2AFXA

Crystal structure of human glutaminyl cyclase in complex with 1-benzylimidazole
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title Crystal structures of human glutaminyl cyclase, an enzyme responsible for protein N-terminal pyroglutamate formation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 110
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2afxA00
2Q51A 4H2KA 5THWA 4FBEA 3SI1A 1ZG8A 1TKHA 2GLFA 1TF9A 4OC3A 3B3TA 3CDXA 4FWUA 5DS0A 4PXCA 7CPAA 1BAVA 3WABA 4MXUA 2PIZA 4A94A 2PJ2A 2PJ1A 2PE3A 1VGYA 2V8GA 5LYLA 3B3CA 4WWVA 2C1CA 4P4EA 4A39A 3KQXA 4ZI6A 3KHZA 1TXRA 4KSIA 4B6ZA 3KI9A 2ZEGA 5I4MA 5LRJA 4ZX8A 4K3NA 1XBUA 2BO9A 2PJ6A 4A37A 1R43A 2AFUA 3KR4A 3PFOA 2V8DA 3KL9A 1H8LA 4DUKA 1AYEA 2RFHA 1BPNA 1LCPA 3FJUA 1Y7EA 1YW4A 4ZYQA 4P10A 1ZLIA 2VL1A 3BI1A 3NH5A 1DE4C 3KQZA 4JZ0A 2PJAA 4UIBA 2BOAA 2F8HA 4P44A 4A38A 3N5FA 2O53A 1Q7LA 2AFWA 3CT9A 2O4HA 2AFSA 1F2PA 1CPXA 2C6CA 3IJ3A 4P4JA 2AFZA 2IJZA 3FF3A 4JYWA 3VATA 4OIDA 4ZX9A 2PRQA 3FH4A 1ELMP 3JRUA 3FECA 4GM5A 3IIBA 3NH8A 3WC7A 1VIXA 3PB7X 3NFZA 3LMSA 4MRIA 2IQ6A 3NA6A 4NGNA 5K8NA 1FT7A 4DJLA 2GREA 3QNVA 1LFWA 4MCSA 1ZLHA 5LRGA 4TWEA 4FAIA 3IWWA 3SI2A 1CPSA 3FX6A 3PB9X 4EWTA 3H8EA 3SI0A 3D66A 1F57A 4MCPA 3WC5A 1FNOA 2AFXA 5K8MA 2PIYA 4P6YA 2PJCA 2ZEDA 3FMCA 1KWMA 2OR4A 1JQGA 4P45A 1LAPA 2BCOA 2ZEEA 3S9NA 1XJOA 5JH9A 3KGQA 2ZEHA 5ELYA 1XFOA 2CIJA 4MCRA 3FEEA 2DEAA 2AFMA 3GB0A 8CPAA 2V77A 3B35A 1ZG9A 3V38A 3ISXA 4NGTA 3IO1A 4OMEA 4P4IA 5K8PA 2I3CA 2HB6A 2WZNA 5K8OA 2ZOFA 4DYOA 5F09A 4Z65A 1UWYA 1Y0RA 2EK8A 4OC4A 1LANA 3D7HA 2HC9A 1CP7A 2ZELA 5CBMA 3D4UA 5IB9A 3H8GA 2PJ0A 1TKFA 5CPAA 1XMBA 4F9UA 1ARLA 4ZY0A 3TX8A 2JBJA 3PBEA 1IY7A 2PVWA 3SJGA 4MHYA 1CG2A 2ZEPA 3FVLA 4P4DA 1ZG7A 3PB8X 2PJ5A 3BXMA 3I1UA 2PJ7A 4PXEA 4R7MA 4ZY1A 1LOKA 2XEJA 4UEFA 3IC1A 4MHNA 3PRTA 2XEGA 4NGPA 2POKA 3KASA 3PBBA 3MRUA 1YLOA 4PXBA 1VHEA 3D7FA 1TF8A 1Z2LA 2Q43A 3D7GA 3HUVA 4EFDA 2ZEMA 4MCQA 5D29A 3RAMA 2G9DA 4UF4A 2J9AA 1TKJA 1Z8LA 1GYTA 1BPMA 2JBKA 4OC2A 2PCUA 3FEDA 3VH9A 3VARA 3L2NA 3SJXA 4X3RA 5HVFA 2NSMA 1HDUA 4PXDA 1CX8A 4F9VA 1QMUA 4X2TA 5LYDA 2AFOA 3GLJA 4MHZA 4P4BA 2GLJA 2PJ3A 3S9MA 3RBUA 4AXVA 2FVGA 2C6GA 1F2OA 1CP6A 1CBXA 3D68A 2OOTA 5JGFA 2ANPA 5JM6A 3MN8A 2F7VA 2C6PA 4G1PA 4ZY2A 4UIAA 1NSAA 1PCAA 4TNUA 3HLPA 4P4FA 2ZEOA 4FUUA 1EE3P 2PJ8A 4F8ZA 4OIWA 4OC5A 2CF4A 4EMEA 2V8HA 3KR5A 1YMEA 3K9TA 2V8VA 1Y0YA 5D8NA 4RUHA 2RB7A 2WYRA 2ABZA 3KHXA 4UEZA 4WJBA 4NJRA 3PEIA 3TC8A 4PQAA 4NGMA 1RTQA 4YWYA 3WC6A 1M4LA 3T8WA 4OKOA 1XRYA 1IGBA 3DGVA 4Q7AA 2CTCA 5HVGA 1R3NA 1LAMA 3PFEA 3IFEA 3K2KA 3D67A 1PYTB 2CTBA 3LWUA 3BI0A 5LRKA 2QVPA 1DTDA 5HXDA 2XEFA 3B3WA 5LYIA 2EK9A 3CPXA 2PJBA 3B2YA 4IK2A 4X8IA 2ZEFA 2JEWA 3V7ZA 4YU9A 2ZENA 3B3SA 4MHPA 1BLLE 4CPAA 6CPAA 4IHMA 3GUXA 1Z5RA 3DLJA 2QYVA 5LYFA 4W9YA 1YW6A 4NGRA 3PB4X 2IMOA 1QQ9A 1YSJA 3IEHA 2PJ4A 4NGQA 1HDQA 3NH4A 5HVHA 4LQGA 4ONWA 2EWBA 3WT4A 4NGSA 2Q4ZA 3H8FA 3KZWA 3BHXA 2GU2A 4OP4A 4OC0A 4R8FA 1ARMA 1HEEA 2PVVA 4R76A 5J1QA 4MMOA 4NJQA 4PPZA 4R6TA 2XEIA 2QJ8A 1ELLP 3SJEA 3S9LA 2NYQA 4O23A 3B7IA 4NFRA 1AMPA 3PB6X 3D7DA 3CPAA 4IAVA 3RZAA 1VHOA 1OBRA 2PJ9A 3ISZA 2ZOGA 4BD9A 3B3VA 4UEEA 3SJFA 4OC1A
chains in the Genus database with same CATH superfamily
1RO5A 2Q51A 4H2KA 4PK3A 2EUIA 2ZW6A 5THWA 4FBEA 3SI1A 1ZG8A 1TKHA 2GLFA 4CYPA 1TF9A 1KUYA 2PR8A 3R96A 2Z0ZA 3W6SA 2R98A 1BO4A 4JD6A 4OC3A 2QIRA 1P0HA 3B3TA 3CDXA 4FWUA 5DS0A 4PXCA 7CPAA 2HV2A 1BAVA 4F6AA 4Q38A 3WABA 4MXUA 2PIZA 4A94A 2ZW4A 2PJ2A 4KVME 3ZJ0A 2ZXVA 3TTHA 5JQ4A 2PJ1A 2PE3A 1VGYA 2V8GA 3OWCA 2J8RA 2AJ6A 4C7IA 4RN7A 5LYLA 3B3CA 4WWVA 2C1CA 3VWEA 4P4EA 4XPKA 4ZGYB 5KTAA 4A39A 2ZPAA 4LUAA 1M1DA 2G3AA 4R3LA 3KQXA 4ZI6A 2B4BA 1TXRA 3KHZA 2YNCA 1L0CA 4KSIA 4B6ZA 2CNMA 1P4NA 3KI9A 2ZEGA 3QAYA 2Z3NA 5I4MA 3QAHA 5LRJA 4K30A 4ZX8A 2BEIA 4OLLA 4K3NA 1BOBA 1XBUA 4F0YA 3DDDA 2BO9A 4RS2A 2PJ6A 3BLNA 4A37A 1R43A 2AFUA 3NE8A 4U9YA 3FYNA 4XPLA 2YNEA 3KR4A 4M6IA 3PFOA 3EC4A 3TCVA 3S6FA 4MJ8A 2V8DA 3KL9A 4CGMA 1H8LA 3I3GA 5CNPA 4DUKA 4KOVA 1AYEA 4EVYA 2B5GB 2RFHA 4BBHA 4MFZA 1BPNA 4XNHB 2PQ8A 4BINA 1LCPA 2B5GA 5IX3A 3TT2A 3FJUA 4UFXA 4YGOA 1Y7EA 1YW4A 3BJ7A 2BSWA 3K9UA 4HNXB 4MY0A 1Y9KA 4ZYQA 4P10A 1OZPA 1ZLIA 2VL1A 3BI1A 3DR6A 4FD4A 3V8IA 5A27A 4CAFA 2ATRA 1DE4C 3KQZA 3NH5A 4JZ0A 4E0AA 4UWIA 4J3GA 1XMTA 2D4OA 2OB0A 2PJAA 4UIBA 3IGRA 2B4DB 2BOAA 4KZTA 2F8HA 2GANA 4KSAA 4P44A 4A38A 1KUXA 2VXKA 3MGDA 1WK4A 2NMTA 2O53A 3N5FA 1Q7LA 4KSFA 4U9ZA 4II9A 1QSOA 3SXNA 2AFWA 4R9MA 3CT9A 2Z3PA 2FL4A 2O4HA 4MFPA 2AFSA 1UFHA 2REFA 1F2PA 1CPXA 2C6CA 4L8AA 4B5PB 3IJ3A 3IWGA 3DNSA 1Q2DA 3SJFA 4P4JA 2AFZA 4PSWA 4XPDB 2IJZA 4B5PA 2I79A 4R57A 3FF3A 4C2XA 4JYWA 2PDOA 1IYLA 3VATA 4OIDA 4ZX9A 2WSAA 4A2ZA 2PRQA 2VZYA 1ELMP 3FH4A 3FECA 3JRUA 4GM5A 4A95A 1S7KA 3IU2A 4CGLA 2FS5A 3IIBA 1I12A 3EO4A 3NH8A 3WC7A 1WWZA 3TO6A 1VIXA 2Q4VA 3PB7X 3NFZA 4KOWA 3LMSA 4MRIA 2IQ6A 3NA6A 4FD5A 3EFAA 4NGNA 4RI1A 5K8NA 4C7HA 4CYQA 1FT7A 4DJLA 2GREA 3QNVA 1LFWA 3FNCA 1S7FA 1ZLHA 4KLWA 4MCSA 2P6GA 3JUWA 1QSTA 5LRGA 1S5KA 5H86A 3TFYA 4TWEA 4FAIA 3IWWA 1S7NA 1CPSA 3SI2A 3FX6A 3PB9X 4EWTA 4UCPA 3H8EA 3SI0A 2PRBA 3H5ZA 5KTDA 3D66A 2VBQA 2Q0YA 1F57A 4U5YA 4MCPA 3UY5A 3S6GA 3WC5A 4QB9A 1PU9A 1S7LA 1FNOA 4PV6A 2AFXA 5C82A 4LX9A 2DF5A 1YK3A 2PIYA 4P6YA 5K8MA 5FVJA 2PJCA 2ZEDA 3FMCA 1KWMA 2OR4A 1JQGA 3PGPA 2OU2A 4P45A 1LAPA 1FY7A 1Q2YA 2BCOA 2FCKA 5HH1A 2ZEEA 2Q4YA 3S9NA 1VKCA 1XJOA 5JH9A 1NSLA 1Z4EA 2C27A 4KOSA 3KGQA 2F5IA 2ZEHA 4AB7A 1XE4A 5ELYA 3P2FA 3G3SA 1CJWA 1XFOA 2B58A 2CIJA 4JXQA 1SQHA 1YR0A 4B11A 2Q7BA 1B6BA 2FE7A 4MCRA 4CRYB 2ZW5A 3KKWA 1N71A 4KUAA 3FEEA 5C88A 3TOBA 3T90A 2DEAA 2AFMA 3CXPA 3R9GA 3GB0A 8CPAA 2V77A 1XIXA 3B35A 1ZG9A 4I49A 3V38A 4KOXA 3ISXA 4NGTA 3IO1A 4OMEA 2HQYA 3PZJA 4P4IA 5K8PA 3IU1A 2I3CA 4OADA 3RNZA 2HB6A 4DNCA 4KVXA 2WZNA 3PP9A 5K8OA 2ZOFA 4DYOA 4FD7A 2Z3OA 2GE3A 4Z65A 1UWYA 5F09A 1Y0RA 1Z9UA 2EK8A 5I0CA 2IL4A 4OC4A 4NEXA 4B14A 1LANA 3EY5A 1IOIA 1IB1E 5AG4A 4UFVA 5IB0A 5G1ZA 3D7HA 2HC9A 1CP7A 2ZELA 2EO8A 3R9FA 4JJXA 3H4QA 5CBMA 2YNCC 3A9LA 3D4UA 4BMHA 5IB9A 4Q36A 5EMIA 3H8GA 4ZBGA 2PJ0A 1K4JA 4KLVA 1M44A 1TKFA 5H84A 4CGNA 1IYKA 1YGHA 5CPAA 1MJ9A 1XMBA 4F9UA 4NF1A 1ARLA 2KCWA 4ZY0A 3TX8A 1ON0A 4A32A 1IOFA 3FB3A 2FIAA 3C26A 3LD2A 4CAWA 2JBJA 5G22A 5DWNA 3FXTA 3PBEA 1IY7A 4C2ZA 4H6ZA 2PVWA 3SJGA 4MHYA 1CG2A 2ZEPA 3FVLA 4P4DA 1ZG7A 3PB8X 2PJ5A 3GIUA 3BXMA 3I1UA 3JTKA 4L89A 4UA3A 4XNHC 4CAEA 2PSWA 2WPWA 3B8GA 2DXQA 2PJ7A 4PXEA 4YRHA 4R7MA 4PK2A 4ZY1A 3D2MA 2CY2A 1LOKA 2VQYA 4KOYA 2B4DA 2XEJA 2QECA 4MBUA 4UEFA 3N7ZA 2FXFA 1RXTA 3IC1A 1NMTA 1X10A 4MHNA 4UWJA 1YVOA 3PRTA 4YFJA 2XEGA 4NGPA 2POKA 1QSNA 3KASA 3PBBA 4M3SA 3MRUA 2G0BA 1YLOA 4FD6A 4PSXA 1YX0A 1IICA 2JEVA 4PXBA 1VHEA 3D7FA 4F0XA 1TF8A 2Z3MA 1X12A 3W91A 3EXNA 1Z2LA 2Q43A 3D7GA 3BJ8A 3HUVA 4HKFA 4EFDA 1YREA 1TIQA 2ZEMA 4MCQA 5ISVA 5D29A 3RAMA 2G9DA 3TE4A 4UF4A 3WR7A 1R57A 4HPSA 2AE6A 1AUGA 5EBVA 2J9AA 3F0AA 5EC4A 4NSQA 1TKJA 4XPDC 5F48A 3SHPA 1Z8LA 3S6HA 3SXOA 5F47A 1NE9A 3I9SA 4MFQA 4R87A 2RC4A 4MHDA 1GYTA 1BPMA 2JBKA 4OC2A 4A30A 2Z3LA 2PCUA 3CXSA 1U6MA 3FEDA 2A4NA 1XF8A 4UBRA 4A33A 1QSRA 4MI4A 3FRMA 3VH9A 2DPSA 4CRZB 5IV0A 2VI7A 3D2PA 3VARA 3L2NA 3SJXA 4X3RA 5HVFA 2NSMA 1HDUA 4MY3A 4PXDA 4B12A 1CX8A 2FIWA 1IU8A 2Z11A 4QC6A 4F9VA 4Y49B 1QMUA 4QUSA 3LODA 4X2TA 1Y9WA 5LYDA 2AFOA 5BWAB 3GLJA 3F8KA 2R8VA 4MFJA 4MHZA 4OAEA 4CYOA 3G8WA 3DSBA 1I21A 4P4BA 1YVKA 2P6FA 4LQ6A 4JWPA 4UCMA 2GLJA 2PJ3A 3S9MA 3T9YA 1V0CA 3RBUA 1XOVA 5F49A 4AXVA 2FVGA 3R9EA 5J8FA 2C6GA 1F2OA 1CP6A 2P0WA 2WPXA 4AVBA 1CBXA 3D68A 3NE7A 3R1KA 2OOTA 2GFQA 1IIDA 2YGWA 5JGFA 2ANPA 5AG6A 5JM6A 3F5BA 4AVAA 4H89A 3MN8A 2F7VA 2C6PA 2G3TA 4G1PA 5DWMA 4KOTA 4ZY2A 4UIAA 1NSAA 1LRZA 1M4IA 1M4DA 4H6UA 1PCAA 4X5KA 3TO9A 4TNUA 3HLPA 4P4FA 4IUSA 2ZEOA 3DR8A 4FUUA 4C68A 2D4PA 1EE3P 2JDDA 4AG7A 2EBJA 2FSRA 2PJ8A 4MFKA 1XEBA 4B13A 2X7BA 4F8ZA 4OIWA 4OC5A 5AG5A 2CF4A 2PC1A 4EMEA 2V8HA 3KR5A 1Z8WA 4KS9A 1YMEA 2GIVA 3K9TA 2V8VA 4KUBA 1Y0YA 5D8NA 2ZW7A 4CGPA 3JVNA 2YNDA 4IF5A 4RUHA 2RB7A 2WYRA 2ABZA 3KHXA 4UEZA 4WJBA 3S6KA 4NJRA 4B5OA 4E2AA 3PEIA 4M85A 3TC8A 2JDCA 2ARHA 5J8CA 2BUEA 2J8NA 4PQAA 4NGMA 4JLYA 2Q04A 4KOUA 4B10A 1RTQA 1Z8XA 4YWYA 2OH1A 3WC6A 4CYNA 1M4LA 3FBUA 3T8WA 1S3ZA 5AGEA 4KORA 1B87A 2O28A 1XRYA 1IGBA 3DGVA 1M4GA 4M6HA 2CTCA 4OKOA 1R3NA 4Q7AA 1LAMA 3E0KA 3PFEA 4E8OA 5HVGA 4NCZA 3IFEA 3K2KA 4HNYB 3R95A 3D67A 4CS0B 1PYTB 2B3VA 2CTBA 3LWUA 3BI0A 3RO0A 2QVPA 3FIXA 1A2ZA 1DTDA 5HXDA 4M6GA 2XEFA 4NXYA 5LRKA 3CZXA 3B3WA 2OZHA 2EK9A 5LYIA 3CPXA 2PJBA 4MFLA 1QSMA 4R3KA 3B2YA 1VHSA 4IK2A 3D3SA 2Z3KA 1KUVA 4X8IA 2ZEFA 2P6EA 2JEWA 2K5TA 4QVTA 3V7ZA 2B3UA 3IWEA 4YU9A 1JWQA 1I1DA 2ZENA 2OZGA 3B3SA 3CXQA 2I00A 4MHPA 5KTCA 1BLLE 4GXHA 1MK4A 3GY9A 3ZZIA 4CPAA 6CPAA 2DPTA 1PUAA 2BL1A 4IHMA 1J4JA 3GUXA 1Z5RA 1MJBA 3DLJA 2QYVA 5JPHA 5LYFA 4W9YA 1S60A 1YW6A 2HUZA 3D8PA 3P2HA 2VZZA 4NGRA 1ZO0A 3PB4X 3QB8A 4KVOE 2IMOA 5G20A 1QQ9A 3TO7A 1YSJA 3IEHA 2PJ4A 4NGQA 1HDQA 3NH4A 4ONUA 3VWDA 4AG9A 2CXAA 5HVHA 4LQGA 4ONWA 1Y7RA 2J8MA 2PR1A 3W6XA 2EWBA 3WT4A 2EVNA 4NGSA 5AG7A 1Z8TA 2Q4ZA 5GCNA 5F46A 4GS4A 2ODFA 4QBJA 2JLMA 5A28A 3H8FA 4AVCA 3KZWA 2Y0MA 3LACA 3BHXA 2GU2A 4OP4A 4OC0A 5E96A 2H5MA 4R8FA 4CGOA 1ARMA 1HEEA 2PVVA 4R76A 5J1QA 4MMOA 4NJQA 4PPZA 2FT0A 4R6TA 2XEIA 4HNWB 2QJ8A 2REEA 1ELLP 4UFWA 3SJEA 2CNTA 3S9LA 3TOAA 5HMNA 4OC1A 2NYQA 4C2YA 1GHEA 4O23A 3GYAA 2R7HA 3B7IA 1CM0A 2WUUA 4NFRA 1AMPA 4Y49C 3PB6X 4JXRA 2QMLA 4CAXA 1Q2CA 1Z4RA 2CNSA 2VEZA 3D7DA 1YLEA 3GKRA 3CPAA 2Q7SA 4IAVA 5G21A 3RZAA 4UCNA 1MJAA 1VHOA 4ORFA 2Q44A 4A31A 1OBRA 2PJ9A 3ISZA 2ZOGA 4BD9A 4CAVA 3RYOA 1YQEA 3B3VA 2R1IA 4UEEA 2Z10A 1KZFA 2OZUA
chains in the Genus database with same CATH topology
2Q51A 4H2KA 5THWA 4FBEA 3SI1A 1ZG8A 1TKHA 2GLFA 1TF9A 4OC3A 3B3TA 3CDXA 4FWUA 5DS0A 4PXCA 7CPAA 1BAVA 3WABA 4MXUA 2PIZA 4A94A 2PJ2A 2PJ1A 2PE3A 1VGYA 2V8GA 5LYLA 3B3CA 4WWVA 2C1CA 4P4EA 4A39A 3KQXA 4ZI6A 3KHZA 1TXRA 4KSIA 4B6ZA 3KI9A 2ZEGA 5I4MA 5LRJA 4ZX8A 4K3NA 1XBUA 2BO9A 2PJ6A 4A37A 1R43A 2AFUA 3KR4A 3PFOA 2V8DA 3KL9A 1H8LA 4DUKA 1AYEA 2RFHA 1BPNA 1LCPA 3FJUA 1Y7EA 1YW4A 4ZYQA 4P10A 1ZLIA 2VL1A 3BI1A 3NH5A 1DE4C 3KQZA 4JZ0A 2PJAA 4UIBA 2BOAA 2F8HA 4P44A 4A38A 3N5FA 2O53A 1Q7LA 2AFWA 3CT9A 2O4HA 2AFSA 1F2PA 1CPXA 2C6CA 3IJ3A 4P4JA 2AFZA 2IJZA 3FF3A 4JYWA 3VATA 4OIDA 4ZX9A 2PRQA 3FH4A 1ELMP 3JRUA 3FECA 4GM5A 3IIBA 3NH8A 3WC7A 1VIXA 3PB7X 3NFZA 3LMSA 4MRIA 2IQ6A 3NA6A 4NGNA 5K8NA 1FT7A 4DJLA 2GREA 3QNVA 1LFWA 4MCSA 1ZLHA 5LRGA 4TWEA 4FAIA 3IWWA 3SI2A 1CPSA 3FX6A 3PB9X 4EWTA 3H8EA 3SI0A 3D66A 1F57A 4MCPA 3WC5A 1FNOA 2AFXA 5K8MA 2PIYA 4P6YA 2PJCA 2ZEDA 3FMCA 1KWMA 2OR4A 1JQGA 4P45A 1LAPA 2BCOA 2ZEEA 3S9NA 1XJOA 5JH9A 3KGQA 2ZEHA 5ELYA 1XFOA 2CIJA 4MCRA 3FEEA 2DEAA 2AFMA 3GB0A 8CPAA 2V77A 3B35A 1ZG9A 3V38A 3ISXA 4NGTA 3IO1A 4OMEA 4P4IA 5K8PA 2I3CA 2HB6A 2WZNA 5K8OA 2ZOFA 4DYOA 5F09A 4Z65A 1UWYA 1Y0RA 2EK8A 4OC4A 1LANA 3D7HA 2HC9A 1CP7A 2ZELA 5CBMA 3D4UA 5IB9A 3H8GA 2PJ0A 1TKFA 5CPAA 1XMBA 4F9UA 1ARLA 4ZY0A 3TX8A 2JBJA 3PBEA 1IY7A 2PVWA 3SJGA 4MHYA 1CG2A 2ZEPA 3FVLA 4P4DA 1ZG7A 3PB8X 2PJ5A 3BXMA 3I1UA 2PJ7A 4PXEA 4R7MA 4ZY1A 1LOKA 2XEJA 4UEFA 3IC1A 4MHNA 3PRTA 2XEGA 4NGPA 2POKA 3KASA 3PBBA 3MRUA 1YLOA 4PXBA 1VHEA 3D7FA 1TF8A 1Z2LA 2Q43A 3D7GA 3HUVA 4EFDA 2ZEMA 4MCQA 5D29A 3RAMA 2G9DA 4UF4A 2J9AA 1TKJA 1Z8LA 1GYTA 1BPMA 2JBKA 4OC2A 2PCUA 3FEDA 3VH9A 3VARA 3L2NA 3SJXA 4X3RA 5HVFA 2NSMA 1HDUA 4PXDA 1CX8A 4F9VA 1QMUA 4X2TA 5LYDA 2AFOA 3GLJA 4MHZA 4P4BA 2GLJA 2PJ3A 3S9MA 3RBUA 4AXVA 2FVGA 2C6GA 1F2OA 1CP6A 1CBXA 3D68A 2OOTA 5JGFA 2ANPA 5JM6A 3MN8A 2F7VA 2C6PA 4G1PA 4ZY2A 4UIAA 1NSAA 1PCAA 4TNUA 3HLPA 4P4FA 2ZEOA 4FUUA 1EE3P 2PJ8A 4F8ZA 4OIWA 4OC5A 2CF4A 4EMEA 2V8HA 3KR5A 1YMEA 3K9TA 2V8VA 1Y0YA 5D8NA 4RUHA 2RB7A 2WYRA 2ABZA 3KHXA 4UEZA 4WJBA 4NJRA 3PEIA 3TC8A 4PQAA 4NGMA 1RTQA 4YWYA 3WC6A 1M4LA 3T8WA 4OKOA 1XRYA 1IGBA 3DGVA 4Q7AA 2CTCA 5HVGA 1R3NA 1LAMA 3PFEA 3IFEA 3K2KA 3D67A 1PYTB 2CTBA 3LWUA 3BI0A 5LRKA 2QVPA 1DTDA 5HXDA 2XEFA 3B3WA 5LYIA 2EK9A 3CPXA 2PJBA 3B2YA 4IK2A 4X8IA 2ZEFA 2JEWA 3V7ZA 4YU9A 2ZENA 3B3SA 4MHPA 1BLLE 4CPAA 6CPAA 4IHMA 3GUXA 1Z5RA 3DLJA 2QYVA 5LYFA 4W9YA 1YW6A 4NGRA 3PB4X 2IMOA 1QQ9A 1YSJA 3IEHA 2PJ4A 4NGQA 1HDQA 3NH4A 5HVHA 4LQGA 4ONWA 2EWBA 3WT4A 4NGSA 2Q4ZA 3H8FA 3KZWA 3BHXA 2GU2A 4OP4A 4OC0A 4R8FA 1ARMA 1HEEA 2PVVA 4R76A 5J1QA 4MMOA 4NJQA 4PPZA 4R6TA 2XEIA 2QJ8A 1ELLP 3SJEA 3S9LA 2NYQA 4O23A 3B7IA 4NFRA 1AMPA 3PB6X 3D7DA 3CPAA 4IAVA 3RZAA 1VHOA 1OBRA 2PJ9A 3ISZA 2ZOGA 4BD9A 3B3VA 4UEEA 3SJFA 4OC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q51 A;  4H2K A;  5THW A;  4FBE A;  3SI1 A;  1ZG8 A;  1TKH A;  2GLF A;  1TF9 A;  4OC3 A;  3B3T A;  3CDX A;  4FWU A;  5DS0 A;  4PXC A;  7CPA A;  1BAV A;  3WAB A;  4MXU A;  2PIZ A;  4A94 A;  2PJ2 A;  2PJ1 A;  2PE3 A;  1VGY A;  2V8G A;  5LYL A;  3B3C A;  4WWV A;  2C1C A;  4P4E A;  4A39 A;  3KQX A;  4ZI6 A;  3KHZ A;  1TXR A;  4KSI A;  4B6Z A;  3KI9 A;  2ZEG A;  5I4M A;  5LRJ A;  4ZX8 A;  4K3N A;  1XBU A;  2BO9 A;  2PJ6 A;  4A37 A;  1R43 A;  2AFU A;  3KR4 A;  3PFO A;  2V8D A;  3KL9 A;  1H8L A;  4DUK A;  1AYE A;  2RFH A;  1BPN A;  1LCP A;  3FJU A;  1Y7E A;  1YW4 A;  4ZYQ A;  4P10 A;  1ZLI A;  2VL1 A;  3BI1 A;  3NH5 A;  1DE4 C;  3KQZ A;  4JZ0 A;  2PJA A;  4UIB A;  2BOA A;  2F8H A;  4P44 A;  4A38 A;  3N5F A;  2O53 A;  1Q7L A;  2AFW A;  3CT9 A;  2O4H A;  2AFS A;  1F2P A;  1CPX A;  2C6C A;  3IJ3 A;  4P4J A;  2AFZ A;  2IJZ A;  3FF3 A;  4JYW A;  3VAT A;  4OID A;  4ZX9 A;  2PRQ A;  3FH4 A;  1ELM P;  3JRU A;  3FEC A;  4GM5 A;  3IIB A;  3NH8 A;  3WC7 A;  1VIX A;  3PB7 X;  3NFZ A;  3LMS A;  4MRI A;  2IQ6 A;  3NA6 A;  4NGN A;  5K8N A;  1FT7 A;  4DJL A;  2GRE A;  3QNV A;  1LFW A;  4MCS A;  1ZLH A;  5LRG A;  4TWE A;  4FAI A;  3IWW A;  3SI2 A;  1CPS A;  3FX6 A;  3PB9 X;  4EWT A;  3H8E A;  3SI0 A;  3D66 A;  1F57 A;  4MCP A;  3WC5 A;  1FNO A;  2AFX A;  5K8M A;  2PIY A;  4P6Y A;  2PJC A;  2ZED A;  3FMC A;  1KWM A;  2OR4 A;  1JQG A;  4P45 A;  1LAP A;  2BCO A;  2ZEE A;  3S9N A;  1XJO A;  5JH9 A;  3KGQ A;  2ZEH A;  5ELY A;  1XFO A;  2CIJ A;  4MCR A;  3FEE A;  2DEA A;  2AFM A;  3GB0 A;  8CPA A;  2V77 A;  3B35 A;  1ZG9 A;  3V38 A;  3ISX A;  4NGT A;  3IO1 A;  4OME A;  4P4I A;  5K8P A;  2I3C A;  2HB6 A;  2WZN A;  5K8O A;  2ZOF A;  4DYO A;  5F09 A;  4Z65 A;  1UWY A;  1Y0R A;  2EK8 A;  4OC4 A;  1LAN A;  3D7H A;  2HC9 A;  1CP7 A;  2ZEL A;  5CBM A;  3D4U A;  5IB9 A;  3H8G A;  2PJ0 A;  1TKF A;  5CPA A;  1XMB A;  4F9U A;  1ARL A;  4ZY0 A;  3TX8 A;  2JBJ A;  3PBE A;  1IY7 A;  2PVW A;  3SJG A;  4MHY A;  1CG2 A;  2ZEP A;  3FVL A;  4P4D A;  1ZG7 A;  3PB8 X;  2PJ5 A;  3BXM A;  3I1U A;  2PJ7 A;  4PXE A;  4R7M A;  4ZY1 A;  1LOK A;  2XEJ A;  4UEF A;  3IC1 A;  4MHN A;  3PRT A;  2XEG A;  4NGP A;  2POK A;  3KAS A;  3PBB A;  3MRU A;  1YLO A;  4PXB A;  1VHE A;  3D7F A;  1TF8 A;  1Z2L A;  2Q43 A;  3D7G A;  3HUV A;  4EFD A;  2ZEM A;  4MCQ A;  5D29 A;  3RAM A;  2G9D A;  4UF4 A;  2J9A A;  1TKJ A;  1Z8L A;  1GYT A;  1BPM A;  2JBK A;  4OC2 A;  2PCU A;  3FED A;  3VH9 A;  3VAR A;  3L2N A;  3SJX A;  4X3R A;  5HVF A;  2NSM A;  1HDU A;  4PXD A;  1CX8 A;  4F9V A;  1QMU A;  4X2T A;  5LYD A;  2AFO A;  3GLJ A;  4MHZ A;  4P4B A;  2GLJ A;  2PJ3 A;  3S9M A;  3RBU A;  4AXV A;  2FVG A;  2C6G A;  1F2O A;  1CP6 A;  1CBX A;  3D68 A;  2OOT A;  5JGF A;  2ANP A;  5JM6 A;  3MN8 A;  2F7V A;  2C6P A;  4G1P A;  4ZY2 A;  4UIA A;  1NSA A;  1PCA A;  4TNU A;  3HLP A;  4P4F A;  2ZEO A;  4FUU A;  1EE3 P;  2PJ8 A;  4F8Z A;  4OIW A;  4OC5 A;  2CF4 A;  4EME A;  2V8H A;  3KR5 A;  1YME A;  3K9T A;  2V8V A;  1Y0Y A;  5D8N A;  4RUH A;  2RB7 A;  2WYR A;  2ABZ A;  3KHX A;  4UEZ A;  4WJB A;  4NJR A;  3PEI A;  3TC8 A;  4PQA A;  4NGM A;  1RTQ A;  4YWY A;  3WC6 A;  1M4L A;  3T8W A;  4OKO A;  1XRY A;  1IGB A;  3DGV A;  4Q7A A;  2CTC A;  5HVG A;  1R3N A;  1LAM A;  3PFE A;  3IFE A;  3K2K A;  3D67 A;  1PYT B;  2CTB A;  3LWU A;  3BI0 A;  5LRK A;  2QVP A;  1DTD A;  5HXD A;  2XEF A;  3B3W A;  5LYI A;  2EK9 A;  3CPX A;  2PJB A;  3B2Y A;  4IK2 A;  4X8I A;  2ZEF A;  2JEW A;  3V7Z A;  4YU9 A;  2ZEN A;  3B3S A;  4MHP A;  1BLL E;  4CPA A;  6CPA A;  4IHM A;  3GUX A;  1Z5R A;  3DLJ A;  2QYV A;  5LYF A;  4W9Y A;  1YW6 A;  4NGR A;  3PB4 X;  2IMO A;  1QQ9 A;  1YSJ A;  3IEH A;  2PJ4 A;  4NGQ A;  1HDQ A;  3NH4 A;  5HVH A;  4LQG A;  4ONW A;  2EWB A;  3WT4 A;  4NGS A;  2Q4Z A;  3H8F A;  3KZW A;  3BHX A;  2GU2 A;  4OP4 A;  4OC0 A;  4R8F A;  1ARM A;  1HEE A;  2PVV A;  4R76 A;  5J1Q A;  4MMO A;  4NJQ A;  4PPZ A;  4R6T A;  2XEI A;  2QJ8 A;  1ELL P;  3SJE A;  3S9L A;  2NYQ A;  4O23 A;  3B7I A;  4NFR A;  1AMP A;  3PB6 X;  3D7D A;  3CPA A;  4IAV A;  3RZA A;  1VHO A;  1OBR A;  2PJ9 A;  3ISZ A;  2ZOG A;  4BD9 A;  3B3V A;  4UEE A;  3SJF A;  4OC1 A; 
#chains in the Genus database with same CATH topology
 1RO5 A;  2Q51 A;  4H2K A;  4PK3 A;  2EUI A;  2ZW6 A;  5THW A;  4FBE A;  3SI1 A;  1ZG8 A;  1TKH A;  2GLF A;  4CYP A;  1TF9 A;  1KUY A;  2PR8 A;  3R96 A;  2Z0Z A;  3W6S A;  2R98 A;  1BO4 A;  4JD6 A;  4OC3 A;  2QIR A;  1P0H A;  3B3T A;  3CDX A;  4FWU A;  5DS0 A;  4PXC A;  7CPA A;  2HV2 A;  1BAV A;  4F6A A;  4Q38 A;  3WAB A;  4MXU A;  2PIZ A;  4A94 A;  2ZW4 A;  2PJ2 A;  4KVM E;  3ZJ0 A;  2ZXV A;  3TTH A;  5JQ4 A;  2PJ1 A;  2PE3 A;  1VGY A;  2V8G A;  3OWC A;  2J8R A;  2AJ6 A;  4C7I A;  4RN7 A;  5LYL A;  3B3C A;  4WWV A;  2C1C A;  3VWE A;  4P4E A;  4XPK A;  4ZGY B;  5KTA A;  4A39 A;  2ZPA A;  4LUA A;  1M1D A;  2G3A A;  4R3L A;  3KQX A;  4ZI6 A;  2B4B A;  1TXR A;  3KHZ A;  2YNC A;  1L0C A;  4KSI A;  4B6Z A;  2CNM A;  1P4N A;  3KI9 A;  2ZEG A;  3QAY A;  2Z3N A;  5I4M A;  3QAH A;  5LRJ A;  4K30 A;  4ZX8 A;  2BEI A;  4OLL A;  4K3N A;  1BOB A;  1XBU A;  4F0Y A;  3DDD A;  2BO9 A;  4RS2 A;  2PJ6 A;  3BLN A;  4A37 A;  1R43 A;  2AFU A;  3NE8 A;  4U9Y A;  3FYN A;  4XPL A;  2YNE A;  3KR4 A;  4M6I A;  3PFO A;  3EC4 A;  3TCV A;  3S6F A;  4MJ8 A;  2V8D A;  3KL9 A;  4CGM A;  1H8L A;  3I3G A;  5CNP A;  4DUK A;  4KOV A;  1AYE A;  4EVY A;  2B5G B;  2RFH A;  4BBH A;  4MFZ A;  1BPN A;  4XNH B;  2PQ8 A;  4BIN A;  1LCP A;  2B5G A;  5IX3 A;  3TT2 A;  3FJU A;  4UFX A;  4YGO A;  1Y7E A;  1YW4 A;  3BJ7 A;  2BSW A;  3K9U A;  4HNX B;  4MY0 A;  1Y9K A;  4ZYQ A;  4P10 A;  1OZP A;  1ZLI A;  2VL1 A;  3BI1 A;  3DR6 A;  4FD4 A;  3V8I A;  5A27 A;  4CAF A;  2ATR A;  1DE4 C;  3KQZ A;  3NH5 A;  4JZ0 A;  4E0A A;  4UWI A;  4J3G A;  1XMT A;  2D4O A;  2OB0 A;  2PJA A;  4UIB A;  3IGR A;  2B4D B;  2BOA A;  4KZT A;  2F8H A;  2GAN A;  4KSA A;  4P44 A;  4A38 A;  1KUX A;  2VXK A;  3MGD A;  1WK4 A;  2NMT A;  2O53 A;  3N5F A;  1Q7L A;  4KSF A;  4U9Z A;  4II9 A;  1QSO A;  3SXN A;  2AFW A;  4R9M A;  3CT9 A;  2Z3P A;  2FL4 A;  2O4H A;  4MFP A;  2AFS A;  1UFH A;  2REF A;  1F2P A;  1CPX A;  2C6C A;  4L8A A;  4B5P B;  3IJ3 A;  3IWG A;  3DNS A;  1Q2D A;  3SJF A;  4P4J A;  2AFZ A;  4PSW A;  4XPD B;  2IJZ A;  4B5P A;  2I79 A;  4R57 A;  3FF3 A;  4C2X A;  4JYW A;  2PDO A;  1IYL A;  3VAT A;  4OID A;  4ZX9 A;  2WSA A;  4A2Z A;  2PRQ A;  2VZY A;  1ELM P;  3FH4 A;  3FEC A;  3JRU A;  4GM5 A;  4A95 A;  1S7K A;  3IU2 A;  4CGL A;  2FS5 A;  3IIB A;  1I12 A;  3EO4 A;  3NH8 A;  3WC7 A;  1WWZ A;  3TO6 A;  1VIX A;  2Q4V A;  3PB7 X;  3NFZ A;  4KOW A;  3LMS A;  4MRI A;  2IQ6 A;  3NA6 A;  4FD5 A;  3EFA A;  4NGN A;  4RI1 A;  5K8N A;  4C7H A;  4CYQ A;  1FT7 A;  4DJL A;  2GRE A;  3QNV A;  1LFW A;  3FNC A;  1S7F A;  1ZLH A;  4KLW A;  4MCS A;  2P6G A;  3JUW A;  1QST A;  5LRG A;  1S5K A;  5H86 A;  3TFY A;  4TWE A;  4FAI A;  3IWW A;  1S7N A;  1CPS A;  3SI2 A;  3FX6 A;  3PB9 X;  4EWT A;  4UCP A;  3H8E A;  3SI0 A;  2PRB A;  3H5Z A;  5KTD A;  3D66 A;  2VBQ A;  2Q0Y A;  1F57 A;  4U5Y A;  4MCP A;  3UY5 A;  3S6G A;  3WC5 A;  4QB9 A;  1PU9 A;  1S7L A;  1FNO A;  4PV6 A;  2AFX A;  5C82 A;  4LX9 A;  2DF5 A;  1YK3 A;  2PIY A;  4P6Y A;  5K8M A;  5FVJ A;  2PJC A;  2ZED A;  3FMC A;  1KWM A;  2OR4 A;  1JQG A;  3PGP A;  2OU2 A;  4P45 A;  1LAP A;  1FY7 A;  1Q2Y A;  2BCO A;  2FCK A;  5HH1 A;  2ZEE A;  2Q4Y A;  3S9N A;  1VKC A;  1XJO A;  5JH9 A;  1NSL A;  1Z4E A;  2C27 A;  4KOS A;  3KGQ A;  2F5I A;  2ZEH A;  4AB7 A;  1XE4 A;  5ELY A;  3P2F A;  3G3S A;  1CJW A;  1XFO A;  2B58 A;  2CIJ A;  4JXQ A;  1SQH A;  1YR0 A;  4B11 A;  2Q7B A;  1B6B A;  2FE7 A;  4MCR A;  4CRY B;  2ZW5 A;  3KKW A;  1N71 A;  4KUA A;  3FEE A;  5C88 A;  3TOB A;  3T90 A;  2DEA A;  2AFM A;  3CXP A;  3R9G A;  3GB0 A;  8CPA A;  2V77 A;  1XIX A;  3B35 A;  1ZG9 A;  4I49 A;  3V38 A;  4KOX A;  3ISX A;  4NGT A;  3IO1 A;  4OME A;  2HQY A;  3PZJ A;  4P4I A;  5K8P A;  3IU1 A;  2I3C A;  4OAD A;  3RNZ A;  2HB6 A;  4DNC A;  4KVX A;  2WZN A;  3PP9 A;  5K8O A;  2ZOF A;  4DYO A;  4FD7 A;  2Z3O A;  2GE3 A;  4Z65 A;  1UWY A;  5F09 A;  1Y0R A;  1Z9U A;  2EK8 A;  5I0C A;  2IL4 A;  4OC4 A;  4NEX A;  4B14 A;  1LAN A;  3EY5 A;  1IOI A;  1IB1 E;  5AG4 A;  4UFV A;  5IB0 A;  5G1Z A;  3D7H A;  2HC9 A;  1CP7 A;  2ZEL A;  2EO8 A;  3R9F A;  4JJX A;  3H4Q A;  5CBM A;  2YNC C;  3A9L A;  3D4U A;  4BMH A;  5IB9 A;  4Q36 A;  5EMI A;  3H8G A;  4ZBG A;  2PJ0 A;  1K4J A;  4KLV A;  1M44 A;  1TKF A;  5H84 A;  4CGN A;  1IYK A;  1YGH A;  5CPA A;  1MJ9 A;  1XMB A;  4F9U A;  4NF1 A;  1ARL A;  2KCW A;  4ZY0 A;  3TX8 A;  1ON0 A;  4A32 A;  1IOF A;  3FB3 A;  2FIA A;  3C26 A;  3LD2 A;  4CAW A;  2JBJ A;  5G22 A;  5DWN A;  3FXT A;  3PBE A;  1IY7 A;  4C2Z A;  4H6Z A;  2PVW A;  3SJG A;  4MHY A;  1CG2 A;  2ZEP A;  3FVL A;  4P4D A;  1ZG7 A;  3PB8 X;  2PJ5 A;  3GIU A;  3BXM A;  3I1U A;  3JTK A;  4L89 A;  4UA3 A;  4XNH C;  4CAE A;  2PSW A;  2WPW A;  3B8G A;  2DXQ A;  2PJ7 A;  4PXE A;  4YRH A;  4R7M A;  4PK2 A;  4ZY1 A;  3D2M A;  2CY2 A;  1LOK A;  2VQY A;  4KOY A;  2B4D A;  2XEJ A;  2QEC A;  4MBU A;  4UEF A;  3N7Z A;  2FXF A;  1RXT A;  3IC1 A;  1NMT A;  1X10 A;  4MHN A;  4UWJ A;  1YVO A;  3PRT A;  4YFJ A;  2XEG A;  4NGP A;  2POK A;  1QSN A;  3KAS A;  3PBB A;  4M3S A;  3MRU A;  2G0B A;  1YLO A;  4FD6 A;  4PSX A;  1YX0 A;  1IIC A;  2JEV A;  4PXB A;  1VHE A;  3D7F A;  4F0X A;  1TF8 A;  2Z3M A;  1X12 A;  3W91 A;  3EXN A;  1Z2L A;  2Q43 A;  3D7G A;  3BJ8 A;  3HUV A;  4HKF A;  4EFD A;  1YRE A;  1TIQ A;  2ZEM A;  4MCQ A;  5ISV A;  5D29 A;  3RAM A;  2G9D A;  3TE4 A;  4UF4 A;  3WR7 A;  1R57 A;  4HPS A;  2AE6 A;  1AUG A;  5EBV A;  2J9A A;  3F0A A;  5EC4 A;  4NSQ A;  1TKJ A;  4XPD C;  5F48 A;  3SHP A;  1Z8L A;  3S6H A;  3SXO A;  5F47 A;  1NE9 A;  3I9S A;  4MFQ A;  4R87 A;  2RC4 A;  4MHD A;  1GYT A;  1BPM A;  2JBK A;  4OC2 A;  4A30 A;  2Z3L A;  2PCU A;  3CXS A;  1U6M A;  3FED A;  2A4N A;  1XF8 A;  4UBR A;  4A33 A;  1QSR A;  4MI4 A;  3FRM A;  3VH9 A;  2DPS A;  4CRZ B;  5IV0 A;  2VI7 A;  3D2P A;  3VAR A;  3L2N A;  3SJX A;  4X3R A;  5HVF A;  2NSM A;  1HDU A;  4MY3 A;  4PXD A;  4B12 A;  1CX8 A;  2FIW A;  1IU8 A;  2Z11 A;  4QC6 A;  4F9V A;  4Y49 B;  1QMU A;  4QUS A;  3LOD A;  4X2T A;  1Y9W A;  5LYD A;  2AFO A;  5BWA B;  3GLJ A;  3F8K A;  2R8V A;  4MFJ A;  4MHZ A;  4OAE A;  4CYO A;  3G8W A;  3DSB A;  1I21 A;  4P4B A;  1YVK A;  2P6F A;  4LQ6 A;  4JWP A;  4UCM A;  2GLJ A;  2PJ3 A;  3S9M A;  3T9Y A;  1V0C A;  3RBU A;  1XOV A;  5F49 A;  4AXV A;  2FVG A;  3R9E A;  5J8F A;  2C6G A;  1F2O A;  1CP6 A;  2P0W A;  2WPX A;  4AVB A;  1CBX A;  3D68 A;  3NE7 A;  3R1K A;  2OOT A;  2GFQ A;  1IID A;  2YGW A;  5JGF A;  2ANP A;  5AG6 A;  5JM6 A;  3F5B A;  4AVA A;  4H89 A;  3MN8 A;  2F7V A;  2C6P A;  2G3T A;  4G1P A;  5DWM A;  4KOT A;  4ZY2 A;  4UIA A;  1NSA A;  1LRZ A;  1M4I A;  1M4D A;  4H6U A;  1PCA A;  4X5K A;  3TO9 A;  4TNU A;  3HLP A;  4P4F A;  4IUS A;  2ZEO A;  3DR8 A;  4FUU A;  4C68 A;  2D4P A;  1EE3 P;  2JDD A;  4AG7 A;  2EBJ A;  2FSR A;  2PJ8 A;  4MFK A;  1XEB A;  4B13 A;  2X7B A;  4F8Z A;  4OIW A;  4OC5 A;  5AG5 A;  2CF4 A;  2PC1 A;  4EME A;  2V8H A;  3KR5 A;  1Z8W A;  4KS9 A;  1YME A;  2GIV A;  3K9T A;  2V8V A;  4KUB A;  1Y0Y A;  5D8N A;  2ZW7 A;  4CGP A;  3JVN A;  2YND A;  4IF5 A;  4RUH A;  2RB7 A;  2WYR A;  2ABZ A;  3KHX A;  4UEZ A;  4WJB A;  3S6K A;  4NJR A;  4B5O A;  4E2A A;  3PEI A;  4M85 A;  3TC8 A;  2JDC A;  2ARH A;  5J8C A;  2BUE A;  2J8N A;  4PQA A;  4NGM A;  4JLY A;  2Q04 A;  4KOU A;  4B10 A;  1RTQ A;  1Z8X A;  4YWY A;  2OH1 A;  3WC6 A;  4CYN A;  1M4L A;  3FBU A;  3T8W A;  1S3Z A;  5AGE A;  4KOR A;  1B87 A;  2O28 A;  1XRY A;  1IGB A;  3DGV A;  1M4G A;  4M6H A;  2CTC A;  4OKO A;  1R3N A;  4Q7A A;  1LAM A;  3E0K A;  3PFE A;  4E8O A;  5HVG A;  4NCZ A;  3IFE A;  3K2K A;  4HNY B;  3R95 A;  3D67 A;  4CS0 B;  1PYT B;  2B3V A;  2CTB A;  3LWU A;  3BI0 A;  3RO0 A;  2QVP A;  3FIX A;  1A2Z A;  1DTD A;  5HXD A;  4M6G A;  2XEF A;  4NXY A;  5LRK A;  3CZX A;  3B3W A;  2OZH A;  2EK9 A;  5LYI A;  3CPX A;  2PJB A;  4MFL A;  1QSM A;  4R3K A;  3B2Y A;  1VHS A;  4IK2 A;  3D3S A;  2Z3K A;  1KUV A;  4X8I A;  2ZEF A;  2P6E A;  2JEW A;  2K5T A;  4QVT A;  3V7Z A;  2B3U A;  3IWE A;  4YU9 A;  1JWQ A;  1I1D A;  2ZEN A;  2OZG A;  3B3S A;  3CXQ A;  2I00 A;  4MHP A;  5KTC A;  1BLL E;  4GXH A;  1MK4 A;  3GY9 A;  3ZZI A;  4CPA A;  6CPA A;  2DPT A;  1PUA A;  2BL1 A;  4IHM A;  1J4J A;  3GUX A;  1Z5R A;  1MJB A;  3DLJ A;  2QYV A;  5JPH A;  5LYF A;  4W9Y A;  1S60 A;  1YW6 A;  2HUZ A;  3D8P A;  3P2H A;  2VZZ A;  4NGR A;  1ZO0 A;  3PB4 X;  3QB8 A;  4KVO E;  2IMO A;  5G20 A;  1QQ9 A;  3TO7 A;  1YSJ A;  3IEH A;  2PJ4 A;  4NGQ A;  1HDQ A;  3NH4 A;  4ONU A;  3VWD A;  4AG9 A;  2CXA A;  5HVH A;  4LQG A;  4ONW A;  1Y7R A;  2J8M A;  2PR1 A;  3W6X A;  2EWB A;  3WT4 A;  2EVN A;  4NGS A;  5AG7 A;  1Z8T A;  2Q4Z A;  5GCN A;  5F46 A;  4GS4 A;  2ODF A;  4QBJ A;  2JLM A;  5A28 A;  3H8F A;  4AVC A;  3KZW A;  2Y0M A;  3LAC A;  3BHX A;  2GU2 A;  4OP4 A;  4OC0 A;  5E96 A;  2H5M A;  4R8F A;  4CGO A;  1ARM A;  1HEE A;  2PVV A;  4R76 A;  5J1Q A;  4MMO A;  4NJQ A;  4PPZ A;  2FT0 A;  4R6T A;  2XEI A;  4HNW B;  2QJ8 A;  2REE A;  1ELL P;  4UFW A;  3SJE A;  2CNT A;  3S9L A;  3TOA A;  5HMN A;  4OC1 A;  2NYQ A;  4C2Y A;  1GHE A;  4O23 A;  3GYA A;  2R7H A;  3B7I A;  1CM0 A;  2WUU A;  4NFR A;  1AMP A;  4Y49 C;  3PB6 X;  4JXR A;  2QML A;  4CAX A;  1Q2C A;  1Z4R A;  2CNS A;  2VEZ A;  3D7D A;  1YLE A;  3GKR A;  3CPA A;  2Q7S A;  4IAV A;  5G21 A;  3RZA A;  4UCN A;  1MJA A;  1VHO A;  4ORF A;  2Q44 A;  4A31 A;  1OBR A;  2PJ9 A;  3ISZ A;  2ZOG A;  4BD9 A;  4CAV A;  3RYO A;  1YQE A;  3B3V A;  2R1I A;  4UEE A;  2Z10 A;  1KZF A;  2OZU A; 
#chains in the Genus database with same CATH homology
 2Q51 A;  4H2K A;  5THW A;  4FBE A;  3SI1 A;  1ZG8 A;  1TKH A;  2GLF A;  1TF9 A;  4OC3 A;  3B3T A;  3CDX A;  4FWU A;  5DS0 A;  4PXC A;  7CPA A;  1BAV A;  3WAB A;  4MXU A;  2PIZ A;  4A94 A;  2PJ2 A;  2PJ1 A;  2PE3 A;  1VGY A;  2V8G A;  5LYL A;  3B3C A;  4WWV A;  2C1C A;  4P4E A;  4A39 A;  3KQX A;  4ZI6 A;  3KHZ A;  1TXR A;  4KSI A;  4B6Z A;  3KI9 A;  2ZEG A;  5I4M A;  5LRJ A;  4ZX8 A;  4K3N A;  1XBU A;  2BO9 A;  2PJ6 A;  4A37 A;  1R43 A;  2AFU A;  3KR4 A;  3PFO A;  2V8D A;  3KL9 A;  1H8L A;  4DUK A;  1AYE A;  2RFH A;  1BPN A;  1LCP A;  3FJU A;  1Y7E A;  1YW4 A;  4ZYQ A;  4P10 A;  1ZLI A;  2VL1 A;  3BI1 A;  3NH5 A;  1DE4 C;  3KQZ A;  4JZ0 A;  2PJA A;  4UIB A;  2BOA A;  2F8H A;  4P44 A;  4A38 A;  3N5F A;  2O53 A;  1Q7L A;  2AFW A;  3CT9 A;  2O4H A;  2AFS A;  1F2P A;  1CPX A;  2C6C A;  3IJ3 A;  4P4J A;  2AFZ A;  2IJZ A;  3FF3 A;  4JYW A;  3VAT A;  4OID A;  4ZX9 A;  2PRQ A;  3FH4 A;  1ELM P;  3JRU A;  3FEC A;  4GM5 A;  3IIB A;  3NH8 A;  3WC7 A;  1VIX A;  3PB7 X;  3NFZ A;  3LMS A;  4MRI A;  2IQ6 A;  3NA6 A;  4NGN A;  5K8N A;  1FT7 A;  4DJL A;  2GRE A;  3QNV A;  1LFW A;  4MCS A;  1ZLH A;  5LRG A;  4TWE A;  4FAI A;  3IWW A;  3SI2 A;  1CPS A;  3FX6 A;  3PB9 X;  4EWT A;  3H8E A;  3SI0 A;  3D66 A;  1F57 A;  4MCP A;  3WC5 A;  1FNO A;  2AFX A;  5K8M A;  2PIY A;  4P6Y A;  2PJC A;  2ZED A;  3FMC A;  1KWM A;  2OR4 A;  1JQG A;  4P45 A;  1LAP A;  2BCO A;  2ZEE A;  3S9N A;  1XJO A;  5JH9 A;  3KGQ A;  2ZEH A;  5ELY A;  1XFO A;  2CIJ A;  4MCR A;  3FEE A;  2DEA A;  2AFM A;  3GB0 A;  8CPA A;  2V77 A;  3B35 A;  1ZG9 A;  3V38 A;  3ISX A;  4NGT A;  3IO1 A;  4OME A;  4P4I A;  5K8P A;  2I3C A;  2HB6 A;  2WZN A;  5K8O A;  2ZOF A;  4DYO A;  5F09 A;  4Z65 A;  1UWY A;  1Y0R A;  2EK8 A;  4OC4 A;  1LAN A;  3D7H A;  2HC9 A;  1CP7 A;  2ZEL A;  5CBM A;  3D4U A;  5IB9 A;  3H8G A;  2PJ0 A;  1TKF A;  5CPA A;  1XMB A;  4F9U A;  1ARL A;  4ZY0 A;  3TX8 A;  2JBJ A;  3PBE A;  1IY7 A;  2PVW A;  3SJG A;  4MHY A;  1CG2 A;  2ZEP A;  3FVL A;  4P4D A;  1ZG7 A;  3PB8 X;  2PJ5 A;  3BXM A;  3I1U A;  2PJ7 A;  4PXE A;  4R7M A;  4ZY1 A;  1LOK A;  2XEJ A;  4UEF A;  3IC1 A;  4MHN A;  3PRT A;  2XEG A;  4NGP A;  2POK A;  3KAS A;  3PBB A;  3MRU A;  1YLO A;  4PXB A;  1VHE A;  3D7F A;  1TF8 A;  1Z2L A;  2Q43 A;  3D7G A;  3HUV A;  4EFD A;  2ZEM A;  4MCQ A;  5D29 A;  3RAM A;  2G9D A;  4UF4 A;  2J9A A;  1TKJ A;  1Z8L A;  1GYT A;  1BPM A;  2JBK A;  4OC2 A;  2PCU A;  3FED A;  3VH9 A;  3VAR A;  3L2N A;  3SJX A;  4X3R A;  5HVF A;  2NSM A;  1HDU A;  4PXD A;  1CX8 A;  4F9V A;  1QMU A;  4X2T A;  5LYD A;  2AFO A;  3GLJ A;  4MHZ A;  4P4B A;  2GLJ A;  2PJ3 A;  3S9M A;  3RBU A;  4AXV A;  2FVG A;  2C6G A;  1F2O A;  1CP6 A;  1CBX A;  3D68 A;  2OOT A;  5JGF A;  2ANP A;  5JM6 A;  3MN8 A;  2F7V A;  2C6P A;  4G1P A;  4ZY2 A;  4UIA A;  1NSA A;  1PCA A;  4TNU A;  3HLP A;  4P4F A;  2ZEO A;  4FUU A;  1EE3 P;  2PJ8 A;  4F8Z A;  4OIW A;  4OC5 A;  2CF4 A;  4EME A;  2V8H A;  3KR5 A;  1YME A;  3K9T A;  2V8V A;  1Y0Y A;  5D8N A;  4RUH A;  2RB7 A;  2WYR A;  2ABZ A;  3KHX A;  4UEZ A;  4WJB A;  4NJR A;  3PEI A;  3TC8 A;  4PQA A;  4NGM A;  1RTQ A;  4YWY A;  3WC6 A;  1M4L A;  3T8W A;  4OKO A;  1XRY A;  1IGB A;  3DGV A;  4Q7A A;  2CTC A;  5HVG A;  1R3N A;  1LAM A;  3PFE A;  3IFE A;  3K2K A;  3D67 A;  1PYT B;  2CTB A;  3LWU A;  3BI0 A;  5LRK A;  2QVP A;  1DTD A;  5HXD A;  2XEF A;  3B3W A;  5LYI A;  2EK9 A;  3CPX A;  2PJB A;  3B2Y A;  4IK2 A;  4X8I A;  2ZEF A;  2JEW A;  3V7Z A;  4YU9 A;  2ZEN A;  3B3S A;  4MHP A;  1BLL E;  4CPA A;  6CPA A;  4IHM A;  3GUX A;  1Z5R A;  3DLJ A;  2QYV A;  5LYF A;  4W9Y A;  1YW6 A;  4NGR A;  3PB4 X;  2IMO A;  1QQ9 A;  1YSJ A;  3IEH A;  2PJ4 A;  4NGQ A;  1HDQ A;  3NH4 A;  5HVH A;  4LQG A;  4ONW A;  2EWB A;  3WT4 A;  4NGS A;  2Q4Z A;  3H8F A;  3KZW A;  3BHX A;  2GU2 A;  4OP4 A;  4OC0 A;  4R8F A;  1ARM A;  1HEE A;  2PVV A;  4R76 A;  5J1Q A;  4MMO A;  4NJQ A;  4PPZ A;  4R6T A;  2XEI A;  2QJ8 A;  1ELL P;  3SJE A;  3S9L A;  2NYQ A;  4O23 A;  3B7I A;  4NFR A;  1AMP A;  3PB6 X;  3D7D A;  3CPA A;  4IAV A;  3RZA A;  1VHO A;  1OBR A;  2PJ9 A;  3ISZ A;  2ZOG A;  4BD9 A;  3B3V A;  4UEE A;  3SJF A;  4OC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...