2AFZA

Crystal structure of human glutaminyl cyclase in complex with 1-vinylimidazole
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
329
structure length
323
Chain Sequence
b'ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
molecule tags Transferase
source organism Homo sapiens
publication title Crystal structures of human glutaminyl cyclase, an enzyme responsible for protein N-terminal pyroglutamate formation
pubmed doi rcsb
total genus 111
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2afzA00
1PYTB 4UEZA 2PJ2A 2G9DA 1CPSA 3S9MA 3LWUA 3KL9A 4ZI6A 4OC3A 4TWEA 1R3NA 5IB9A 3D68A 4JYWA 3LMSA 2ZEEA 3KI9A 2PJ9A 3IEHA 3HUVA 4ZX8A 1VGYA 3I1UA 3FJUA 4A39A 3JRUA 1GYTA 5J1QA 3B7IA 3MN8A 3K9TA 3FEDA 4PQAA 2QJ8A 3GB0A 1M4LA 3KASA 5CPAA 2OR4A 1BPNA 3GLJA 5I4MA 2GU2A 3D4UA 1AMPA 4X2TA 3PBBA 4PPZA 4ZY1A 1Y7EA 1FT7A 4FBEA 4FUUA 4DJLA 2DEAA 3IO1A 4YWYA 1ZLHA 2PIZA 4P4JA 3WC5A 3B3TA 5HVHA 3PB7X 4OIWA 3DLJA 4NGRA 4P4BA 4NJQA 4A37A 1HDQA 1AYEA 1YW6A 1Q7LA 5LRJA 1FNOA 3BI0A 3TC8A 1PCAA 4OIDA 4P4DA 4CPAA 3N5FA 2ZEGA 3H8FA 4AXVA 2JBKA 3B3SA 3PB9X 3BHXA 2PRQA 3SJEA 4OC1A 3CPXA 2V8VA 3SI1A 2C1CA 2Q51A 4GM5A 1TXRA 3D67A 1LAPA 4UF4A 3WC6A 4IAVA 4P45A 4A94A 5D8NA 4P44A 1YW4A 2PJ6A 2RFHA 2EK8A 1XJOA 1IGBA 1LFWA 2F7VA 3BI1A 2FVGA 2F8HA 3IIBA 3SJFA 1Z2LA 4OC5A 3VARA 2NSMA 2EWBA 4ZY2A 3NH8A 3D66A 5K8NA 2WYRA 3RAMA 3KHZA 2AFOA 2POKA 2Q43A 4NGPA 2GLJA 3IFEA 3IWWA 3L2NA 1F2OA 2C6GA 2ZEMA 4MHYA 3PRTA 5LYLA 4YU9A 4EFDA 2ZEOA 1TKHA 1BLLE 1ZG7A 3V38A 4A38A 3WT4A 2WZNA 4Z65A 3T8WA 4R6TA 3KHXA 3RZAA 3VATA 3IJ3A 2V8HA 1CP6A 2C6PA 3WC7A 2ZEFA 3D7GA 2CF4A 2Q4ZA 4PXDA 3KR4A 4RUHA 2XEFA 3NA6A 3D7HA 3FH4A 7CPAA 2GREA 4UIBA 1F57A 4MCSA 2PJ7A 5K8OA 1LAMA 2PE3A 4ZX9A 2PJ3A 1ELLP 3CDXA 2PJBA 1CG2A 4UEFA 4MHNA 3V7ZA 4WWVA 2CIJA 2PJ1A 1HDUA 4ONWA 4P10A 2V8DA 3NH5A 1Z8LA 1ZLIA 2CTCA 4MCRA 4ZYQA 3PB8X 4NGSA 3K2KA 2PJCA 4B6ZA 1BAVA 1F2PA 2XEGA 2J9AA 4WJBA 4MXUA 4EMEA 3FEEA 4O23A 4FAIA 1NSAA 2PJAA 2ZENA 3PEIA 5LRGA 3VH9A 2VL1A 3RBUA 3KQZA 3FVLA 1YLOA 3SJGA 4NFRA 4DUKA 1YMEA 3FX6A 3PFEA 3B3VA 4W9YA 6CPAA 3MRUA 4PXCA 1JQGA 3HLPA 4IHMA 1VHOA 4H2KA 1TF8A 2I3CA 4P6YA 5JH9A 2O53A 4X8IA 3ISXA 2RB7A 1XBUA 2AFUA 2AFWA 2ZEDA 1ZG9A 4F8ZA 4MRIA 2ANPA 2IQ6A 1Z5RA 2PVVA 4OC0A 3B35A 2ZOFA 3CPAA 1EE3P 1TKFA 1Y0YA 4P4EA 1ELMP 1ZG8A 5THWA 4OC4A 4MCPA 3D7DA 2QYVA 3KZWA 1CX8A 1OBRA 4UIAA 2XEIA 5DS0A 4EWTA 4FWUA 3NH4A 4F9VA 4PXEA 2HB6A 5D29A 1LOKA 3SI0A 1BPMA 1IY7A 1CBXA 2NYQA 4TNUA 2IJZA 2GLFA 2ZEPA 4G1PA 4K3NA 5CBMA 5LRKA 1CPXA 3FF3A 1QQ9A 3IC1A 3B3CA 4P4FA 4R76A 1LANA 1LCPA 5HXDA 2PJ5A 4MCQA 1VIXA 3KQXA 4R7MA 1CP7A 4UEEA 3H8EA 5HVFA 1RTQA 1TF9A 1HEEA 1YSJA 3BXMA 3CT9A 3PBEA 1ARMA 2V77A 2BO9A 2IMOA 2PIYA 2EK9A 5JGFA 2CTBA 4PXBA 1UWYA 4NGQA 4OKOA 4LQGA 2XEJA 4NGTA 4NGNA 5LYIA 2O4HA 4DYOA 3B2YA 5K8MA 4JZ0A 1XRYA 1R43A 2AFSA 3S9LA 4IK2A 2PJ0A 3NFZA 2BCOA 1Y0RA 2AFXA 3ISZA 1DE4C 2AFMA 5K8PA 4OMEA 1ARLA 4NJRA 3H8GA 8CPAA 1KWMA 2ZEHA 5JM6A 4OP4A 3TX8A 4F9UA 1DTDA 1QMUA 3PB6X 2OOTA 4BD9A 2PVWA 5ELYA 2ZOGA 2C6CA 4MMOA 4P4IA 2JBJA 2HC9A 3SJXA 4Q7AA 5LYFA 3DGVA 4NGMA 4KSIA 4X3RA 2PJ4A 3S9NA 3KR5A 4MHPA 4R8FA 4OC2A 3QNVA 3GUXA 3WABA 3KGQA 2BOAA 2ZELA 3D7FA 4ZY0A 3FMCA 1H8LA 2PCUA 3B3WA 3PFOA 2AFZA 2QVPA 3SI2A 3FECA 5LYDA 2JEWA 2V8GA 5HVGA 1XMBA 2PJ8A 1XFOA 1VHEA 3PB4X 4MHZA 5F09A 1TKJA 2ABZA
chains in the Genus database with same CATH superfamily
1PYTB 4UEZA 2PJ2A 1P4NA 2P6FA 4R57A 2G9DA 1IU8A 1CPSA 2DPSA 2WUUA 4JD6A 4UFWA 1N71A 1Y9WA 3R96A 3S9MA 3LWUA 3KL9A 4HPSA 4ZI6A 4OC3A 3V8IA 4TWEA 1R3NA 3FYNA 4BMHA 3P2FA 5IB9A 3D68A 1J4JA 1Y7RA 1LRZA 2A4NA 3N7ZA 4JYWA 3LMSA 4B10A 4KOSA 2EUIA 2ZEEA 1X12A 3KI9A 2PJ9A 3IEHA 2F5IA 3HUVA 4I49A 4ZX8A 4AVAA 4JJXA 3D2MA 1VGYA 3I1UA 3FJUA 1Z8TA 4C7IA 4A39A 3JRUA 2I00A 1GYTA 4M6IA 2VXKA 2REEA 5J1QA 4KUBA 3B7IA 3MN8A 3GY9A 3K9TA 3FEDA 2Q7BA 5H86A 3SXOA 2BEIA 4PQAA 4E2AA 3H4QA 2QJ8A 3GB0A 1BOBA 3F5BA 1L0CA 4UA3A 1ON0A 1M4LA 4AG9A 4QUSA 2FXFA 2G0BA 2OR4A 3KASA 3NE7A 5CPAA 2EVNA 1BPNA 3TO7A 3GKRA 3GLJA 4KLVA 4CGOA 2GU2A 5I4MA 5F48A 1I12A 4MHDA 5A28A 5FVJA 3D4UA 1AMPA 4X2TA 4CRYB 3PBBA 4PPZA 4ZY1A 4CAXA 5IX3A 1Y7EA 4QC6A 1FT7A 1K4JA 4FBEA 4FUUA 2B3VA 3SXNA 4DJLA 2AJ6A 2DEAA 2BSWA 3D2PA 4OLLA 3IO1A 4YWYA 3W6SA 1WWZA 1ZLHA 2K5TA 2PIZA 2FL4A 4P4JA 4M85A 1A2ZA 2O28A 3B3TA 5AG6A 3WC5A 4A32A 4C7HA 4DNCA 5HVHA 3PB7X 4JXRA 4OIWA 4CGNA 3DLJA 4MY3A 2P0WA 4NGRA 3S6GA 3CXSA 4P4BA 4NJQA 4A37A 1HDQA 2YNCA 4OADA 3D3SA 1AYEA 1YW6A 4IF5A 4MY0A 1Q7LA 5LRJA 1FNOA 3BI0A 3TC8A 1PCAA 1S5KA 4XPDC 2Z3OA 4K30A 4OIDA 4P4DA 4CAEA 3N5FA 4CPAA 1YX0A 3LODA 2AE6A 2Z3MA 2ZEGA 1S7KA 4EVYA 4F0YA 3H8FA 4B13A 5G21A 4AXVA 2JBKA 3UY5A 3B3SA 3PB9X 4B5OA 2Q0YA 3BHXA 2PRQA 3SJEA 4OC1A 1QSMA 3CPXA 4CYNA 2V8VA 4BINA 3SI1A 2C1CA 2Q51A 4MI4A 4B5PA 2GIVA 3W91A 4GM5A 1TXRA 2B5GB 1Z4RA 3D67A 4MBUA 5F46A 1LAPA 4GXHA 3R95A 3OWCA 4UF4A 3WC6A 3KKWA 4IAVA 4P45A 5G1ZA 4A94A 5D8NA 4P44A 1YW4A 1M4GA 2PJ6A 4QVTA 2RFHA 5KTCA 2EK8A 4UBRA 4FD7A 1XJOA 5DWNA 3S6KA 1IGBA 5G20A 1LFWA 2F7VA 3BI1A 2FVGA 4H6UA 4MJ8A 1IOIA 2F8HA 3IIBA 3SJFA 1Z2LA 3VWDA 4OC5A 1NSLA 4B12A 4CYPA 3VARA 1CM0A 2NSMA 5EMIA 2EWBA 4ZY2A 3NH8A 2PRBA 3D66A 3VWEA 2D4OA 1QSOA 5K8NA 2EBJA 2WYRA 4B5PB 5CNPA 3RAMA 2VI7A 2C27A 4AG7A 1XF8A 1U6MA 3KHZA 2AFOA 2POKA 4CRZB 2Z10A 5ISVA 3LACA 2B58A 2OB0A 2Q43A 4NGPA 2GLJA 4IUSA 3I3GA 3IFEA 3IWWA 5EBVA 3L2NA 2OZHA 2PSWA 1F2OA 4HKFA 2EO8A 1Q2YA 2C6GA 4JLYA 2ZEMA 4UFVA 4MHYA 3JUWA 3PRTA 5LYLA 2DXQA 4UFXA 1KUYA 4YU9A 4EFDA 2ZEOA 4KOUA 3T9YA 1BLLE 1NMTA 1TKHA 3TOAA 4X5KA 1ZG7A 3BJ8A 3R9FA 3FXTA 3V38A 4A38A 1QSTA 1M4DA 1Z8WA 2ZW6A 5HH1A 3WT4A 1MJ9A 2WZNA 2PDOA 2WSAA 4NEXA 3R9EA 1YLEA 3QAHA 4XPKA 3TCVA 4RS2A 3T8WA 4NXYA 4Z65A 1OZPA 4R6TA 3KHXA 3RZAA 3VATA 3IJ3A 2V8HA 1CP6A 3IU1A 4R3KA 2FE7A 4CYOA 2C6PA 3WC7A 4A30A 2ZEFA 4HNYB 3D7GA 2CF4A 4CGMA 2FCKA 2D4PA 2Q4ZA 4PXDA 1I21A 3IU2A 3KR4A 4JWPA 4RUHA 3FRMA 2XEFA 3IWEA 4CGLA 3NA6A 3D7HA 3FH4A 2JLMA 2ARHA 3GYAA 4FD5A 4KOWA 4NSQA 4ORFA 7CPAA 1IYKA 2GREA 2Q4YA 3H5ZA 4EWTA 2DPTA 4UIBA 5G22A 4KORA 1F57A 4MCSA 4U9ZA 4AB7A 2PJ7A 4A2ZA 5K8OA 1LAMA 2PE3A 2YNCC 4ZX9A 4CAFA 2ZW4A 2PJ3A 5HMNA 2VEZA 1ELLP 3CDXA 1S3ZA 2PJBA 1CG2A 1KZFA 5KTDA 2CNSA 4MHNA 4UEFA 3V7ZA 4WWVA 2CIJA 2PJ1A 2J8RA 4KOTA 1HDUA 4ONWA 4P10A 2V8DA 3RO0A 3NH5A 3PZJA 1ZLIA 1Z8LA 2CTCA 3EY5A 4MFPA 4MCRA 3PB8X 4ZYQA 2CXAA 4NGSA 3K2KA 2PJCA 4U5YA 2OZUA 4B6ZA 1S60A 5E96A 1BAVA 1F2PA 2FSRA 2J9AA 2XEGA 2IL4A 4WJBA 5I0CA 3QB8A 1KUVA 4MXUA 4Q38A 3T90A 4UWJA 2ZPAA 3CXPA 4H6ZA 2FIAA 4XNHB 1I1DA 2BUEA 4EMEA 2VBQA 3FEEA 3G3SA 4O23A 3TFYA 2H5MA 4FAIA 4KOVA 4OAEA 4LUAA 1NSAA 4LQ6A 2OU2A 1FY7A 2PJAA 2ZENA 3EFAA 3PEIA 5LRGA 3WR7A 4UCMA 1MK4A 3VH9A 2VL1A 5AG5A 3RBUA 3KQZA 1MJBA 1YLOA 3FVLA 3IGRA 3SJGA 4Y49B 2X7BA 4NFRA 4JXQA 2J8MA 2GFQA 4DUKA 1YMEA 3DNSA 3FX6A 4MFQA 3PFEA 3B3VA 1P0HA 3A9LA 3E0KA 4KS9A 2JEVA 4PV6A 2WPXA 4W9YA 4CS0B 3NE8A 4KVME 1YREA 1XE4A 3TT2A 3MRUA 3C26A 1M44A 4PXCA 5AGEA 4CAVA 6CPAA 1JQGA 3HLPA 4IHMA 1VHOA 4H2KA 1TF8A 2I3CA 2P6GA 4P6YA 3ZZIA 4E8OA 2CNMA 4R87A 4XPDB 2RC4A 5JH9A 1IB1E 2O53A 4F6AA 2ATRA 4X8IA 3ISXA 2RB7A 4MFKA 2OZGA 1XBUA 2AFUA 2AFWA 2VZZA 1ZG9A 2ZEDA 4F8ZA 3FNCA 4MRIA 5F49A 3K9UA 3JVNA 1CJWA 4KOYA 2ANPA 2IQ6A 5F47A 1YQEA 1Z5RA 3QAYA 5H84A 2R7HA 2PVVA 4OC0A 2Q44A 2JDDA 3B35A 2ZOFA 4YFJA 3CPAA 1EE3P 4GS4A 1TKFA 1Y0YA 4P4EA 2HV2A 4CGPA 5AG4A 1Q2DA 4FD6A 1ZO0A 1ELMP 1ZG8A 4KLWA 5THWA 4OC4A 4Y49C 4MCPA 3D7DA 4KSAA 4UCPA 2QYVA 3KZWA 5C88A 2ODFA 5IV0A 1CX8A 1OBRA 1SQHA 4UIAA 3TOBA 2XEIA 3IWGA 5DS0A 1QSNA 2ZW7A 2FS5A 3D8PA 3DR8A 2Z11A 2HUZA 2PR8A 1VHSA 3I9SA 2QIRA 1IOFA 2Q04A 4FWUA 4A95A 3NH4A 4J3GA 4C68A 4F9VA 2G3AA 4PXEA 4RI1A 4A31A 2HB6A 5D29A 5DWMA 2YGWA 1LOKA 4QBJA 1Z4EA 3SI0A 1MJAA 1BPMA 1IY7A 1CBXA 3B8GA 2NYQA 4TNUA 1GHEA 2HQYA 2IJZA 4YRHA 2GLFA 2Z3LA 2ZEPA 3CZXA 4H89A 3R9GA 4LX9A 4G1PA 3F8KA 4K3NA 5CBMA 3BJ7A 5LRKA 2ZXVA 5JPHA 1CPXA 2R1IA 3FF3A 1QQ9A 4KVOE 3DSBA 4ZGYB 3IC1A 4PSXA 2YNEA 1PUAA 3B3CA 3LD2A 4UWIA 4P4FA 4Q36A 4R76A 3SHPA 1LANA 2BL1A 4C2XA 1LCPA 5HXDA 2PJ5A 2QECA 4L89A 2Q7SA 4MCQA 5A27A 1VIXA 1Z8XA 2DF5A 3KQXA 4M6HA 4R7MA 2Z3KA 3TO9A 1CP7A 4C2ZA 4UEEA 3H8EA 3PGPA 2NMTA 1RTQA 1TF9A 1HEEA 1YSJA 3BXMA 3P2HA 3CT9A 5HVFA 4F0XA 2Z3PA 3FIXA 3PBEA 1ARMA 1VKCA 2V77A 2BO9A 2Y0MA 4FD4A 4PK3A 2IMOA 2FT0A 2PIYA 2CNTA 4NCZA 1RXTA 4C2YA 2P6EA 3G8WA 4XPLA 2EK9A 3GIUA 5JGFA 3EC4A 2CTBA 5EC4A 4QB9A 4CAWA 4RN7A 1IICA 4PXBA 1UWYA 1YR0A 4NGQA 1YK3A 1Q2CA 2XEJA 4LQGA 4NGTA 4NGNA 2O4HA 4OKOA 5LYIA 5J8FA 1XIXA 1Z9UA 1V0CA 2REFA 2Z0ZA 1Y9KA 4UCNA 2B4BA 3MGDA 1KUXA 4MFJA 4AVBA 4DYOA 2YNDA 3W6XA 3B2YA 2Z3NA 1YVOA 5K8MA 4JZ0A 1XRYA 3ZJ0A 1R43A 5IB0A 5J8CA 1NE9A 2AFSA 3S9LA 2G3TA 4IK2A 2PJ0A 4B14A 3NFZA 2BCOA 1Y0RA 2AFXA 4R3LA 4KVXA 4KZTA 5JQ4A 3BLNA 1DE4C 3ISZA 2GANA 2AFMA 2WPWA 5K8PA 5KTAA 4OMEA 1ARLA 1XOVA 1YVKA 2OH1A 2KCWA 4NJRA 1XEBA 3FBUA 2PQ8A 3H8GA 2ZW5A 4ZBGA 4KOXA 5BWAB 8CPAA 1KWMA 2ZEHA 5JM6A 4OP4A 2B4DA 3TX8A 2R8VA 2B5GA 1XMTA 1DTDA 1QMUA 1X10A 3EO4A 3PB6X 5GCNA 2OOTA 4F9UA 1S7LA 4II9A 4BD9A 3EXNA 4BBHA 2PVWA 5ELYA 1IIDA 2ZOGA 1B6BA 2GE3A 1TIQA 2FIWA 2JDCA 2PC1A 3RNZA 3TE4A 2C6CA 4L8AA 3PP9A 4MMOA 4XNHC 4B11A 4KSFA 4P4IA 2JBJA 2HC9A 3SJXA 5AG7A 4Q7AA 5C82A 5LYFA 3R1KA 3DGVA 4PK2A 1PU9A 4NGMA 4KSIA 1BO4A 2PJ4A 4X3RA 3S9NA 3KR5A 4MHPA 4R8FA 4M6GA 4OC2A 1UFHA 4PSWA 3QNVA 3GUXA 3WABA 3KGQA 2BOAA 2ZELA 2B3UA 2QMLA 4NF1A 3D7FA 4ZY0A 3RYOA 3S6HA 3FMCA 1H8LA 2PCUA 2I79A 3B3WA 1M4IA 4HNWB 1M1DA 3PFOA 3F0AA 1S7NA 4R9MA 2AFZA 4YGOA 2QVPA 4ONUA 3TTHA 3DR6A 1WK4A 2Q4VA 3SI2A 4E0AA 1RO5A 3FB3A 3FECA 5LYDA 2JEWA 2V8GA 1IYLA 2PR1A 1XMBA 2VQYA 4AVCA 5HVGA 1QSRA 1AUGA 2PJ8A 1XFOA 2R98A 3S6FA 4CYQA 3JTKA 4HNXB 2B4DB 1VHEA 4M3SA 2VZYA 3CXQA 1JWQA 1R57A 1B87A 1TKJA 2J8NA 3PB4X 4MHZA 3TO6A 5F09A 2CY2A 4A33A 4KUAA 4MFZA 4U9YA 1S7FA 1YGHA 4MFLA 3DDDA 2ABZA
chains in the Genus database with same CATH topology
1PYTB 4UEZA 2PJ2A 2G9DA 1CPSA 3S9MA 3LWUA 3KL9A 4ZI6A 4OC3A 4TWEA 1R3NA 5IB9A 3D68A 4JYWA 3LMSA 2ZEEA 3KI9A 2PJ9A 3IEHA 3HUVA 4ZX8A 1VGYA 3I1UA 3FJUA 4A39A 3JRUA 1GYTA 5J1QA 3B7IA 3MN8A 3K9TA 3FEDA 4PQAA 2QJ8A 3GB0A 1M4LA 3KASA 5CPAA 2OR4A 1BPNA 3GLJA 5I4MA 2GU2A 3D4UA 1AMPA 4X2TA 3PBBA 4PPZA 4ZY1A 1Y7EA 1FT7A 4FBEA 4FUUA 4DJLA 2DEAA 3IO1A 4YWYA 1ZLHA 2PIZA 4P4JA 3WC5A 3B3TA 5HVHA 3PB7X 4OIWA 3DLJA 4NGRA 4P4BA 4NJQA 4A37A 1HDQA 1AYEA 1YW6A 1Q7LA 5LRJA 1FNOA 3BI0A 3TC8A 1PCAA 4OIDA 4P4DA 4CPAA 3N5FA 2ZEGA 3H8FA 4AXVA 2JBKA 3B3SA 3PB9X 3BHXA 2PRQA 3SJEA 4OC1A 3CPXA 2V8VA 3SI1A 2C1CA 2Q51A 4GM5A 1TXRA 3D67A 1LAPA 4UF4A 3WC6A 4IAVA 4P45A 4A94A 5D8NA 4P44A 1YW4A 2PJ6A 2RFHA 2EK8A 1XJOA 1IGBA 1LFWA 2F7VA 3BI1A 2FVGA 2F8HA 3IIBA 3SJFA 1Z2LA 4OC5A 3VARA 2NSMA 2EWBA 4ZY2A 3NH8A 3D66A 5K8NA 2WYRA 3RAMA 3KHZA 2AFOA 2POKA 2Q43A 4NGPA 2GLJA 3IFEA 3IWWA 3L2NA 1F2OA 2C6GA 2ZEMA 4MHYA 3PRTA 5LYLA 4YU9A 4EFDA 2ZEOA 1TKHA 1BLLE 1ZG7A 3V38A 4A38A 3WT4A 2WZNA 4Z65A 3T8WA 4R6TA 3KHXA 3RZAA 3VATA 3IJ3A 2V8HA 1CP6A 2C6PA 3WC7A 2ZEFA 3D7GA 2CF4A 2Q4ZA 4PXDA 3KR4A 4RUHA 2XEFA 3NA6A 3D7HA 3FH4A 7CPAA 2GREA 4UIBA 1F57A 4MCSA 2PJ7A 5K8OA 1LAMA 2PE3A 4ZX9A 2PJ3A 1ELLP 3CDXA 2PJBA 1CG2A 4UEFA 4MHNA 3V7ZA 4WWVA 2CIJA 2PJ1A 1HDUA 4ONWA 4P10A 2V8DA 3NH5A 1Z8LA 1ZLIA 2CTCA 4MCRA 4ZYQA 3PB8X 4NGSA 3K2KA 2PJCA 4B6ZA 1BAVA 1F2PA 2XEGA 2J9AA 4WJBA 4MXUA 4EMEA 3FEEA 4O23A 4FAIA 1NSAA 2PJAA 2ZENA 3PEIA 5LRGA 3VH9A 2VL1A 3RBUA 3KQZA 3FVLA 1YLOA 3SJGA 4NFRA 4DUKA 1YMEA 3FX6A 3PFEA 3B3VA 4W9YA 6CPAA 3MRUA 4PXCA 1JQGA 3HLPA 4IHMA 1VHOA 4H2KA 1TF8A 2I3CA 4P6YA 5JH9A 2O53A 4X8IA 3ISXA 2RB7A 1XBUA 2AFUA 2AFWA 2ZEDA 1ZG9A 4F8ZA 4MRIA 2ANPA 2IQ6A 1Z5RA 2PVVA 4OC0A 3B35A 2ZOFA 3CPAA 1EE3P 1TKFA 1Y0YA 4P4EA 1ELMP 1ZG8A 5THWA 4OC4A 4MCPA 3D7DA 2QYVA 3KZWA 1CX8A 1OBRA 4UIAA 2XEIA 5DS0A 4EWTA 4FWUA 3NH4A 4F9VA 4PXEA 2HB6A 5D29A 1LOKA 3SI0A 1BPMA 1IY7A 1CBXA 2NYQA 4TNUA 2IJZA 2GLFA 2ZEPA 4G1PA 4K3NA 5CBMA 5LRKA 1CPXA 3FF3A 1QQ9A 3IC1A 3B3CA 4P4FA 4R76A 1LANA 1LCPA 5HXDA 2PJ5A 4MCQA 1VIXA 3KQXA 4R7MA 1CP7A 4UEEA 3H8EA 5HVFA 1RTQA 1TF9A 1HEEA 1YSJA 3BXMA 3CT9A 3PBEA 1ARMA 2V77A 2BO9A 2IMOA 2PIYA 2EK9A 5JGFA 2CTBA 4PXBA 1UWYA 4NGQA 4OKOA 4LQGA 2XEJA 4NGTA 4NGNA 5LYIA 2O4HA 4DYOA 3B2YA 5K8MA 4JZ0A 1XRYA 1R43A 2AFSA 3S9LA 4IK2A 2PJ0A 3NFZA 2BCOA 1Y0RA 2AFXA 3ISZA 1DE4C 2AFMA 5K8PA 4OMEA 1ARLA 4NJRA 3H8GA 8CPAA 1KWMA 2ZEHA 5JM6A 4OP4A 3TX8A 4F9UA 1DTDA 1QMUA 3PB6X 2OOTA 4BD9A 2PVWA 5ELYA 2ZOGA 2C6CA 4MMOA 4P4IA 2JBJA 2HC9A 3SJXA 4Q7AA 5LYFA 3DGVA 4NGMA 4KSIA 4X3RA 2PJ4A 3S9NA 3KR5A 4MHPA 4R8FA 4OC2A 3QNVA 3GUXA 3WABA 3KGQA 2BOAA 2ZELA 3D7FA 4ZY0A 3FMCA 1H8LA 2PCUA 3B3WA 3PFOA 2AFZA 2QVPA 3SI2A 3FECA 5LYDA 2JEWA 2V8GA 5HVGA 1XMBA 2PJ8A 1XFOA 1VHEA 3PB4X 4MHZA 5F09A 1TKJA 2ABZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PYT B;  4UEZ A;  2PJ2 A;  2G9D A;  1CPS A;  3S9M A;  3LWU A;  3KL9 A;  4ZI6 A;  4OC3 A;  4TWE A;  1R3N A;  5IB9 A;  3D68 A;  4JYW A;  3LMS A;  2ZEE A;  3KI9 A;  2PJ9 A;  3IEH A;  3HUV A;  4ZX8 A;  1VGY A;  3I1U A;  3FJU A;  4A39 A;  3JRU A;  1GYT A;  5J1Q A;  3B7I A;  3MN8 A;  3K9T A;  3FED A;  4PQA A;  2QJ8 A;  3GB0 A;  1M4L A;  3KAS A;  5CPA A;  2OR4 A;  1BPN A;  3GLJ A;  5I4M A;  2GU2 A;  3D4U A;  1AMP A;  4X2T A;  3PBB A;  4PPZ A;  4ZY1 A;  1Y7E A;  1FT7 A;  4FBE A;  4FUU A;  4DJL A;  2DEA A;  3IO1 A;  4YWY A;  1ZLH A;  2PIZ A;  4P4J A;  3WC5 A;  3B3T A;  5HVH A;  3PB7 X;  4OIW A;  3DLJ A;  4NGR A;  4P4B A;  4NJQ A;  4A37 A;  1HDQ A;  1AYE A;  1YW6 A;  1Q7L A;  5LRJ A;  1FNO A;  3BI0 A;  3TC8 A;  1PCA A;  4OID A;  4P4D A;  4CPA A;  3N5F A;  2ZEG A;  3H8F A;  4AXV A;  2JBK A;  3B3S A;  3PB9 X;  3BHX A;  2PRQ A;  3SJE A;  4OC1 A;  3CPX A;  2V8V A;  3SI1 A;  2C1C A;  2Q51 A;  4GM5 A;  1TXR A;  3D67 A;  1LAP A;  4UF4 A;  3WC6 A;  4IAV A;  4P45 A;  4A94 A;  5D8N A;  4P44 A;  1YW4 A;  2PJ6 A;  2RFH A;  2EK8 A;  1XJO A;  1IGB A;  1LFW A;  2F7V A;  3BI1 A;  2FVG A;  2F8H A;  3IIB A;  3SJF A;  1Z2L A;  4OC5 A;  3VAR A;  2NSM A;  2EWB A;  4ZY2 A;  3NH8 A;  3D66 A;  5K8N A;  2WYR A;  3RAM A;  3KHZ A;  2AFO A;  2POK A;  2Q43 A;  4NGP A;  2GLJ A;  3IFE A;  3IWW A;  3L2N A;  1F2O A;  2C6G A;  2ZEM A;  4MHY A;  3PRT A;  5LYL A;  4YU9 A;  4EFD A;  2ZEO A;  1TKH A;  1BLL E;  1ZG7 A;  3V38 A;  4A38 A;  3WT4 A;  2WZN A;  4Z65 A;  3T8W A;  4R6T A;  3KHX A;  3RZA A;  3VAT A;  3IJ3 A;  2V8H A;  1CP6 A;  2C6P A;  3WC7 A;  2ZEF A;  3D7G A;  2CF4 A;  2Q4Z A;  4PXD A;  3KR4 A;  4RUH A;  2XEF A;  3NA6 A;  3D7H A;  3FH4 A;  7CPA A;  2GRE A;  4UIB A;  1F57 A;  4MCS A;  2PJ7 A;  5K8O A;  1LAM A;  2PE3 A;  4ZX9 A;  2PJ3 A;  1ELL P;  3CDX A;  2PJB A;  1CG2 A;  4UEF A;  4MHN A;  3V7Z A;  4WWV A;  2CIJ A;  2PJ1 A;  1HDU A;  4ONW A;  4P10 A;  2V8D A;  3NH5 A;  1Z8L A;  1ZLI A;  2CTC A;  4MCR A;  4ZYQ A;  3PB8 X;  4NGS A;  3K2K A;  2PJC A;  4B6Z A;  1BAV A;  1F2P A;  2XEG A;  2J9A A;  4WJB A;  4MXU A;  4EME A;  3FEE A;  4O23 A;  4FAI A;  1NSA A;  2PJA A;  2ZEN A;  3PEI A;  5LRG A;  3VH9 A;  2VL1 A;  3RBU A;  3KQZ A;  3FVL A;  1YLO A;  3SJG A;  4NFR A;  4DUK A;  1YME A;  3FX6 A;  3PFE A;  3B3V A;  4W9Y A;  6CPA A;  3MRU A;  4PXC A;  1JQG A;  3HLP A;  4IHM A;  1VHO A;  4H2K A;  1TF8 A;  2I3C A;  4P6Y A;  5JH9 A;  2O53 A;  4X8I A;  3ISX A;  2RB7 A;  1XBU A;  2AFU A;  2AFW A;  2ZED A;  1ZG9 A;  4F8Z A;  4MRI A;  2ANP A;  2IQ6 A;  1Z5R A;  2PVV A;  4OC0 A;  3B35 A;  2ZOF A;  3CPA A;  1EE3 P;  1TKF A;  1Y0Y A;  4P4E A;  1ELM P;  1ZG8 A;  5THW A;  4OC4 A;  4MCP A;  3D7D A;  2QYV A;  3KZW A;  1CX8 A;  1OBR A;  4UIA A;  2XEI A;  5DS0 A;  4EWT A;  4FWU A;  3NH4 A;  4F9V A;  4PXE A;  2HB6 A;  5D29 A;  1LOK A;  3SI0 A;  1BPM A;  1IY7 A;  1CBX A;  2NYQ A;  4TNU A;  2IJZ A;  2GLF A;  2ZEP A;  4G1P A;  4K3N A;  5CBM A;  5LRK A;  1CPX A;  3FF3 A;  1QQ9 A;  3IC1 A;  3B3C A;  4P4F A;  4R76 A;  1LAN A;  1LCP A;  5HXD A;  2PJ5 A;  4MCQ A;  1VIX A;  3KQX A;  4R7M A;  1CP7 A;  4UEE A;  3H8E A;  5HVF A;  1RTQ A;  1TF9 A;  1HEE A;  1YSJ A;  3BXM A;  3CT9 A;  3PBE A;  1ARM A;  2V77 A;  2BO9 A;  2IMO A;  2PIY A;  2EK9 A;  5JGF A;  2CTB A;  4PXB A;  1UWY A;  4NGQ A;  4OKO A;  4LQG A;  2XEJ A;  4NGT A;  4NGN A;  5LYI A;  2O4H A;  4DYO A;  3B2Y A;  5K8M A;  4JZ0 A;  1XRY A;  1R43 A;  2AFS A;  3S9L A;  4IK2 A;  2PJ0 A;  3NFZ A;  2BCO A;  1Y0R A;  2AFX A;  3ISZ A;  1DE4 C;  2AFM A;  5K8P A;  4OME A;  1ARL A;  4NJR A;  3H8G A;  8CPA A;  1KWM A;  2ZEH A;  5JM6 A;  4OP4 A;  3TX8 A;  4F9U A;  1DTD A;  1QMU A;  3PB6 X;  2OOT A;  4BD9 A;  2PVW A;  5ELY A;  2ZOG A;  2C6C A;  4MMO A;  4P4I A;  2JBJ A;  2HC9 A;  3SJX A;  4Q7A A;  5LYF A;  3DGV A;  4NGM A;  4KSI A;  4X3R A;  2PJ4 A;  3S9N A;  3KR5 A;  4MHP A;  4R8F A;  4OC2 A;  3QNV A;  3GUX A;  3WAB A;  3KGQ A;  2BOA A;  2ZEL A;  3D7F A;  4ZY0 A;  3FMC A;  1H8L A;  2PCU A;  3B3W A;  3PFO A;  2AFZ A;  2QVP A;  3SI2 A;  3FEC A;  5LYD A;  2JEW A;  2V8G A;  5HVG A;  1XMB A;  2PJ8 A;  1XFO A;  1VHE A;  3PB4 X;  4MHZ A;  5F09 A;  1TKJ A;  2ABZ A; 
#chains in the Genus database with same CATH topology
 1PYT B;  4UEZ A;  2PJ2 A;  1P4N A;  2P6F A;  4R57 A;  2G9D A;  1IU8 A;  1CPS A;  2DPS A;  2WUU A;  4JD6 A;  4UFW A;  1N71 A;  1Y9W A;  3R96 A;  3S9M A;  3LWU A;  3KL9 A;  4HPS A;  4ZI6 A;  4OC3 A;  3V8I A;  4TWE A;  1R3N A;  3FYN A;  4BMH A;  3P2F A;  5IB9 A;  3D68 A;  1J4J A;  1Y7R A;  1LRZ A;  2A4N A;  3N7Z A;  4JYW A;  3LMS A;  4B10 A;  4KOS A;  2EUI A;  2ZEE A;  1X12 A;  3KI9 A;  2PJ9 A;  3IEH A;  2F5I A;  3HUV A;  4I49 A;  4ZX8 A;  4AVA A;  4JJX A;  3D2M A;  1VGY A;  3I1U A;  3FJU A;  1Z8T A;  4C7I A;  4A39 A;  3JRU A;  2I00 A;  1GYT A;  4M6I A;  2VXK A;  2REE A;  5J1Q A;  4KUB A;  3B7I A;  3MN8 A;  3GY9 A;  3K9T A;  3FED A;  2Q7B A;  5H86 A;  3SXO A;  2BEI A;  4PQA A;  4E2A A;  3H4Q A;  2QJ8 A;  3GB0 A;  1BOB A;  3F5B A;  1L0C A;  4UA3 A;  1ON0 A;  1M4L A;  4AG9 A;  4QUS A;  2FXF A;  2G0B A;  2OR4 A;  3KAS A;  3NE7 A;  5CPA A;  2EVN A;  1BPN A;  3TO7 A;  3GKR A;  3GLJ A;  4KLV A;  4CGO A;  2GU2 A;  5I4M A;  5F48 A;  1I12 A;  4MHD A;  5A28 A;  5FVJ A;  3D4U A;  1AMP A;  4X2T A;  4CRY B;  3PBB A;  4PPZ A;  4ZY1 A;  4CAX A;  5IX3 A;  1Y7E A;  4QC6 A;  1FT7 A;  1K4J A;  4FBE A;  4FUU A;  2B3V A;  3SXN A;  4DJL A;  2AJ6 A;  2DEA A;  2BSW A;  3D2P A;  4OLL A;  3IO1 A;  4YWY A;  3W6S A;  1WWZ A;  1ZLH A;  2K5T A;  2PIZ A;  2FL4 A;  4P4J A;  4M85 A;  1A2Z A;  2O28 A;  3B3T A;  5AG6 A;  3WC5 A;  4A32 A;  4C7H A;  4DNC A;  5HVH A;  3PB7 X;  4JXR A;  4OIW A;  4CGN A;  3DLJ A;  4MY3 A;  2P0W A;  4NGR A;  3S6G A;  3CXS A;  4P4B A;  4NJQ A;  4A37 A;  1HDQ A;  2YNC A;  4OAD A;  3D3S A;  1AYE A;  1YW6 A;  4IF5 A;  4MY0 A;  1Q7L A;  5LRJ A;  1FNO A;  3BI0 A;  3TC8 A;  1PCA A;  1S5K A;  4XPD C;  2Z3O A;  4K30 A;  4OID A;  4P4D A;  4CAE A;  3N5F A;  4CPA A;  1YX0 A;  3LOD A;  2AE6 A;  2Z3M A;  2ZEG A;  1S7K A;  4EVY A;  4F0Y A;  3H8F A;  4B13 A;  5G21 A;  4AXV A;  2JBK A;  3UY5 A;  3B3S A;  3PB9 X;  4B5O A;  2Q0Y A;  3BHX A;  2PRQ A;  3SJE A;  4OC1 A;  1QSM A;  3CPX A;  4CYN A;  2V8V A;  4BIN A;  3SI1 A;  2C1C A;  2Q51 A;  4MI4 A;  4B5P A;  2GIV A;  3W91 A;  4GM5 A;  1TXR A;  2B5G B;  1Z4R A;  3D67 A;  4MBU A;  5F46 A;  1LAP A;  4GXH A;  3R95 A;  3OWC A;  4UF4 A;  3WC6 A;  3KKW A;  4IAV A;  4P45 A;  5G1Z A;  4A94 A;  5D8N A;  4P44 A;  1YW4 A;  1M4G A;  2PJ6 A;  4QVT A;  2RFH A;  5KTC A;  2EK8 A;  4UBR A;  4FD7 A;  1XJO A;  5DWN A;  3S6K A;  1IGB A;  5G20 A;  1LFW A;  2F7V A;  3BI1 A;  2FVG A;  4H6U A;  4MJ8 A;  1IOI A;  2F8H A;  3IIB A;  3SJF A;  1Z2L A;  3VWD A;  4OC5 A;  1NSL A;  4B12 A;  4CYP A;  3VAR A;  1CM0 A;  2NSM A;  5EMI A;  2EWB A;  4ZY2 A;  3NH8 A;  2PRB A;  3D66 A;  3VWE A;  2D4O A;  1QSO A;  5K8N A;  2EBJ A;  2WYR A;  4B5P B;  5CNP A;  3RAM A;  2VI7 A;  2C27 A;  4AG7 A;  1XF8 A;  1U6M A;  3KHZ A;  2AFO A;  2POK A;  4CRZ B;  2Z10 A;  5ISV A;  3LAC A;  2B58 A;  2OB0 A;  2Q43 A;  4NGP A;  2GLJ A;  4IUS A;  3I3G A;  3IFE A;  3IWW A;  5EBV A;  3L2N A;  2OZH A;  2PSW A;  1F2O A;  4HKF A;  2EO8 A;  1Q2Y A;  2C6G A;  4JLY A;  2ZEM A;  4UFV A;  4MHY A;  3JUW A;  3PRT A;  5LYL A;  2DXQ A;  4UFX A;  1KUY A;  4YU9 A;  4EFD A;  2ZEO A;  4KOU A;  3T9Y A;  1BLL E;  1NMT A;  1TKH A;  3TOA A;  4X5K A;  1ZG7 A;  3BJ8 A;  3R9F A;  3FXT A;  3V38 A;  4A38 A;  1QST A;  1M4D A;  1Z8W A;  2ZW6 A;  5HH1 A;  3WT4 A;  1MJ9 A;  2WZN A;  2PDO A;  2WSA A;  4NEX A;  3R9E A;  1YLE A;  3QAH A;  4XPK A;  3TCV A;  4RS2 A;  3T8W A;  4NXY A;  4Z65 A;  1OZP A;  4R6T A;  3KHX A;  3RZA A;  3VAT A;  3IJ3 A;  2V8H A;  1CP6 A;  3IU1 A;  4R3K A;  2FE7 A;  4CYO A;  2C6P A;  3WC7 A;  4A30 A;  2ZEF A;  4HNY B;  3D7G A;  2CF4 A;  4CGM A;  2FCK A;  2D4P A;  2Q4Z A;  4PXD A;  1I21 A;  3IU2 A;  3KR4 A;  4JWP A;  4RUH A;  3FRM A;  2XEF A;  3IWE A;  4CGL A;  3NA6 A;  3D7H A;  3FH4 A;  2JLM A;  2ARH A;  3GYA A;  4FD5 A;  4KOW A;  4NSQ A;  4ORF A;  7CPA A;  1IYK A;  2GRE A;  2Q4Y A;  3H5Z A;  4EWT A;  2DPT A;  4UIB A;  5G22 A;  4KOR A;  1F57 A;  4MCS A;  4U9Z A;  4AB7 A;  2PJ7 A;  4A2Z A;  5K8O A;  1LAM A;  2PE3 A;  2YNC C;  4ZX9 A;  4CAF A;  2ZW4 A;  2PJ3 A;  5HMN A;  2VEZ A;  1ELL P;  3CDX A;  1S3Z A;  2PJB A;  1CG2 A;  1KZF A;  5KTD A;  2CNS A;  4MHN A;  4UEF A;  3V7Z A;  4WWV A;  2CIJ A;  2PJ1 A;  2J8R A;  4KOT A;  1HDU A;  4ONW A;  4P10 A;  2V8D A;  3RO0 A;  3NH5 A;  3PZJ A;  1ZLI A;  1Z8L A;  2CTC A;  3EY5 A;  4MFP A;  4MCR A;  3PB8 X;  4ZYQ A;  2CXA A;  4NGS A;  3K2K A;  2PJC A;  4U5Y A;  2OZU A;  4B6Z A;  1S60 A;  5E96 A;  1BAV A;  1F2P A;  2FSR A;  2J9A A;  2XEG A;  2IL4 A;  4WJB A;  5I0C A;  3QB8 A;  1KUV A;  4MXU A;  4Q38 A;  3T90 A;  4UWJ A;  2ZPA A;  3CXP A;  4H6Z A;  2FIA A;  4XNH B;  1I1D A;  2BUE A;  4EME A;  2VBQ A;  3FEE A;  3G3S A;  4O23 A;  3TFY A;  2H5M A;  4FAI A;  4KOV A;  4OAE A;  4LUA A;  1NSA A;  4LQ6 A;  2OU2 A;  1FY7 A;  2PJA A;  2ZEN A;  3EFA A;  3PEI A;  5LRG A;  3WR7 A;  4UCM A;  1MK4 A;  3VH9 A;  2VL1 A;  5AG5 A;  3RBU A;  3KQZ A;  1MJB A;  1YLO A;  3FVL A;  3IGR A;  3SJG A;  4Y49 B;  2X7B A;  4NFR A;  4JXQ A;  2J8M A;  2GFQ A;  4DUK A;  1YME A;  3DNS A;  3FX6 A;  4MFQ A;  3PFE A;  3B3V A;  1P0H A;  3A9L A;  3E0K A;  4KS9 A;  2JEV A;  4PV6 A;  2WPX A;  4W9Y A;  4CS0 B;  3NE8 A;  4KVM E;  1YRE A;  1XE4 A;  3TT2 A;  3MRU A;  3C26 A;  1M44 A;  4PXC A;  5AGE A;  4CAV A;  6CPA A;  1JQG A;  3HLP A;  4IHM A;  1VHO A;  4H2K A;  1TF8 A;  2I3C A;  2P6G A;  4P6Y A;  3ZZI A;  4E8O A;  2CNM A;  4R87 A;  4XPD B;  2RC4 A;  5JH9 A;  1IB1 E;  2O53 A;  4F6A A;  2ATR A;  4X8I A;  3ISX A;  2RB7 A;  4MFK A;  2OZG A;  1XBU A;  2AFU A;  2AFW A;  2VZZ A;  1ZG9 A;  2ZED A;  4F8Z A;  3FNC A;  4MRI A;  5F49 A;  3K9U A;  3JVN A;  1CJW A;  4KOY A;  2ANP A;  2IQ6 A;  5F47 A;  1YQE A;  1Z5R A;  3QAY A;  5H84 A;  2R7H A;  2PVV A;  4OC0 A;  2Q44 A;  2JDD A;  3B35 A;  2ZOF A;  4YFJ A;  3CPA A;  1EE3 P;  4GS4 A;  1TKF A;  1Y0Y A;  4P4E A;  2HV2 A;  4CGP A;  5AG4 A;  1Q2D A;  4FD6 A;  1ZO0 A;  1ELM P;  1ZG8 A;  4KLW A;  5THW A;  4OC4 A;  4Y49 C;  4MCP A;  3D7D A;  4KSA A;  4UCP A;  2QYV A;  3KZW A;  5C88 A;  2ODF A;  5IV0 A;  1CX8 A;  1OBR A;  1SQH A;  4UIA A;  3TOB A;  2XEI A;  3IWG A;  5DS0 A;  1QSN A;  2ZW7 A;  2FS5 A;  3D8P A;  3DR8 A;  2Z11 A;  2HUZ A;  2PR8 A;  1VHS A;  3I9S A;  2QIR A;  1IOF A;  2Q04 A;  4FWU A;  4A95 A;  3NH4 A;  4J3G A;  4C68 A;  4F9V A;  2G3A A;  4PXE A;  4RI1 A;  4A31 A;  2HB6 A;  5D29 A;  5DWM A;  2YGW A;  1LOK A;  4QBJ A;  1Z4E A;  3SI0 A;  1MJA A;  1BPM A;  1IY7 A;  1CBX A;  3B8G A;  2NYQ A;  4TNU A;  1GHE A;  2HQY A;  2IJZ A;  4YRH A;  2GLF A;  2Z3L A;  2ZEP A;  3CZX A;  4H89 A;  3R9G A;  4LX9 A;  4G1P A;  3F8K A;  4K3N A;  5CBM A;  3BJ7 A;  5LRK A;  2ZXV A;  5JPH A;  1CPX A;  2R1I A;  3FF3 A;  1QQ9 A;  4KVO E;  3DSB A;  4ZGY B;  3IC1 A;  4PSX A;  2YNE A;  1PUA A;  3B3C A;  3LD2 A;  4UWI A;  4P4F A;  4Q36 A;  4R76 A;  3SHP A;  1LAN A;  2BL1 A;  4C2X A;  1LCP A;  5HXD A;  2PJ5 A;  2QEC A;  4L89 A;  2Q7S A;  4MCQ A;  5A27 A;  1VIX A;  1Z8X A;  2DF5 A;  3KQX A;  4M6H A;  4R7M A;  2Z3K A;  3TO9 A;  1CP7 A;  4C2Z A;  4UEE A;  3H8E A;  3PGP A;  2NMT A;  1RTQ A;  1TF9 A;  1HEE A;  1YSJ A;  3BXM A;  3P2H A;  3CT9 A;  5HVF A;  4F0X A;  2Z3P A;  3FIX A;  3PBE A;  1ARM A;  1VKC A;  2V77 A;  2BO9 A;  2Y0M A;  4FD4 A;  4PK3 A;  2IMO A;  2FT0 A;  2PIY A;  2CNT A;  4NCZ A;  1RXT A;  4C2Y A;  2P6E A;  3G8W A;  4XPL A;  2EK9 A;  3GIU A;  5JGF A;  3EC4 A;  2CTB A;  5EC4 A;  4QB9 A;  4CAW A;  4RN7 A;  1IIC A;  4PXB A;  1UWY A;  1YR0 A;  4NGQ A;  1YK3 A;  1Q2C A;  2XEJ A;  4LQG A;  4NGT A;  4NGN A;  2O4H A;  4OKO A;  5LYI A;  5J8F A;  1XIX A;  1Z9U A;  1V0C A;  2REF A;  2Z0Z A;  1Y9K A;  4UCN A;  2B4B A;  3MGD A;  1KUX A;  4MFJ A;  4AVB A;  4DYO A;  2YND A;  3W6X A;  3B2Y A;  2Z3N A;  1YVO A;  5K8M A;  4JZ0 A;  1XRY A;  3ZJ0 A;  1R43 A;  5IB0 A;  5J8C A;  1NE9 A;  2AFS A;  3S9L A;  2G3T A;  4IK2 A;  2PJ0 A;  4B14 A;  3NFZ A;  2BCO A;  1Y0R A;  2AFX A;  4R3L A;  4KVX A;  4KZT A;  5JQ4 A;  3BLN A;  1DE4 C;  3ISZ A;  2GAN A;  2AFM A;  2WPW A;  5K8P A;  5KTA A;  4OME A;  1ARL A;  1XOV A;  1YVK A;  2OH1 A;  2KCW A;  4NJR A;  1XEB A;  3FBU A;  2PQ8 A;  3H8G A;  2ZW5 A;  4ZBG A;  4KOX A;  5BWA B;  8CPA A;  1KWM A;  2ZEH A;  5JM6 A;  4OP4 A;  2B4D A;  3TX8 A;  2R8V A;  2B5G A;  1XMT A;  1DTD A;  1QMU A;  1X10 A;  3EO4 A;  3PB6 X;  5GCN A;  2OOT A;  4F9U A;  1S7L A;  4II9 A;  4BD9 A;  3EXN A;  4BBH A;  2PVW A;  5ELY A;  1IID A;  2ZOG A;  1B6B A;  2GE3 A;  1TIQ A;  2FIW A;  2JDC A;  2PC1 A;  3RNZ A;  3TE4 A;  2C6C A;  4L8A A;  3PP9 A;  4MMO A;  4XNH C;  4B11 A;  4KSF A;  4P4I A;  2JBJ A;  2HC9 A;  3SJX A;  5AG7 A;  4Q7A A;  5C82 A;  5LYF A;  3R1K A;  3DGV A;  4PK2 A;  1PU9 A;  4NGM A;  4KSI A;  1BO4 A;  2PJ4 A;  4X3R A;  3S9N A;  3KR5 A;  4MHP A;  4R8F A;  4M6G A;  4OC2 A;  1UFH A;  4PSW A;  3QNV A;  3GUX A;  3WAB A;  3KGQ A;  2BOA A;  2ZEL A;  2B3U A;  2QML A;  4NF1 A;  3D7F A;  4ZY0 A;  3RYO A;  3S6H A;  3FMC A;  1H8L A;  2PCU A;  2I79 A;  3B3W A;  1M4I A;  4HNW B;  1M1D A;  3PFO A;  3F0A A;  1S7N A;  4R9M A;  2AFZ A;  4YGO A;  2QVP A;  4ONU A;  3TTH A;  3DR6 A;  1WK4 A;  2Q4V A;  3SI2 A;  4E0A A;  1RO5 A;  3FB3 A;  3FEC A;  5LYD A;  2JEW A;  2V8G A;  1IYL A;  2PR1 A;  1XMB A;  2VQY A;  4AVC A;  5HVG A;  1QSR A;  1AUG A;  2PJ8 A;  1XFO A;  2R98 A;  3S6F A;  4CYQ A;  3JTK A;  4HNX B;  2B4D B;  1VHE A;  4M3S A;  2VZY A;  3CXQ A;  1JWQ A;  1R57 A;  1B87 A;  1TKJ A;  2J8N A;  3PB4 X;  4MHZ A;  3TO6 A;  5F09 A;  2CY2 A;  4A33 A;  4KUA A;  4MFZ A;  4U9Y A;  1S7F A;  1YGH A;  4MFL A;  3DDD A;  2ABZ A; 
#chains in the Genus database with same CATH homology
 1PYT B;  4UEZ A;  2PJ2 A;  2G9D A;  1CPS A;  3S9M A;  3LWU A;  3KL9 A;  4ZI6 A;  4OC3 A;  4TWE A;  1R3N A;  5IB9 A;  3D68 A;  4JYW A;  3LMS A;  2ZEE A;  3KI9 A;  2PJ9 A;  3IEH A;  3HUV A;  4ZX8 A;  1VGY A;  3I1U A;  3FJU A;  4A39 A;  3JRU A;  1GYT A;  5J1Q A;  3B7I A;  3MN8 A;  3K9T A;  3FED A;  4PQA A;  2QJ8 A;  3GB0 A;  1M4L A;  3KAS A;  5CPA A;  2OR4 A;  1BPN A;  3GLJ A;  5I4M A;  2GU2 A;  3D4U A;  1AMP A;  4X2T A;  3PBB A;  4PPZ A;  4ZY1 A;  1Y7E A;  1FT7 A;  4FBE A;  4FUU A;  4DJL A;  2DEA A;  3IO1 A;  4YWY A;  1ZLH A;  2PIZ A;  4P4J A;  3WC5 A;  3B3T A;  5HVH A;  3PB7 X;  4OIW A;  3DLJ A;  4NGR A;  4P4B A;  4NJQ A;  4A37 A;  1HDQ A;  1AYE A;  1YW6 A;  1Q7L A;  5LRJ A;  1FNO A;  3BI0 A;  3TC8 A;  1PCA A;  4OID A;  4P4D A;  4CPA A;  3N5F A;  2ZEG A;  3H8F A;  4AXV A;  2JBK A;  3B3S A;  3PB9 X;  3BHX A;  2PRQ A;  3SJE A;  4OC1 A;  3CPX A;  2V8V A;  3SI1 A;  2C1C A;  2Q51 A;  4GM5 A;  1TXR A;  3D67 A;  1LAP A;  4UF4 A;  3WC6 A;  4IAV A;  4P45 A;  4A94 A;  5D8N A;  4P44 A;  1YW4 A;  2PJ6 A;  2RFH A;  2EK8 A;  1XJO A;  1IGB A;  1LFW A;  2F7V A;  3BI1 A;  2FVG A;  2F8H A;  3IIB A;  3SJF A;  1Z2L A;  4OC5 A;  3VAR A;  2NSM A;  2EWB A;  4ZY2 A;  3NH8 A;  3D66 A;  5K8N A;  2WYR A;  3RAM A;  3KHZ A;  2AFO A;  2POK A;  2Q43 A;  4NGP A;  2GLJ A;  3IFE A;  3IWW A;  3L2N A;  1F2O A;  2C6G A;  2ZEM A;  4MHY A;  3PRT A;  5LYL A;  4YU9 A;  4EFD A;  2ZEO A;  1TKH A;  1BLL E;  1ZG7 A;  3V38 A;  4A38 A;  3WT4 A;  2WZN A;  4Z65 A;  3T8W A;  4R6T A;  3KHX A;  3RZA A;  3VAT A;  3IJ3 A;  2V8H A;  1CP6 A;  2C6P A;  3WC7 A;  2ZEF A;  3D7G A;  2CF4 A;  2Q4Z A;  4PXD A;  3KR4 A;  4RUH A;  2XEF A;  3NA6 A;  3D7H A;  3FH4 A;  7CPA A;  2GRE A;  4UIB A;  1F57 A;  4MCS A;  2PJ7 A;  5K8O A;  1LAM A;  2PE3 A;  4ZX9 A;  2PJ3 A;  1ELL P;  3CDX A;  2PJB A;  1CG2 A;  4UEF A;  4MHN A;  3V7Z A;  4WWV A;  2CIJ A;  2PJ1 A;  1HDU A;  4ONW A;  4P10 A;  2V8D A;  3NH5 A;  1Z8L A;  1ZLI A;  2CTC A;  4MCR A;  4ZYQ A;  3PB8 X;  4NGS A;  3K2K A;  2PJC A;  4B6Z A;  1BAV A;  1F2P A;  2XEG A;  2J9A A;  4WJB A;  4MXU A;  4EME A;  3FEE A;  4O23 A;  4FAI A;  1NSA A;  2PJA A;  2ZEN A;  3PEI A;  5LRG A;  3VH9 A;  2VL1 A;  3RBU A;  3KQZ A;  3FVL A;  1YLO A;  3SJG A;  4NFR A;  4DUK A;  1YME A;  3FX6 A;  3PFE A;  3B3V A;  4W9Y A;  6CPA A;  3MRU A;  4PXC A;  1JQG A;  3HLP A;  4IHM A;  1VHO A;  4H2K A;  1TF8 A;  2I3C A;  4P6Y A;  5JH9 A;  2O53 A;  4X8I A;  3ISX A;  2RB7 A;  1XBU A;  2AFU A;  2AFW A;  2ZED A;  1ZG9 A;  4F8Z A;  4MRI A;  2ANP A;  2IQ6 A;  1Z5R A;  2PVV A;  4OC0 A;  3B35 A;  2ZOF A;  3CPA A;  1EE3 P;  1TKF A;  1Y0Y A;  4P4E A;  1ELM P;  1ZG8 A;  5THW A;  4OC4 A;  4MCP A;  3D7D A;  2QYV A;  3KZW A;  1CX8 A;  1OBR A;  4UIA A;  2XEI A;  5DS0 A;  4EWT A;  4FWU A;  3NH4 A;  4F9V A;  4PXE A;  2HB6 A;  5D29 A;  1LOK A;  3SI0 A;  1BPM A;  1IY7 A;  1CBX A;  2NYQ A;  4TNU A;  2IJZ A;  2GLF A;  2ZEP A;  4G1P A;  4K3N A;  5CBM A;  5LRK A;  1CPX A;  3FF3 A;  1QQ9 A;  3IC1 A;  3B3C A;  4P4F A;  4R76 A;  1LAN A;  1LCP A;  5HXD A;  2PJ5 A;  4MCQ A;  1VIX A;  3KQX A;  4R7M A;  1CP7 A;  4UEE A;  3H8E A;  5HVF A;  1RTQ A;  1TF9 A;  1HEE A;  1YSJ A;  3BXM A;  3CT9 A;  3PBE A;  1ARM A;  2V77 A;  2BO9 A;  2IMO A;  2PIY A;  2EK9 A;  5JGF A;  2CTB A;  4PXB A;  1UWY A;  4NGQ A;  4OKO A;  4LQG A;  2XEJ A;  4NGT A;  4NGN A;  5LYI A;  2O4H A;  4DYO A;  3B2Y A;  5K8M A;  4JZ0 A;  1XRY A;  1R43 A;  2AFS A;  3S9L A;  4IK2 A;  2PJ0 A;  3NFZ A;  2BCO A;  1Y0R A;  2AFX A;  3ISZ A;  1DE4 C;  2AFM A;  5K8P A;  4OME A;  1ARL A;  4NJR A;  3H8G A;  8CPA A;  1KWM A;  2ZEH A;  5JM6 A;  4OP4 A;  3TX8 A;  4F9U A;  1DTD A;  1QMU A;  3PB6 X;  2OOT A;  4BD9 A;  2PVW A;  5ELY A;  2ZOG A;  2C6C A;  4MMO A;  4P4I A;  2JBJ A;  2HC9 A;  3SJX A;  4Q7A A;  5LYF A;  3DGV A;  4NGM A;  4KSI A;  4X3R A;  2PJ4 A;  3S9N A;  3KR5 A;  4MHP A;  4R8F A;  4OC2 A;  3QNV A;  3GUX A;  3WAB A;  3KGQ A;  2BOA A;  2ZEL A;  3D7F A;  4ZY0 A;  3FMC A;  1H8L A;  2PCU A;  3B3W A;  3PFO A;  2AFZ A;  2QVP A;  3SI2 A;  3FEC A;  5LYD A;  2JEW A;  2V8G A;  5HVG A;  1XMB A;  2PJ8 A;  1XFO A;  1VHE A;  3PB4 X;  4MHZ A;  5F09 A;  1TKJ A;  2ABZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...