPAA 4R8FA 4B6ZA 1LOKA 1YW4A 3N5FA 3FEDA 3RBUA 3PB7X 4P4FA 3IFEA 3D4UA 1HDUA 1CP6A 3V7ZA 2QVPA 2HB6A 5D29A 3D67A 4NJRA 4IHMA 4IK2A 4TWEA 3ISXA 3MRUA 2ABZA 2JBJA 5HXDA 1YLOA 2QJ8A 3NH8A 4NGRA 4DUKA 2AFZA 3IC1A 1CBXA 4EFDA 3H8FA 4FUUA 5D8NA 1ELMP 3S9MA 4OIDA 2NSMA 1VGYA 3D68A 5ELYA 4EWTA 1VIXA 3D7FA 5LYFA 5LYLA 4KSIA 1TKFA 3B2YA 1Q7LA 2BOAA 2AFXA 4OC3A 2C6PA 4MCSA 1LAPA 5JM6A 2PJ2A 1AYEA 1PCAA 1Y0YA 1CPSA 3WC5A 1ZG9A 5HVFA 2GU2A 2RB7A 3PB6X 1LANA 3SJEA 3NFZA 5LYIA 5LYDA 2PCUA 1Y0RA 4Q7AA 4R76A 3BI1A 1XJOA 2PJ7A 3KASA 4A37A 3VH9A 2XEGA 5HVHA 2BO9A 2RFHA 3B3CA 5IB9A 4FWUA 1F57A 3BI0A 2AFWA 1F2OA 2CTBA 1TKHA 4MMOA 4MHPA 4W9YA 3WT4A 3CDXA 4R7MA 4DJLA 4P4IA 2PJCA 2IMOA 3PBBA 1ZG8A 4JYWA 2FVGA 2C6GA 3B3WA 1LAMA 4P6YA 2ZEHA 3NH4A 4RUHA 3D7GA 2ANPA 4FBEA 4WWVA 4PPZA 2XEIA 3KHXA 3KZWA 1XMBA 2Q4ZA 3B7IA 1XFOA 1Z2LA 3MN8A 5K8OA 4P45A 1R3NA 4ONWA 3FVLA 4OMEA 1Z5RA 1FNOA 3RZAA 3V38A 1TF9A 1OBRA 4MHYA 5CPAA 3SJFA 4O23A 4PXEA 5J1QA 4EMEA 1H8LA 3GB0A 3S9NA 3I1UA 3WC7A 4NGTA 3HUVA 4ZYQA 5K8MA 1KWMA 2AFSA 2PJBA 4X8IA 1Y7EA 4YWYA 2CIJA 4OC0A 3PFEA 2OOTA 3RAMA 3PB9X 1IGBA 2Q51A 4DYOA 4OC2A 4NGMA 3LMSA 3T8WA 4TNUA 4ZX8A 2Q43A 4CPAA 3NH5A 3PRTA 3BHXA 1NSAA 2ZEDA 4MRIA 1TF8A 1PYTB 2PJ1A 4OIWA 3DGVA 1ELLP 1XRYA 1BPMA 2F8HA 3KGQA 2ZEEA 4X2TA 1BLLE 1ZLIA 2I3CA 3KR5A 2PIYA 2PJ9A 3KQXA 4MHNA 1FT7A 4ZI6A 2ZEFA 3IO1A 2POKA 2ZENA 3TC8A 3DLJA 4PXCA 4WJBA 4MHZA 4UIAA 3VARA 1RTQA 3FX6A 4FAIA 4ZX9A 3QNVA 3D66A 1CX8A 4R6TA 2EK8A 4AXVA 3BXMA 1VHEA 2OR4A 3PB8X 2GREA 2PRQA 2CF4A 5F09A 1UWYA 3D7HA 4OP4A 1YMEA 4PXBA 4NGSA 2WZNA 3CPAA 1DTDA 2IJZA 1BAVA 3ISZA 1QMUA 4OC4A 3B3SA 3GUXA 4MXUA 2C1CA 4LQGA 4MCPA 2QYVA 3PB4X 2XEJA 4F9VA 4P4EA 2GLFA 4P4JA 3B3TA 3HLPA 4UEEA 2PVWA 1DE4C 2AFUA 2PJ6A 4P4BA 2JBKA 2ZELA 4UEFA 1Z8LA 2ZEMA 2PIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NGP A;  2V77 A;  1EE3 P;  3FJU A;  2V8D A;  3WAB A;  1YW6 A;  2V8V A;  1TKJ A;  5LRK A;  4NJQ A;  4F9U A;  8CPA A;  1GYT A;  3K2K A;  2IQ6 A;  4JZ0 A;  3B35 A;  3PFO A;  4UF4 A;  5THW A;  4BD9 A;  2V8H A;  2PVV A;  2F7V A;  2HC9 A;  4GM5 A;  1BPN A;  1QQ9 A;  5K8P A;  2J9A A;  2PJ3 A;  1IY7 A;  3SI0 A;  1AMP A;  3SJX A;  4P4D A;  3FMC A;  4PXD A;  4A39 A;  5K8N A;  2PJ4 A;  1R43 A;  4ZY1 A;  1HEE A;  2PE3 A;  2WYR A;  2O4H A;  2PJ0 A;  3SI2 A;  3NA6 A;  4OC5 A;  1TXR A;  1HDQ A;  1LCP A;  2ZEO A;  1XBU A;  2XEF A;  5I4M A;  3FF3 A;  3GLJ A;  3H8G A;  2BCO A;  3IWW A;  2CTC A;  4UEZ A;  3S9L A;  3KR4 A;  4Z65 A;  1ARL A;  3IIB A;  4P44 A;  6CPA A;  5HVG A;  4A94 A;  4P10 A;  4NGN A;  4NGQ A;  1YSJ A;  4F8Z A;  2JEW A;  4OKO A;  2ZEG A;  4MCQ A;  3PBE A;  4ZY2 A;  1ZLH A;  3FH4 A;  3CT9 A;  2V8G A;  3SI1 A;  2PJ8 A;  3K9T A;  3KI9 A;  3L2N A;  3KL9 A;  1F2P A;  3PEI A;  2ZEP A;  2DEA A;  2EK9 A;  3CPX A;  5JH9 A;  2PJ5 A;  2VL1 A;  3JRU A;  2EWB A;  3TX8 A;  5CBM A;  5LRJ A;  2NYQ A;  3SJG A;  2G9D A;  4A38 A;  2PJA A;  4OC1 A;  3IEH A;  2AFM A;  4YU9 A;  3D7D A;  3H8E A;  1LFW A;  2C6C A;  3IJ3 A;  4NFR A;  4H2K A;  1M4L A;  5DS0 A;  2GLJ A;  1CPX A;  1ARM A;  3KQZ A;  1VHO A;  5JGF A;  4PQA A;  4X3R A;  4ZY0 A;  1JQG A;  2AFO A;  1ZG7 A;  4G1P A;  4UIB A;  3WC6 A;  1CP7 A;  3FEE A;  3FEC A;  4IAV A;  3LWU A;  4MCR A;  1CG2 A;  2ZOF A;  5LRG A;  2O53 A;  3B3V A;  3KHZ A;  2ZOG A;  3VAT A;  4K3N A;  7CPA A;  4R8F A;  4B6Z A;  1LOK A;  1YW4 A;  3N5F A;  3FED A;  3RBU A;  3PB7 X;  4P4F A;  3IFE A;  3D4U A;  1HDU A;  1CP6 A;  3V7Z A;  2QVP A;  2HB6 A;  5D29 A;  3D67 A;  4NJR A;  4IHM A;  4IK2 A;  4TWE A;  3ISX A;  3MRU A;  2ABZ A;  2JBJ A;  5HXD A;  1YLO A;  2QJ8 A;  3NH8 A;  4NGR A;  4DUK A;  2AFZ A;  3IC1 A;  1CBX A;  4EFD A;  3H8F A;  4FUU A;  5D8N A;  1ELM P;  3S9M A;  4OID A;  2NSM A;  1VGY A;  3D68 A;  5ELY A;  4EWT A;  1VIX A;  3D7F A;  5LYF A;  5LYL A;  4KSI A;  1TKF A;  3B2Y A;  1Q7L A;  2BOA A;  2AFX A;  4OC3 A;  2C6P A;  4MCS A;  1LAP A;  5JM6 A;  2PJ2 A;  1AYE A;  1PCA A;  1Y0Y A;  1CPS A;  3WC5 A;  1ZG9 A;  5HVF A;  2GU2 A;  2RB7 A;  3PB6 X;  1LAN A;  3SJE A;  3NFZ A;  5LYI A;  5LYD A;  2PCU A;  1Y0R A;  4Q7A A;  4R76 A;  3BI1 A;  1XJO A;  2PJ7 A;  3KAS A;  4A37 A;  3VH9 A;  2XEG A;  5HVH A;  2BO9 A;  2RFH A;  3B3C A;  5IB9 A;  4FWU A;  1F57 A;  3BI0 A;  2AFW A;  1F2O A;  2CTB A;  1TKH A;  4MMO A;  4MHP A;  4W9Y A;  3WT4 A;  3CDX A;  4R7M A;  4DJL A;  4P4I A;  2PJC A;  2IMO A;  3PBB A;  1ZG8 A;  4JYW A;  2FVG A;  2C6G A;  3B3W A;  1LAM A;  4P6Y A;  2ZEH A;  3NH4 A;  4RUH A;  3D7G A;  2ANP A;  4FBE A;  4WWV A;  4PPZ A;  2XEI A;  3KHX A;  3KZW A;  1XMB A;  2Q4Z A;  3B7I A;  1XFO A;  1Z2L A;  3MN8 A;  5K8O A;  4P45 A;  1R3N A;  4ONW A;  3FVL A;  4OME A;  1Z5R A;  1FNO A;  3RZA A;  3V38 A;  1TF9 A;  1OBR A;  4MHY A;  5CPA A;  3SJF A;  4O23 A;  4PXE A;  5J1Q A;  4EME A;  1H8L A;  3GB0 A;  3S9N A;  3I1U A;  3WC7 A;  4NGT A;  3HUV A;  4ZYQ A;  5K8M A;  1KWM A;  2AFS A;  2PJB A;  4X8I A;  1Y7E A;  4YWY A;  2CIJ A;  4OC0 A;  3PFE A;  2OOT A;  3RAM A;  3PB9 X;  1IGB A;  2Q51 A;  4DYO A;  4OC2 A;  4NGM A;  3LMS A;  3T8W A;  4TNU A;  4ZX8 A;  2Q43 A;  4CPA A;  3NH5 A;  3PRT A;  3BHX A;  1NSA A;  2ZED A;  4MRI A;  1TF8 A;  1PYT B;  2PJ1 A;  4OIW A;  3DGV A;  1ELL P;  1XRY A;  1BPM A;  2F8H A;  3KGQ A;  2ZEE A;  4X2T A;  1BLL E;  1ZLI A;  2I3C A;  3KR5 A;  2PIY A;  2PJ9 A;  3KQX A;  4MHN A;  1FT7 A;  4ZI6 A;  2ZEF A;  3IO1 A;  2POK A;  2ZEN A;  3TC8 A;  3DLJ A;  4PXC A;  4WJB A;  4MHZ A;  4UIA A;  3VAR A;  1RTQ A;  3FX6 A;  4FAI A;  4ZX9 A;  3QNV A;  3D66 A;  1CX8 A;  4R6T A;  2EK8 A;  4AXV A;  3BXM A;  1VHE A;  2OR4 A;  3PB8 X;  2GRE A;  2PRQ A;  2CF4 A;  5F09 A;  1UWY A;  3D7H A;  4OP4 A;  1YME A;  4PXB A;  4NGS A;  2WZN A;  3CPA A;  1DTD A;  2IJZ A;  1BAV A;  3ISZ A;  1QMU A;  4OC4 A;  3B3S A;  3GUX A;  4MXU A;  2C1C A;  4LQG A;  4MCP A;  2QYV A;  3PB4 X;  2XEJ A;  4F9V A;  4P4E A;  2GLF A;  4P4J A;  3B3T A;  3HLP A;  4UEE A;  2PVW A;  1DE4 C;  2AFU A;  2PJ6 A;  4P4B A;  2JBK A;  2ZEL A;  4UEF A;  1Z8L A;  2ZEM A;  2PIZ A; 
#chains in the Genus database with same CATH topology
 2VI7 A;  2JDC A;  1YRE A;  2V77 A;  1EE3 P;  4NGP A;  4MFQ A;  3EFA A;  2R98 A;  3FJU A;  5BWA B;  4LUA A;  4LX9 A;  5AG5 A;  3GKR A;  5I0C A;  4FD7 A;  5H84 A;  2V8D A;  3LOD A;  3WAB A;  1YW6 A;  4CAW A;  4A31 A;  2V8V A;  4CRY B;  1TKJ A;  4NF1 A;  3CXQ A;  5LRK A;  4NJQ A;  4U5Y A;  4F9U A;  3F8K A;  8CPA A;  4UCN A;  1GYT A;  1Z8X A;  1MJ9 A;  3K2K A;  3R1K A;  2IQ6 A;  4KOT A;  1IID A;  4JZ0 A;  2H5M A;  3B35 A;  3PFO A;  2Y0M A;  4UF4 A;  2Z3O A;  5THW A;  4BD9 A;  3EXN A;  4X5K A;  2HQY A;  1S3Z A;  2HUZ A;  4XPK A;  2V8H A;  2PVV A;  2NMT A;  2F7V A;  2Q4Y A;  2HC9 A;  3JVN A;  1Z8W A;  5ISV A;  4GM5 A;  2GFQ A;  4AG7 A;  1BPN A;  1QQ9 A;  1Q2C A;  5K8P A;  4B13 A;  2J9A A;  2PJ3 A;  1IY7 A;  1I1D A;  5GCN A;  4UFW A;  1SQH A;  3SI0 A;  1AMP A;  1QST A;  3SJX A;  2DF5 A;  2WUU A;  4KOV A;  4MFP A;  3CXP A;  3FMC A;  3PGP A;  4P4D A;  4PXD A;  4MBU A;  4A39 A;  5K8N A;  2PJ4 A;  1R43 A;  1M44 A;  4ZY1 A;  1HEE A;  2PE3 A;  2Z3M A;  4QUS A;  2WYR A;  3SHP A;  3R9F A;  5C88 A;  2J8N A;  4UWJ A;  2ZPA A;  2O4H A;  4YRH A;  2PJ0 A;  3SI2 A;  3TCV A;  1Y9K A;  3NA6 A;  4OC5 A;  5J8C A;  1TXR A;  1HDQ A;  1LCP A;  1Z4R A;  2ZEO A;  5IX3 A;  1IOF A;  4HNW B;  1XBU A;  4NSQ A;  2XEF A;  4OAE A;  5I4M A;  3FF3 A;  4MI4 A;  3GLJ A;  2I79 A;  3H8G A;  3KKW A;  2BCO A;  4CGP A;  1IYL A;  3IWW A;  2CTC A;  2P0W A;  2FL4 A;  4HKF A;  1ZO0 A;  1QSM A;  4UEZ A;  3G3S A;  3S9L A;  3KR4 A;  2ODF A;  4M3S A;  2PRB A;  4Z65 A;  1ARL A;  1B87 A;  3IIB A;  4P44 A;  6CPA A;  5HVG A;  4A94 A;  4P10 A;  4NGN A;  4A30 A;  3R96 A;  1A2Z A;  4RI1 A;  4NGQ A;  1YSJ A;  3IWE A;  3S6F A;  4F8Z A;  4AVC A;  2JEW A;  3BJ8 A;  1JWQ A;  3H4Q A;  2ZEG A;  4OKO A;  1YX0 A;  4MCQ A;  5EMI A;  3PBE A;  4ZBG A;  5E96 A;  4ZY2 A;  1KZF A;  1ZLH A;  3FH4 A;  2B4D B;  5J8F A;  1IB1 E;  3CT9 A;  5F48 A;  2V8G A;  3SI1 A;  4KS9 A;  4YFJ A;  2PJ8 A;  5JQ4 A;  1J4J A;  4CYP A;  1U6M A;  3DSB A;  5G20 A;  3K9T A;  4UCM A;  3VWD A;  2JLM A;  3KI9 A;  3L2N A;  3KL9 A;  1M4I A;  2ZW5 A;  3DDD A;  1R57 A;  1F2P A;  3PEI A;  2BEI A;  2QIR A;  2B5G B;  2ZEP A;  2DEA A;  2EK9 A;  3CPX A;  4KOW A;  5JH9 A;  2PJ5 A;  4IUS A;  2VL1 A;  1S7L A;  3JRU A;  2EWB A;  4EVY A;  3TX8 A;  1S60 A;  4LQ6 A;  4M6G A;  5CBM A;  1YLE A;  2CXA A;  5LRJ A;  2NYQ A;  4B5O A;  3SJG A;  2G9D A;  2EUI A;  3I9S A;  2G3T A;  2I00 A;  2PJA A;  4OC1 A;  3IEH A;  4A38 A;  2AFM A;  4YU9 A;  4JLY A;  3D7D A;  4UBR A;  4CGO A;  5IB0 A;  4ORF A;  4CGN A;  2ZXV A;  3H8E A;  1LFW A;  3K9U A;  2C6C A;  3IJ3 A;  1X12 A;  4NFR A;  4MFZ A;  4XNH C;  4GS4 A;  4H2K A;  2D4O A;  5AG6 A;  3T90 A;  1M4L A;  5DS0 A;  2GLJ A;  3SXN A;  3P2F A;  1CPX A;  4E2A A;  1ARM A;  3KQZ A;  2IL4 A;  1Q2D A;  1VHO A;  4R3K A;  5JGF A;  3EY5 A;  4KUA A;  2B4B A;  4PQA A;  2K5T A;  4X3R A;  4A33 A;  1Q2Y A;  4ZY0 A;  1JQG A;  2AFO A;  4AG9 A;  1ZG7 A;  4KOY A;  4G1P A;  4UIB A;  4QC6 A;  3WC6 A;  4B11 A;  5DWN A;  3FB3 A;  4ONU A;  1CP7 A;  4U9Y A;  2FXF A;  3FEE A;  1B6B A;  3FEC A;  4B12 A;  1WK4 A;  4IAV A;  4KSA A;  3LWU A;  4MCR A;  1CG2 A;  2F5I A;  5CNP A;  4CGM A;  4Q36 A;  5C82 A;  2ZOF A;  4H6U A;  5F49 A;  5LRG A;  2O53 A;  3NE8 A;  3B3V A;  1Y9W A;  2R1I A;  2ZOG A;  3KHZ A;  4KOX A;  3VAT A;  1YR0 A;  4K3N A;  7CPA A;  1OZP A;  1V0C A;  4CYO A;  4R8F A;  2YNC C;  4KLW A;  3N7Z A;  4KSF A;  4PSX A;  4BMH A;  3FBU A;  4KOU A;  4B6Z A;  1LOK A;  1YW4 A;  3GYA A;  3N5F A;  4NCZ A;  2AJ6 A;  2ZW7 A;  3SXO A;  3FED A;  2VZZ A;  4JXR A;  2Q7B A;  3RBU A;  3PB7 X;  4P4F A;  1BO4 A;  3IFE A;  4CGL A;  3D4U A;  4K30 A;  2OZG A;  3RYO A;  2CNM A;  1HDU A;  4C68 A;  1M4G A;  2DXQ A;  1CP6 A;  5G22 A;  4QBJ A;  3V7Z A;  2QVP A;  1KUY A;  2HB6 A;  4XPD C;  5D29 A;  3WR7 A;  3D67 A;  4Q38 A;  2YND A;  4NJR A;  4IHM A;  4IK2 A;  4TWE A;  1S5K A;  3D2M A;  1XEB A;  4MY3 A;  2DPS A;  3ISX A;  4L8A A;  3MRU A;  2ABZ A;  1N71 A;  2JBJ A;  3TOB A;  2FS5 A;  5HXD A;  1YLO A;  4AVB A;  2QJ8 A;  3IGR A;  3NH8 A;  4NGR A;  3R9E A;  4DUK A;  2AFZ A;  2G3A A;  3IC1 A;  1CBX A;  4EFD A;  3V8I A;  3FXT A;  3H8F A;  5F47 A;  4CAE A;  4FUU A;  4A2Z A;  2PR8 A;  1ELM P;  5D8N A;  3S9M A;  4OID A;  2Q04 A;  2NSM A;  1VGY A;  2PR1 A;  3D68 A;  4KUB A;  1KUV A;  5ELY A;  4CYQ A;  3NE7 A;  4EWT A;  1VIX A;  3D7F A;  1RO5 A;  5LYF A;  5LYL A;  4OAD A;  3BLN A;  4JD6 A;  4KSI A;  1TKF A;  1L0C A;  5AG7 A;  5AG4 A;  2OB0 A;  3B2Y A;  1BOB A;  5HMN A;  1FY7 A;  1Q7L A;  2BOA A;  3R95 A;  2AFX A;  4C2Z A;  1NE9 A;  4OC3 A;  2C6P A;  4MCS A;  4PK3 A;  1LAP A;  5JM6 A;  1NMT A;  4C2X A;  2PJ2 A;  1AYE A;  4KVO E;  1PCA A;  3D8P A;  4KLV A;  1Y0Y A;  3TOA A;  1CPS A;  3WC5 A;  4CS0 B;  4CYN A;  1ZG9 A;  2D4P A;  2GU2 A;  2RB7 A;  1S7K A;  3PB6 X;  5HVF A;  4B10 A;  2QML A;  1LAN A;  1RXT A;  3SJE A;  1QSO A;  3NFZ A;  3TO7 A;  4F0X A;  5LYI A;  2REE A;  5LYD A;  5EC4 A;  3FIX A;  2PCU A;  3FNC A;  3E0K A;  1Y0R A;  4Q7A A;  3IU1 A;  4R76 A;  2P6G A;  3BI1 A;  3QAH A;  1XJO A;  4IF5 A;  2Q4V A;  2X7B A;  4UCP A;  1CM0 A;  2B3U A;  2KCW A;  4AVA A;  1TIQ A;  2PJ7 A;  3DR6 A;  3KAS A;  1YK3 A;  1P4N A;  4A37 A;  4R3L A;  3VH9 A;  2GIV A;  3W91 A;  2XEG A;  5HVH A;  1IOI A;  1YGH A;  4E0A A;  1Y7R A;  2BO9 A;  4R57 A;  2RFH A;  3B3C A;  2Z10 A;  5IB9 A;  2Z3L A;  1MJB A;  4FWU A;  4Y49 C;  3W6X A;  1F57 A;  2EBJ A;  3BI0 A;  2AFW A;  1F2O A;  2GE3 A;  3BJ7 A;  2CTB A;  4MJ8 A;  2Z0Z A;  4L89 A;  1I21 A;  1I12 A;  3DR8 A;  1TKH A;  4MMO A;  1YVK A;  2G0B A;  2PQ8 A;  4M85 A;  5KTD A;  2FE7 A;  4MHP A;  4W9Y A;  3WT4 A;  3CDX A;  4R7M A;  4CAX A;  4DJL A;  4P4I A;  5G21 A;  2PJC A;  2IMO A;  2B3V A;  3PBB A;  4A95 A;  1WWZ A;  1ZG8 A;  4JYW A;  4XPL A;  3DNS A;  3T9Y A;  2FVG A;  2C6G A;  3EC4 A;  3GIU A;  3B3W A;  4H6Z A;  3H5Z A;  1XMT A;  2AE6 A;  2Z3P A;  1Z9U A;  1LAM A;  4KZT A;  1IU8 A;  4P6Y A;  4YGO A;  4MHD A;  2ZEH A;  4M6H A;  3NH4 A;  3W6S A;  4KOS A;  4PV6 A;  3TE4 A;  2FSR A;  2OZH A;  4RUH A;  2VQY A;  3D7G A;  1XE4 A;  2ANP A;  1LRZ A;  4FBE A;  4WWV A;  4RS2 A;  5G1Z A;  4M6I A;  2XEI A;  3KHX A;  3KZW A;  4PPZ A;  5A27 A;  4MY0 A;  1XIX A;  1XMB A;  3ZJ0 A;  3ZZI A;  4B5P A;  4PK2 A;  1NSL A;  4NXY A;  2Q4Z A;  2J8R A;  4KVM E;  3B7I A;  4GXH A;  2JDD A;  1S7F A;  1XFO A;  1Z2L A;  3MN8 A;  5K8O A;  3TT2 A;  3A9L A;  4P45 A;  1R3N A;  4ONW A;  4MFL A;  4H89 A;  4UWI A;  4XNH B;  4II9 A;  1MK4 A;  1M4D A;  5FVJ A;  2R8V A;  3FVL A;  4OME A;  1Z5R A;  2WPX A;  1FNO A;  3RZA A;  3S6K A;  4CAV A;  3V38 A;  1TF9 A;  4FD4 A;  1OBR A;  3I3G A;  3JTK A;  4MHY A;  5CPA A;  1VHS A;  3SJF A;  4O23 A;  2O28 A;  4PXE A;  5J1Q A;  2Z11 A;  2B58 A;  2WPW A;  3S6H A;  3FRM A;  3QB8 A;  2FIA A;  5EBV A;  4EME A;  1M1D A;  2ATR A;  2BUE A;  2PSW A;  1X10 A;  1H8L A;  2P6F A;  4HPS A;  3D3S A;  4R87 A;  4C7I A;  2VXK A;  3GB0 A;  3S9N A;  3I1U A;  3WC7 A;  3HUV A;  4NGT A;  4ZYQ A;  5K8M A;  1KWM A;  2AFS A;  2PJB A;  4X8I A;  1Y7E A;  1Z4E A;  4YWY A;  3G8W A;  2Z3N A;  1ON0 A;  4HNX B;  2JEV A;  4QB9 A;  2REF A;  3OWC A;  2A4N A;  4KVX A;  2CIJ A;  4OC0 A;  2WSA A;  5KTC A;  3C26 A;  2OZU A;  3PFE A;  2OOT A;  3RAM A;  3PB9 X;  4I49 A;  4PSW A;  1IGB A;  2Q51 A;  2YNC A;  1QSN A;  4DYO A;  4OC2 A;  4NGM A;  3TO9 A;  1VKC A;  3LMS A;  2ZW4 A;  3T8W A;  2Q0Y A;  4TNU A;  4ZX8 A;  2ZW6 A;  2Q43 A;  4CPA A;  1Z8T A;  1S7N A;  2C27 A;  3NH5 A;  2CY2 A;  3EO4 A;  3PRT A;  3S6G A;  3UY5 A;  2FT0 A;  3BHX A;  5DWM A;  2EVN A;  2R7H A;  1NSA A;  3D2P A;  2OU2 A;  3TFY A;  2ZED A;  1YQE A;  2EO8 A;  3GY9 A;  4XPD B;  4MRI A;  1TF8 A;  1PYT B;  2FIW A;  2PJ1 A;  2VZY A;  5IV0 A;  2BSW A;  4OIW A;  3DGV A;  1IYK A;  1ELL P;  1XRY A;  3MGD A;  1BPM A;  2F8H A;  5AGE A;  3CXS A;  3KGQ A;  1P0H A;  2ZEE A;  4X2T A;  3RNZ A;  1BLL E;  1ZLI A;  2I3C A;  3KR5 A;  2CNS A;  1K4J A;  1YVO A;  2PIY A;  4JJX A;  1XOV A;  2PJ9 A;  3CZX A;  4A32 A;  3F5B A;  3KQX A;  4MHN A;  1FT7 A;  4ZI6 A;  1KUX A;  1CJW A;  5HH1 A;  2J8M A;  4E8O A;  2BL1 A;  2ZEF A;  3IO1 A;  2POK A;  3R9G A;  3VWE A;  2ZEN A;  3TC8 A;  2PDO A;  3DLJ A;  4PXC A;  4F0Y A;  2YGW A;  4WJB A;  4MHZ A;  4UIA A;  3VAR A;  1RTQ A;  2FCK A;  3FX6 A;  4FAI A;  1PU9 A;  2PC1 A;  1PUA A;  3QNV A;  3D66 A;  1CX8 A;  4ZX9 A;  4BBH A;  1IIC A;  4MFJ A;  2VEZ A;  4R6T A;  2B4D A;  2EK8 A;  5JPH A;  4AXV A;  4C7H A;  3BXM A;  2QEC A;  4RN7 A;  1VHE A;  4UFX A;  2Q44 A;  3TTH A;  3FYN A;  2CNT A;  2OR4 A;  3PB8 X;  5H86 A;  4C2Y A;  1QSR A;  2GRE A;  3QAY A;  3LD2 A;  4F6A A;  3IU2 A;  2B5G A;  4FD6 A;  1XF8 A;  3LAC A;  2PRQ A;  2P6E A;  2CF4 A;  3F0A A;  3IWG A;  3P2H A;  3PP9 A;  4MFK A;  1UWY A;  5F09 A;  3D7H A;  3TO6 A;  1MJA A;  2YNE A;  1YME A;  4OP4 A;  4PXB A;  4CRZ B;  4NGS A;  2WZN A;  3CPA A;  1DTD A;  4DNC A;  1AUG A;  2IJZ A;  1BAV A;  3ISZ A;  2VBQ A;  1QMU A;  1UFH A;  4OC4 A;  3B3S A;  3GUX A;  4MXU A;  5F46 A;  2C1C A;  4OLL A;  2GAN A;  4LQG A;  4BIN A;  5KTA A;  4MCP A;  4J3G A;  2DPT A;  2QYV A;  3RO0 A;  3PB4 X;  2XEJ A;  4R9M A;  4F9V A;  2ARH A;  4P4E A;  4UA3 A;  4KOR A;  2GLF A;  4QVT A;  4JWP A;  4HNY B;  2RC4 A;  4P4J A;  2OH1 A;  4B14 A;  4CAF A;  3B3T A;  4AB7 A;  2Z3K A;  3HLP A;  4UEE A;  4U9Z A;  2Q7S A;  2HV2 A;  2PVW A;  4UFV A;  4B5P B;  1DE4 C;  2AFU A;  2PJ6 A;  3JUW A;  4JXQ A;  2JBK A;  4NEX A;  4P4B A;  5A28 A;  2ZEL A;  3PZJ A;  4UEF A;  4FD5 A;  1GHE A;  1Z8L A;  2ZEM A;  4Y49 B;  3B8G A;  4ZGY B;  2PIZ A; 
#chains in the Genus database with same CATH homology
 4NGP A;  2V77 A;  1EE3 P;  3FJU A;  2V8D A;  3WAB A;  1YW6 A;  2V8V A;  1TKJ A;  5LRK A;  4NJQ A;  4F9U A;  8CPA A;  1GYT A;  3K2K A;  2IQ6 A;  4JZ0 A;  3B35 A;  3PFO A;  4UF4 A;  5THW A;  4BD9 A;  2V8H A;  2PVV A;  2F7V A;  2HC9 A;  4GM5 A;  1BPN A;  1QQ9 A;  5K8P A;  2J9A A;  2PJ3 A;  1IY7 A;  3SI0 A;  1AMP A;  3SJX A;  4P4D A;  3FMC A;  4PXD A;  4A39 A;  5K8N A;  2PJ4 A;  1R43 A;  4ZY1 A;  1HEE A;  2PE3 A;  2WYR A;  2O4H A;  2PJ0 A;  3SI2 A;  3NA6 A;  4OC5 A;  1TXR A;  1HDQ A;  1LCP A;  2ZEO A;  1XBU A;  2XEF A;  5I4M A;  3FF3 A;  3GLJ A;  3H8G A;  2BCO A;  3IWW A;  2CTC A;  4UEZ A;  3S9L A;  3KR4 A;  4Z65 A;  1ARL A;  3IIB A;  4P44 A;  6CPA A;  5HVG A;  4A94 A;  4P10 A;  4NGN A;  4NGQ A;  1YSJ A;  4F8Z A;  2JEW A;  4OKO A;  2ZEG A;  4MCQ A;  3PBE A;  4ZY2 A;  1ZLH A;  3FH4 A;  3CT9 A;  2V8G A;  3SI1 A;  2PJ8 A;  3K9T A;  3KI9 A;  3L2N A;  3KL9 A;  1F2P A;  3PEI A;  2ZEP A;  2DEA A;  2EK9 A;  3CPX A;  5JH9 A;  2PJ5 A;  2VL1 A;  3JRU A;  2EWB A;  3TX8 A;  5CBM A;  5LRJ A;  2NYQ A;  3SJG A;  2G9D A;  4A38 A;  2PJA A;  4OC1 A;  3IEH A;  2AFM A;  4YU9 A;  3D7D A;  3H8E A;  1LFW A;  2C6C A;  3IJ3 A;  4NFR A;  4H2K A;  1M4L A;  5DS0 A;  2GLJ A;  1CPX A;  1ARM A;  3KQZ A;  1VHO A;  5JGF A;  4PQA A;  4X3R A;  4ZY0 A;  1JQG A;  2AFO A;  1ZG7 A;  4G1P A;  4UIB A;  3WC6 A;  1CP7 A;  3FEE A;  3FEC A;  4IAV A;  3LWU A;  4MCR A;  1CG2 A;  2ZOF A;  5LRG A;  2O53 A;  3B3V A;  3KHZ A;  2ZOG A;  3VAT A;  4K3N A;  7CPA A;  4R8F A;  4B6Z A;  1LOK A;  1YW4 A;  3N5F A;  3FED A;  3RBU A;  3PB7 X;  4P4F A;  3IFE A;  3D4U A;  1HDU A;  1CP6 A;  3V7Z A;  2QVP A;  2HB6 A;  5D29 A;  3D67 A;  4NJR A;  4IHM A;  4IK2 A;  4TWE A;  3ISX A;  3MRU A;  2ABZ A;  2JBJ A;  5HXD A;  1YLO A;  2QJ8 A;  3NH8 A;  4NGR A;  4DUK A;  2AFZ A;  3IC1 A;  1CBX A;  4EFD A;  3H8F A;  4FUU A;  5D8N A;  1ELM P;  3S9M A;  4OID A;  2NSM A;  1VGY A;  3D68 A;  5ELY A;  4EWT A;  1VIX A;  3D7F A;  5LYF A;  5LYL A;  4KSI A;  1TKF A;  3B2Y A;  1Q7L A;  2BOA A;  2AFX A;  4OC3 A;  2C6P A;  4MCS A;  1LAP A;  5JM6 A;  2PJ2 A;  1AYE A;  1PCA A;  1Y0Y A;  1CPS A;  3WC5 A;  1ZG9 A;  5HVF A;  2GU2 A;  2RB7 A;  3PB6 X;  1LAN A;  3SJE A;  3NFZ A;  5LYI A;  5LYD A;  2PCU A;  1Y0R A;  4Q7A A;  4R76 A;  3BI1 A;  1XJO A;  2PJ7 A;  3KAS A;  4A37 A;  3VH9 A;  2XEG A;  5HVH A;  2BO9 A;  2RFH A;  3B3C A;  5IB9 A;  4FWU A;  1F57 A;  3BI0 A;  2AFW A;  1F2O A;  2CTB A;  1TKH A;  4MMO A;  4MHP A;  4W9Y A;  3WT4 A;  3CDX A;  4R7M A;  4DJL A;  4P4I A;  2PJC A;  2IMO A;  3PBB A;  1ZG8 A;  4JYW A;  2FVG A;  2C6G A;  3B3W A;  1LAM A;  4P6Y A;  2ZEH A;  3NH4 A;  4RUH A;  3D7G A;  2ANP A;  4FBE A;  4WWV A;  4PPZ A;  2XEI A;  3KHX A;  3KZW A;  1XMB A;  2Q4Z A;  3B7I A;  1XFO A;  1Z2L A;  3MN8 A;  5K8O A;  4P45 A;  1R3N A;  4ONW A;  3FVL A;  4OME A;  1Z5R A;  1FNO A;  3RZA A;  3V38 A;  1TF9 A;  1OBR A;  4MHY A;  5CPA A;  3SJF A;  4O23 A;  4PXE A;  5J1Q A;  4EME A;  1H8L A;  3GB0 A;  3S9N A;  3I1U A;  3WC7 A;  4NGT A;  3HUV A;  4ZYQ A;  5K8M A;  1KWM A;  2AFS A;  2PJB A;  4X8I A;  1Y7E A;  4YWY A;  2CIJ A;  4OC0 A;  3PFE A;  2OOT A;  3RAM A;  3PB9 X;  1IGB A;  2Q51 A;  4DYO A;  4OC2 A;  4NGM A;  3LMS A;  3T8W A;  4TNU A;  4ZX8 A;  2Q43 A;  4CPA A;  3NH5 A;  3PRT A;  3BHX A;  1NSA A;  2ZED A;  4MRI A;  1TF8 A;  1PYT B;  2PJ1 A;  4OIW A;  3DGV A;  1ELL P;  1XRY A;  1BPM A;  2F8H A;  3KGQ A;  2ZEE A;  4X2T A;  1BLL E;  1ZLI A;  2I3C A;  3KR5 A;  2PIY A;  2PJ9 A;  3KQX A;  4MHN A;  1FT7 A;  4ZI6 A;  2ZEF A;  3IO1 A;  2POK A;  2ZEN A;  3TC8 A;  3DLJ A;  4PXC A;  4WJB A;  4MHZ A;  4UIA A;  3VAR A;  1RTQ A;  3FX6 A;  4FAI A;  4ZX9 A;  3QNV A;  3D66 A;  1CX8 A;  4R6T A;  2EK8 A;  4AXV A;  3BXM A;  1VHE A;  2OR4 A;  3PB8 X;  2GRE A;  2PRQ A;  2CF4 A;  5F09 A;  1UWY A;  3D7H A;  4OP4 A;  1YME A;  4PXB A;  4NGS A;  2WZN A;  3CPA A;  1DTD A;  2IJZ A;  1BAV A;  3ISZ A;  1QMU A;  4OC4 A;  3B3S A;  3GUX A;  4MXU A;  2C1C A;  4LQG A;  4MCP A;  2QYV A;  3PB4 X;  2XEJ A;  4F9V A;  4P4E A;  2GLF A;  4P4J A;  3B3T A;  3HLP A;  4UEE A;  2PVW A;  1DE4 C;  2AFU A;  2PJ6 A;  4P4B A;  2JBK A;  2ZEL A;  4UEF A;  1Z8L A;  2ZEM A;  2PIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...