2AFZA

Crystal structure of human glutaminyl cyclase in complex with 1-vinylimidazole
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title Crystal structures of human glutaminyl cyclase, an enzyme responsible for protein N-terminal pyroglutamate formation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 111
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2afzA00
4WWVA 5CPAA 3WC7A 3D7GA 1VIXA 4IK2A 1XFOA 2XEJA 3B3CA 5K8OA 4R8FA 2CIJA 1YLOA 4NJQA 4ZX9A 7CPAA 2HB6A 4P4IA 5JGFA 2OOTA 2ZEPA 2V8DA 5DS0A 5LRKA 4UF4A 3LMSA 5LRJA 4OP4A 3FMCA 5THWA 4CPAA 3QNVA 3S9MA 3PB6X 2ABZA 4NGPA 1Y0RA 2JBKA 2PJ5A 2AFSA 1CX8A 2XEGA 3PB8X 1HDQA 3D4UA 3HLPA 1TKJA 3WC6A 3H8FA 4ZY1A 5K8NA 4K3NA 1CPXA 4A37A 3V38A 4TWEA 2PJ1A 4ZY2A 2IJZA 3PB4X 1LAMA 3TX8A 3ISXA 6CPAA 1CPSA 2ZEEA 1BPMA 1LAPA 4DJLA 4MHNA 4OMEA 3PEIA 2HC9A 4X3RA 4OC5A 2NSMA 1R3NA 3D7DA 2AFZA 2PIZA 2XEFA 2DEAA 4AXVA 3KZWA 5LYIA 2F7VA 4X8IA 2VL1A 3NH4A 3H8GA 1BLLE 2IQ6A 1HEEA 1NSAA 2BCOA 1H8LA 3MRUA 4UEFA 5JM6A 5K8PA 3FECA 3GUXA 3NH8A 4UIAA 3L2NA 1TKFA 3BI0A 3NFZA 2ZOFA 2ANPA 3PFEA 4UEEA 2PCUA 1DTDA 4MRIA 4P6YA 3SJXA 2PJ6A 1TKHA 5F09A 4NGSA 2CF4A 2PJ0A 3DLJA 3KASA 5LYLA 2AFOA 4OIWA 4P45A 3SI2A 1QQ9A 4LQGA 3H8EA 2WYRA 5HVHA 4A39A 2V8VA 4P4EA 3KQXA 1XMBA 1TF8A 3FJUA 3FVLA 3CDXA 1VHEA 4OC0A 4MHPA 3I1UA 4ZYQA 1Q7LA 1M4LA 3SI0A 4MCRA 3GLJA 2V8HA 1RTQA 3B3WA 2PVWA 4NGQA 3SI1A 1HDUA 2Q4ZA 2PJ9A 4P44A 2O53A 3IEHA 4OIDA 4NFRA 1JQGA 2G9DA 2I3CA 3CT9A 2PVVA 4G1PA 1Y7EA 3BI1A 4NGNA 4IHMA 5LYDA 1ELLP 3TC8A 3SJGA 3S9LA 3IIBA 3KHZA 2PJ2A 3PFOA 3KR4A 2EK9A 2AFWA 3D7FA 3B3TA 2AFMA 4UEZA 3PBBA 4F8ZA 4MCQA 2C6CA 3IFEA 2ZEFA 2AFXA 2JBJA 4P4FA 2PJ4A 4OC2A 1XRYA 3PRTA 1YW6A 3D68A 3FEDA 1GYTA 2RB7A 4YWYA 4R7MA 8CPAA 2BO9A 1LFWA 1ZLHA 3PB7X 3K2KA 3LWUA 2IMOA 4P4JA 2AFUA 3IJ3A 1Z8LA 2OR4A 4B6ZA 5JH9A 3ISZA 5LYFA 4ONWA 4ZI6A 5K8MA 3N5FA 2PJ3A 2PE3A 3KL9A 4FBEA 2PIYA 1IGBA 4OC4A 5J1QA 1AYEA 4ZX8A 3NA6A 3SJFA 3RAMA 2CTCA 4NGMA 1ZG7A 3BHXA 3KGQA 1CP7A 4JZ0A 1TF9A 4FAIA 4YU9A 3WABA 4H2KA 1XBUA 1YSJA 4EFDA 1F2PA 1BPNA 4P10A 2PJ7A 4PPZA 2EWBA 4X2TA 2GREA 2PJAA 2GU2A 2ZEDA 3BXMA 2BOAA 2JEWA 5HVGA 2QVPA 1IY7A 3VH9A 4Q7AA 1DE4C 3NH5A 2V77A 2PRQA 5HVFA 3CPAA 2EK8A 1UWYA 3SJEA 4MMOA 3B3SA 1CP6A 4ZY0A 3IWWA 3D67A 4JYWA 2ZELA 4TNUA 4OC3A 1XJOA 4P4DA 4FWUA 3D66A 3B3VA 2PJCA 3IC1A 1VHOA 5ELYA 3PB9X 3VARA 3FF3A 4A94A 1YW4A 3B2YA 4F9VA 1YMEA 5CBMA 3T8WA 4RUHA 4BD9A 2GLJA 3B35A 1KWMA 2ZOGA 4Z65A 3V7ZA 3WC5A 1LCPA 3DGVA 4PQAA 3FX6A 3RBUA 1BAVA 5LRGA 2ZEHA 1PYTB 2F8HA 2WZNA 4DUKA 1FNOA 3PBEA 3FEEA 1F2OA 4OC1A 3KI9A 2RFHA 4FUUA 4O23A 1QMUA 3CPXA 3K9TA 2QJ8A 2ZEOA 4F9UA 4R76A 4W9YA 5D29A 3RZAA 4EMEA 3WT4A 2C6GA 3S9NA 1EE3P 2V8GA 2CTBA 5HXDA 1Y0YA 2NYQA 5D8NA 4PXCA 2C6PA 2O4HA 2POKA 4MCPA 3B7IA 1PCAA 3HUVA 4NGTA 4MXUA 1CBXA 4PXEA 1CG2A 2PJBA 4OKOA 5I4MA 3IO1A 1ARMA 2ZEMA 4KSIA 2Q43A 3MN8A 2XEIA 1ZG9A 2FVGA 2QYVA 2Q51A 4IAVA 1OBRA 4A38A 4R6TA 3VATA 4P4BA 3FH4A 4GM5A 4UIBA 2J9AA 4MCSA 3JRUA 4PXDA 2ZENA 1ELMP 2ZEGA 1LANA 1TXRA 1ZG8A 1Z2LA 2GLFA 3KHXA 1AMPA 1LOKA 4WJBA 1Z5RA 3KQZA 4NJRA 1F57A 3GB0A 1FT7A 4DYOA 5IB9A 1VGYA 1R43A 2PJ8A 4NGRA 1ARLA 3KR5A 4MHYA 1ZLIA 2C1CA 4EWTA 3D7HA 4MHZA 4PXBA
chains in the Genus database with same CATH superfamily
4WWVA 2Q04A 3R95A 5CPAA 3WC7A 4HNXB 1NSLA 3D7GA 5AG6A 1VIXA 2FXFA 1S7KA 1XFOA 2D4PA 4IK2A 2CXAA 4FD4A 2XEJA 1NE9A 3B3CA 3QAHA 4ZGYB 5K8OA 1QSOA 4R8FA 2ZW7A 2CIJA 1YLOA 4R3LA 4NJQA 4ZX9A 7CPAA 2HB6A 3A9LA 4X5KA 2RC4A 1WWZA 4L8AA 2OZUA 4P4IA 4CYPA 4AB7A 5JGFA 2OOTA 2ZEPA 3H4QA 2V8DA 4JD6A 5DS0A 2JLMA 4QB9A 5LRKA 4UF4A 2B4DA 2YNEA 1Z4RA 2F5IA 4CGPA 2I00A 1XMTA 4YFJA 4PXCA 3LMSA 5LRJA 4UBRA 4OP4A 1QSMA 3FMCA 4RN7A 4I49A 3QNVA 5THWA 3S9MA 4CPAA 3PB6X 2ABZA 3SXNA 1IB1E 4NGPA 1Y0RA 2JBKA 2PJ5A 1IIDA 2AFSA 2DPSA 4B5OA 1CX8A 3BLNA 2XEGA 3PB8X 1HDQA 3D4UA 3HLPA 5F46A 2JDCA 3QB8A 3TOAA 4CAFA 5C82A 2PRBA 4ZBGA 1TKJA 2DF5A 1B6BA 3H8FA 5F47A 4M6IA 3WC6A 4ZY1A 5K8NA 2ZW5A 3E0KA 4K3NA 1M4IA 1V0CA 2G0BA 1YX0A 3KKWA 4OADA 1CPXA 4A37A 3K9UA 2REFA 4CAVA 1MJAA 3V38A 4TWEA 3TOBA 1KZFA 1YLEA 2PJ1A 3P2HA 4ZY2A 2IJZA 3FXTA 4KSFA 2FT0A 2Z3KA 3PB4X 4CGMA 3TFYA 1LAMA 5EC4A 3RO0A 3ISXA 4UCNA 4R3KA 3TX8A 1CPSA 2ZEEA 6CPAA 1BPMA 1LAPA 4DJLA 2Q4VA 1Q2YA 4MHNA 1Z8TA 1BO4A 4OMEA 3P2FA 3PP9A 3PEIA 2HC9A 1M44A 1Q2CA 1U6MA 2PDOA 3IWEA 4X3RA 2QIRA 4OC5A 2VZYA 3R96A 4M6GA 4A2ZA 2NSMA 4NEXA 5C88A 1YVKA 4CGOA 1R3NA 3D7DA 4CYOA 2AFZA 2PIZA 2XEFA 4U9YA 2DEAA 1XIXA 3KZWA 4AXVA 5LYIA 2F7VA 4UA3A 5J8CA 1M1DA 4X8IA 2VL1A 3NH4A 2Z0ZA 4CRYB 3H8GA 1BLLE 2IQ6A 1YR0A 1HEEA 1NSAA 2BCOA 1H8LA 5H86A 4C2ZA 4KVME 4F0YA 2Z10A 4QUSA 3MRUA 4UEFA 5JM6A 1B87A 3RNZA 2O28A 5K8PA 2ZXVA 3FECA 4MJ8A 3VWDA 5A27A 4MHDA 3GUXA 1I1DA 3NH8A 4MFKA 2BEIA 4UIAA 3L2NA 4F6AA 1TKFA 3BI0A 3NFZA 3UY5A 5FVJA 2ZOFA 2ANPA 4M85A 3R9EA 3PFEA 4IF5A 3FBUA 4UEEA 1RXTA 1A2ZA 4KUAA 2PCUA 1DTDA 4MRIA 4P6YA 5HH1A 3SJXA 4AG7A 4MFQA 2FSRA 2P0WA 2PJ6A 1TKHA 5F09A 1LRZA 4NGSA 2CF4A 4BMHA 2PJ0A 2OH1A 3DLJA 4LX9A 3EFAA 3KASA 1IU8A 5LYLA 1IICA 2P6FA 3DR8A 3JVNA 1PU9A 2AFOA 2GIVA 3GIUA 3QAYA 2ZPAA 2GE3A 2VQYA 4OIWA 4P45A 3D2MA 4B5PA 3SI2A 1QQ9A 4OLLA 4LQGA 2GANA 4BINA 3TE4A 3S6HA 2IL4A 3H8EA 2CNMA 2WYRA 4U5YA 3JTKA 4NXYA 4R87A 5HVHA 4UCMA 3T9YA 4A39A 5IX3A 2V8VA 1QSRA 4P4EA 3FIXA 4C7IA 2Y0MA 4KOXA 2P6EA 3KQXA 1CM0A 1TF8A 1XMBA 3FJUA 3FVLA 4KOSA 4MY0A 4CGNA 3CDXA 1VHEA 4OC0A 4MHPA 2VEZA 5A28A 3I1UA 4ZYQA 1Q7LA 4XPKA 4PV6A 2NMTA 2DXQA 5G20A 1L0CA 2QMLA 3RYOA 1M4LA 2GFQA 2HV2A 3W6XA 3SI0A 5KTAA 3CXQA 4UFXA 3T90A 4MCRA 3TO6A 4KOVA 4NCZA 3GLJA 3R1KA 3GYAA 5KTDA 4KVOE 2V8HA 1RTQA 2FCKA 3B3WA 4Q36A 3DSBA 2PVWA 5F48A 4NGQA 4A30A 1YREA 3SI1A 1HDUA 2EBJA 4JXRA 1IOFA 2Q4ZA 4H89A 4B14A 5BWAB 2PJ9A 4AG9A 4P44A 2O53A 5G21A 2G3AA 3IEHA 4OIDA 4NFRA 1JQGA 2G9DA 4Y49C 5EMIA 2I3CA 4UWIA 1XF8A 2QECA 3CT9A 4KVXA 4MI4A 3DR6A 2WSAA 2OB0A 2D4OA 1I21A 3FNCA 3JUWA 4E0AA 2PVVA 2C27A 4G1PA 2OU2A 2B4DB 2P6GA 5GCNA 1Y7EA 3BI1A 4NGNA 4IHMA 2R7HA 5LYDA 1ELLP 3TC8A 3SJGA 2Q7BA 3S9LA 4B11A 3IIBA 3EXNA 3KHZA 2PJ2A 3SHPA 3PFOA 3KR4A 3V8IA 2EK9A 2AFWA 2AE6A 3D7FA 4B13A 3OWCA 1IYLA 3B3TA 2AFMA 4UEZA 3PBBA 4F8ZA 1IOIA 1X12A 4MCQA 2C6CA 3IFEA 4OAEA 3NE7A 3NE8A 2J8NA 2ZEFA 4HKFA 5CNPA 2AFXA 2JBJA 4P4FA 3EY5A 3CXPA 2PJ4A 3SXOA 1TIQA 4OC2A 4FD5A 1XRYA 3PRTA 4Y49B 5F49A 1YW6A 1YGHA 3D68A 2YNDA 5ISVA 3TTHA 2FS5A 3FEDA 4PSXA 4UFVA 1GYTA 2RB7A 4R57A 4L89A 1Z8XA 2B58A 4YWYA 3WR7A 4CAEA 3I9SA 1Y7RA 4Q38A 4KOUA 4R7MA 8CPAA 5H84A 2BO9A 1LFWA 1ZLHA 3PB7X 4RI1A 3K2KA 3LWUA 2IMOA 2JEVA 2AFUA 4P4JA 1PUAA 2Q4YA 3IJ3A 3FRMA 1Z8LA 2OR4A 4B6ZA 4F0XA 4YGOA 3ISZA 4EWTA 3F0AA 4ONWA 5JH9A 5LYFA 4ZI6A 1P0HA 4GS4A 5K8MA 3N5FA 3TCVA 1FY7A 4K30A 4PSWA 2PJ3A 4KUBA 2PE3A 3KL9A 4FBEA 2PIYA 4PXBA 3DNSA 1Q2DA 1IGBA 2ZW6A 4HNWB 4OC4A 1AYEA 5J1QA 4ZX8A 3NA6A 3SJFA 3RAMA 4KOWA 3EC4A 2CTCA 4NGMA 1ZG7A 3BHXA 1N71A 2AJ6A 2HQYA 1ON0A 2FL4A 1MK4A 3F8KA 3KGQA 1I12A 3TT2A 1KUVA 1YK3A 4B10A 4CGLA 1CP7A 2DPTA 3C26A 1XOVA 4M6HA 5AG7A 4JZ0A 1VHSA 1TF9A 2Z3MA 4FAIA 2Q0YA 2REEA 4MFPA 4H2KA 4YU9A 3WABA 1XBUA 1YSJA 4EFDA 1F2PA 1BPNA 4P10A 4R9MA 2PJ7A 2EVNA 4PPZA 2EWBA 3I3GA 4X2TA 2GREA 4CAWA 2PJAA 2GU2A 2ZEDA 3BXMA 4UCPA 4KORA 2BOAA 2JEWA 4CRZB 5HVGA 2QVPA 4QVTA 4GXHA 1IY7A 1XE4A 2X7BA 4MFJA 4FD6A 1KUYA 5DWNA 3VH9A 4Q7AA 3D8PA 4UFWA 2JDDA 3CXSA 1DE4C 4CAXA 3NH5A 2PR8A 4ORFA 2V77A 2B5GA 2OZGA 2PRQA 5HVFA 4A32A 3IU1A 2FIWA 3CPAA 4LUAA 4B5PB 3GY9A 4BBHA 2EK8A 1QSNA 1UWYA 3SJEA 4E8OA 4MMOA 1M4GA 3B3SA 1CP6A 4XNHB 4ZY0A 3IWWA 3D67A 2VXKA 3F5BA 4JYWA 2EUIA 2HUZA 2ZELA 4TNUA 3S6FA 4XPDC 1AUGA 1XJOA 4OC3A 2Z3PA 2YNCA 4P4DA 5AG4A 4FWUA 1IYKA 3D66A 3G3SA 4KSAA 2PQ8A 3FB3A 3W6SA 3B3VA 2PJCA 3IC1A 2Q44A 1VHOA 2CNSA 5ELYA 1NMTA 3PB9X 1VKCA 3VARA 3ZJ0A 3FF3A 3B8GA 2FIAA 2B5GB 3N7ZA 4A94A 3CZXA 3VWEA 1YW4A 3B2YA 4F9VA 1YMEA 4UWJA 4AVCA 2Z3LA 2Z3NA 4B12A 4C7HA 5CBMA 3T8WA 1S5KA 5DWMA 4RUHA 4BD9A 3IGRA 2GLJA 3B35A 2VBQA 4CYQA 1KWMA 2ZOGA 4H6ZA 5IV0A 4Z65A 1BOBA 2VZZA 1KUXA 5AGEA 1SQHA 3V7ZA 3WC5A 1LCPA 2OZHA 1Z9UA 3DGVA 3FYNA 2ZW4A 1J4JA 3FX6A 4PQAA 3RBUA 1S7NA 4JJXA 2EO8A 1BAVA 4PK3A 2FE7A 3H5ZA 2ZEHA 5LRGA 1PYTB 2F8HA 4J3GA 2WZNA 2WUUA 2BL1A 1S3ZA 2PSWA 2KCWA 4DUKA 1FNOA 1XEBA 3G8WA 4CS0B 3PBEA 2B3UA 1F2OA 1MJBA 3BJ8A 3FEEA 4OC1A 3KI9A 2RFHA 4FUUA 4O23A 4KZTA 1QSTA 1QMUA 4RS2A 1OZPA 5G1ZA 5I0CA 3CPXA 3K9TA 1RO5A 2R1IA 2B4BA 1MJ9A 2QJ8A 3DDDA 2I79A 4H6UA 2ZEOA 4F9UA 3W91A 1X10A 4R76A 2H5MA 4XPLA 3R9GA 2ARHA 3IWGA 4W9YA 1WK4A 1Z4EA 1Y9WA 5D29A 1CJWA 3D2PA 3RZAA 3WT4A 4A33A 4EMEA 2C6GA 5E96A 3EO4A 3S9NA 1EE3P 2V8GA 2CTBA 4MFLA 1Y0YA 2NYQA 4NF1A 5D8NA 1Z8WA 4AVAA 5HXDA 4QBJA 4KLWA 1YVOA 2C6PA 1K4JA 1S60A 1ZO0A 2O4HA 2PC1A 2POKA 4LQ6A 3B7IA 4MCPA 1GHEA 1PCAA 3HUVA 4NGTA 1JWQA 4HPSA 4MXUA 3S6GA 3PGPA 1CBXA 4PXEA 1CG2A 5JQ4A 1M4DA 1S7LA 2PJBA 2R98A 4OKOA 4PK2A 5I4MA 3IO1A 1ARMA 4KS9A 3D3SA 2ZEMA 5J8FA 4KSIA 1Y9KA 2Q43A 3MN8A 5AG5A 4KOYA 2XEIA 1ZG9A 4A31A 3BJ7A 2K5TA 4XPDB 2WPXA 3S6KA 4MBUA 2FVGA 3TO9A 2QYVA 1S7FA 4DNCA 2BUEA 2ODFA 2Q51A 2J8MA 2Z11A 4IAVA 4U9ZA 1OBRA 2B3VA 4A38A 4R6TA 4CYNA 3VATA 2PR1A 2J8RA 4P4BA 3FH4A 4C2YA 4GM5A 2Q7SA 4UIBA 2J9AA 4XNHC 3TO7A 4MCSA 3JRUA 4PXDA 2ZENA 1R57A 2A4NA 5HMNA 1ELMP 2R8VA 3LODA 2ZEGA 1LANA 1TXRA 4JXQA 1ZG8A 4MY3A 5EBVA 2YGWA 4JWPA 4ONUA 5JPHA 1Z2LA 3LD2A 2GLFA 3KHXA 1AMPA 4NSQA 4FD7A 1LOKA 4KOTA 1Z5RA 3KQZA 4WJBA 5KTCA 3R9FA 4NJRA 1F57A 3GKRA 3GB0A 4QC6A 4A95A 1FT7A 2Z3OA 5G22A 5IB0A 3LACA 4AVBA 4DYOA 4KLVA 5IB9A 4IUSA 1VGYA 4E2AA 4HNYB 1YQEA 2ATRA 4EVYA 1R43A 4JLYA 4II9A 3PZJA 4YRHA 4C68A 2PJ8A 4NGRA 2YNCC 1ARLA 2G3TA 3KR5A 1UFHA 2CNTA 2CY2A 4MHYA 3MGDA 1ZLIA 2VI7A 1P4NA 3ZZIA 2WPWA 4C2XA 2C1CA 4M3SA 3D7HA 4MFZA 2BSWA 4MHZA 3IU2A
chains in the Genus database with same CATH topology
4WWVA 5CPAA 3WC7A 3D7GA 1VIXA 4IK2A 1XFOA 2XEJA 3B3CA 5K8OA 4R8FA 2CIJA 1YLOA 4NJQA 4ZX9A 7CPAA 2HB6A 4P4IA 5JGFA 2OOTA 2ZEPA 2V8DA 5DS0A 5LRKA 4UF4A 3LMSA 5LRJA 4OP4A 3FMCA 5THWA 4CPAA 3QNVA 3S9MA 3PB6X 2ABZA 4NGPA 1Y0RA 2JBKA 2PJ5A 2AFSA 1CX8A 2XEGA 3PB8X 1HDQA 3D4UA 3HLPA 1TKJA 3WC6A 3H8FA 4ZY1A 5K8NA 4K3NA 1CPXA 4A37A 3V38A 4TWEA 2PJ1A 4ZY2A 2IJZA 3PB4X 1LAMA 3TX8A 3ISXA 6CPAA 1CPSA 2ZEEA 1BPMA 1LAPA 4DJLA 4MHNA 4OMEA 3PEIA 2HC9A 4X3RA 4OC5A 2NSMA 1R3NA 3D7DA 2AFZA 2PIZA 2XEFA 2DEAA 4AXVA 3KZWA 5LYIA 2F7VA 4X8IA 2VL1A 3NH4A 3H8GA 1BLLE 2IQ6A 1HEEA 1NSAA 2BCOA 1H8LA 3MRUA 4UEFA 5JM6A 5K8PA 3FECA 3GUXA 3NH8A 4UIAA 3L2NA 1TKFA 3BI0A 3NFZA 2ZOFA 2ANPA 3PFEA 4UEEA 2PCUA 1DTDA 4MRIA 4P6YA 3SJXA 2PJ6A 1TKHA 5F09A 4NGSA 2CF4A 2PJ0A 3DLJA 3KASA 5LYLA 2AFOA 4OIWA 4P45A 3SI2A 1QQ9A 4LQGA 3H8EA 2WYRA 5HVHA 4A39A 2V8VA 4P4EA 3KQXA 1XMBA 1TF8A 3FJUA 3FVLA 3CDXA 1VHEA 4OC0A 4MHPA 3I1UA 4ZYQA 1Q7LA 1M4LA 3SI0A 4MCRA 3GLJA 2V8HA 1RTQA 3B3WA 2PVWA 4NGQA 3SI1A 1HDUA 2Q4ZA 2PJ9A 4P44A 2O53A 3IEHA 4OIDA 4NFRA 1JQGA 2G9DA 2I3CA 3CT9A 2PVVA 4G1PA 1Y7EA 3BI1A 4NGNA 4IHMA 5LYDA 1ELLP 3TC8A 3SJGA 3S9LA 3IIBA 3KHZA 2PJ2A 3PFOA 3KR4A 2EK9A 2AFWA 3D7FA 3B3TA 2AFMA 4UEZA 3PBBA 4F8ZA 4MCQA 2C6CA 3IFEA 2ZEFA 2AFXA 2JBJA 4P4FA 2PJ4A 4OC2A 1XRYA 3PRTA 1YW6A 3D68A 3FEDA 1GYTA 2RB7A 4YWYA 4R7MA 8CPAA 2BO9A 1LFWA 1ZLHA 3PB7X 3K2KA 3LWUA 2IMOA 4P4JA 2AFUA 3IJ3A 1Z8LA 2OR4A 4B6ZA 5JH9A 3ISZA 5LYFA 4ONWA 4ZI6A 5K8MA 3N5FA 2PJ3A 2PE3A 3KL9A 4FBEA 2PIYA 1IGBA 4OC4A 5J1QA 1AYEA 4ZX8A 3NA6A 3SJFA 3RAMA 2CTCA 4NGMA 1ZG7A 3BHXA 3KGQA 1CP7A 4JZ0A 1TF9A 4FAIA 4YU9A 3WABA 4H2KA 1XBUA 1YSJA 4EFDA 1F2PA 1BPNA 4P10A 2PJ7A 4PPZA 2EWBA 4X2TA 2GREA 2PJAA 2GU2A 2ZEDA 3BXMA 2BOAA 2JEWA 5HVGA 2QVPA 1IY7A 3VH9A 4Q7AA 1DE4C 3NH5A 2V77A 2PRQA 5HVFA 3CPAA 2EK8A 1UWYA 3SJEA 4MMOA 3B3SA 1CP6A 4ZY0A 3IWWA 3D67A 4JYWA 2ZELA 4TNUA 4OC3A 1XJOA 4P4DA 4FWUA 3D66A 3B3VA 2PJCA 3IC1A 1VHOA 5ELYA 3PB9X 3VARA 3FF3A 4A94A 1YW4A 3B2YA 4F9VA 1YMEA 5CBMA 3T8WA 4RUHA 4BD9A 2GLJA 3B35A 1KWMA 2ZOGA 4Z65A 3V7ZA 3WC5A 1LCPA 3DGVA 4PQAA 3FX6A 3RBUA 1BAVA 5LRGA 2ZEHA 1PYTB 2F8HA 2WZNA 4DUKA 1FNOA 3PBEA 3FEEA 1F2OA 4OC1A 3KI9A 2RFHA 4FUUA 4O23A 1QMUA 3CPXA 3K9TA 2QJ8A 2ZEOA 4F9UA 4R76A 4W9YA 5D29A 3RZAA 4EMEA 3WT4A 2C6GA 3S9NA 1EE3P 2V8GA 2CTBA 5HXDA 1Y0YA 2NYQA 5D8NA 4PXCA 2C6PA 2O4HA 2POKA 4MCPA 3B7IA 1PCAA 3HUVA 4NGTA 4MXUA 1CBXA 4PXEA 1CG2A 2PJBA 4OKOA 5I4MA 3IO1A 1ARMA 2ZEMA 4KSIA 2Q43A 3MN8A 2XEIA 1ZG9A 2FVGA 2QYVA 2Q51A 4IAVA 1OBRA 4A38A 4R6TA 3VATA 4P4BA 3FH4A 4GM5A 4UIBA 2J9AA 4MCSA 3JRUA 4PXDA 2ZENA 1ELMP 2ZEGA 1LANA 1TXRA 1ZG8A 1Z2LA 2GLFA 3KHXA 1AMPA 1LOKA 4WJBA 1Z5RA 3KQZA 4NJRA 1F57A 3GB0A 1FT7A 4DYOA 5IB9A 1VGYA 1R43A 2PJ8A 4NGRA 1ARLA 3KR5A 4MHYA 1ZLIA 2C1CA 4EWTA 3D7HA 4MHZA 4PXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WWV A;  5CPA A;  3WC7 A;  3D7G A;  1VIX A;  4IK2 A;  1XFO A;  2XEJ A;  3B3C A;  5K8O A;  4R8F A;  2CIJ A;  1YLO A;  4NJQ A;  4ZX9 A;  7CPA A;  2HB6 A;  4P4I A;  5JGF A;  2OOT A;  2ZEP A;  2V8D A;  5DS0 A;  5LRK A;  4UF4 A;  3LMS A;  5LRJ A;  4OP4 A;  3FMC A;  5THW A;  4CPA A;  3QNV A;  3S9M A;  3PB6 X;  2ABZ A;  4NGP A;  1Y0R A;  2JBK A;  2PJ5 A;  2AFS A;  1CX8 A;  2XEG A;  3PB8 X;  1HDQ A;  3D4U A;  3HLP A;  1TKJ A;  3WC6 A;  3H8F A;  4ZY1 A;  5K8N A;  4K3N A;  1CPX A;  4A37 A;  3V38 A;  4TWE A;  2PJ1 A;  4ZY2 A;  2IJZ A;  3PB4 X;  1LAM A;  3TX8 A;  3ISX A;  6CPA A;  1CPS A;  2ZEE A;  1BPM A;  1LAP A;  4DJL A;  4MHN A;  4OME A;  3PEI A;  2HC9 A;  4X3R A;  4OC5 A;  2NSM A;  1R3N A;  3D7D A;  2AFZ A;  2PIZ A;  2XEF A;  2DEA A;  4AXV A;  3KZW A;  5LYI A;  2F7V A;  4X8I A;  2VL1 A;  3NH4 A;  3H8G A;  1BLL E;  2IQ6 A;  1HEE A;  1NSA A;  2BCO A;  1H8L A;  3MRU A;  4UEF A;  5JM6 A;  5K8P A;  3FEC A;  3GUX A;  3NH8 A;  4UIA A;  3L2N A;  1TKF A;  3BI0 A;  3NFZ A;  2ZOF A;  2ANP A;  3PFE A;  4UEE A;  2PCU A;  1DTD A;  4MRI A;  4P6Y A;  3SJX A;  2PJ6 A;  1TKH A;  5F09 A;  4NGS A;  2CF4 A;  2PJ0 A;  3DLJ A;  3KAS A;  5LYL A;  2AFO A;  4OIW A;  4P45 A;  3SI2 A;  1QQ9 A;  4LQG A;  3H8E A;  2WYR A;  5HVH A;  4A39 A;  2V8V A;  4P4E A;  3KQX A;  1XMB A;  1TF8 A;  3FJU A;  3FVL A;  3CDX A;  1VHE A;  4OC0 A;  4MHP A;  3I1U A;  4ZYQ A;  1Q7L A;  1M4L A;  3SI0 A;  4MCR A;  3GLJ A;  2V8H A;  1RTQ A;  3B3W A;  2PVW A;  4NGQ A;  3SI1 A;  1HDU A;  2Q4Z A;  2PJ9 A;  4P44 A;  2O53 A;  3IEH A;  4OID A;  4NFR A;  1JQG A;  2G9D A;  2I3C A;  3CT9 A;  2PVV A;  4G1P A;  1Y7E A;  3BI1 A;  4NGN A;  4IHM A;  5LYD A;  1ELL P;  3TC8 A;  3SJG A;  3S9L A;  3IIB A;  3KHZ A;  2PJ2 A;  3PFO A;  3KR4 A;  2EK9 A;  2AFW A;  3D7F A;  3B3T A;  2AFM A;  4UEZ A;  3PBB A;  4F8Z A;  4MCQ A;  2C6C A;  3IFE A;  2ZEF A;  2AFX A;  2JBJ A;  4P4F A;  2PJ4 A;  4OC2 A;  1XRY A;  3PRT A;  1YW6 A;  3D68 A;  3FED A;  1GYT A;  2RB7 A;  4YWY A;  4R7M A;  8CPA A;  2BO9 A;  1LFW A;  1ZLH A;  3PB7 X;  3K2K A;  3LWU A;  2IMO A;  4P4J A;  2AFU A;  3IJ3 A;  1Z8L A;  2OR4 A;  4B6Z A;  5JH9 A;  3ISZ A;  5LYF A;  4ONW A;  4ZI6 A;  5K8M A;  3N5F A;  2PJ3 A;  2PE3 A;  3KL9 A;  4FBE A;  2PIY A;  1IGB A;  4OC4 A;  5J1Q A;  1AYE A;  4ZX8 A;  3NA6 A;  3SJF A;  3RAM A;  2CTC A;  4NGM A;  1ZG7 A;  3BHX A;  3KGQ A;  1CP7 A;  4JZ0 A;  1TF9 A;  4FAI A;  4YU9 A;  3WAB A;  4H2K A;  1XBU A;  1YSJ A;  4EFD A;  1F2P A;  1BPN A;  4P10 A;  2PJ7 A;  4PPZ A;  2EWB A;  4X2T A;  2GRE A;  2PJA A;  2GU2 A;  2ZED A;  3BXM A;  2BOA A;  2JEW A;  5HVG A;  2QVP A;  1IY7 A;  3VH9 A;  4Q7A A;  1DE4 C;  3NH5 A;  2V77 A;  2PRQ A;  5HVF A;  3CPA A;  2EK8 A;  1UWY A;  3SJE A;  4MMO A;  3B3S A;  1CP6 A;  4ZY0 A;  3IWW A;  3D67 A;  4JYW A;  2ZEL A;  4TNU A;  4OC3 A;  1XJO A;  4P4D A;  4FWU A;  3D66 A;  3B3V A;  2PJC A;  3IC1 A;  1VHO A;  5ELY A;  3PB9 X;  3VAR A;  3FF3 A;  4A94 A;  1YW4 A;  3B2Y A;  4F9V A;  1YME A;  5CBM A;  3T8W A;  4RUH A;  4BD9 A;  2GLJ A;  3B35 A;  1KWM A;  2ZOG A;  4Z65 A;  3V7Z A;  3WC5 A;  1LCP A;  3DGV A;  4PQA A;  3FX6 A;  3RBU A;  1BAV A;  5LRG A;  2ZEH A;  1PYT B;  2F8H A;  2WZN A;  4DUK A;  1FNO A;  3PBE A;  3FEE A;  1F2O A;  4OC1 A;  3KI9 A;  2RFH A;  4FUU A;  4O23 A;  1QMU A;  3CPX A;  3K9T A;  2QJ8 A;  2ZEO A;  4F9U A;  4R76 A;  4W9Y A;  5D29 A;  3RZA A;  4EME A;  3WT4 A;  2C6G A;  3S9N A;  1EE3 P;  2V8G A;  2CTB A;  5HXD A;  1Y0Y A;  2NYQ A;  5D8N A;  4PXC A;  2C6P A;  2O4H A;  2POK A;  4MCP A;  3B7I A;  1PCA A;  3HUV A;  4NGT A;  4MXU A;  1CBX A;  4PXE A;  1CG2 A;  2PJB A;  4OKO A;  5I4M A;  3IO1 A;  1ARM A;  2ZEM A;  4KSI A;  2Q43 A;  3MN8 A;  2XEI A;  1ZG9 A;  2FVG A;  2QYV A;  2Q51 A;  4IAV A;  1OBR A;  4A38 A;  4R6T A;  3VAT A;  4P4B A;  3FH4 A;  4GM5 A;  4UIB A;  2J9A A;  4MCS A;  3JRU A;  4PXD A;  2ZEN A;  1ELM P;  2ZEG A;  1LAN A;  1TXR A;  1ZG8 A;  1Z2L A;  2GLF A;  3KHX A;  1AMP A;  1LOK A;  4WJB A;  1Z5R A;  3KQZ A;  4NJR A;  1F57 A;  3GB0 A;  1FT7 A;  4DYO A;  5IB9 A;  1VGY A;  1R43 A;  2PJ8 A;  4NGR A;  1ARL A;  3KR5 A;  4MHY A;  1ZLI A;  2C1C A;  4EWT A;  3D7H A;  4MHZ A;  4PXB A; 
#chains in the Genus database with same CATH topology
 4WWV A;  2Q04 A;  3R95 A;  5CPA A;  3WC7 A;  4HNX B;  1NSL A;  3D7G A;  5AG6 A;  1VIX A;  2FXF A;  1S7K A;  1XFO A;  2D4P A;  4IK2 A;  2CXA A;  4FD4 A;  2XEJ A;  1NE9 A;  3B3C A;  3QAH A;  4ZGY B;  5K8O A;  1QSO A;  4R8F A;  2ZW7 A;  2CIJ A;  1YLO A;  4R3L A;  4NJQ A;  4ZX9 A;  7CPA A;  2HB6 A;  3A9L A;  4X5K A;  2RC4 A;  1WWZ A;  4L8A A;  2OZU A;  4P4I A;  4CYP A;  4AB7 A;  5JGF A;  2OOT A;  2ZEP A;  3H4Q A;  2V8D A;  4JD6 A;  5DS0 A;  2JLM A;  4QB9 A;  5LRK A;  4UF4 A;  2B4D A;  2YNE A;  1Z4R A;  2F5I A;  4CGP A;  2I00 A;  1XMT A;  4YFJ A;  4PXC A;  3LMS A;  5LRJ A;  4UBR A;  4OP4 A;  1QSM A;  3FMC A;  4RN7 A;  4I49 A;  3QNV A;  5THW A;  3S9M A;  4CPA A;  3PB6 X;  2ABZ A;  3SXN A;  1IB1 E;  4NGP A;  1Y0R A;  2JBK A;  2PJ5 A;  1IID A;  2AFS A;  2DPS A;  4B5O A;  1CX8 A;  3BLN A;  2XEG A;  3PB8 X;  1HDQ A;  3D4U A;  3HLP A;  5F46 A;  2JDC A;  3QB8 A;  3TOA A;  4CAF A;  5C82 A;  2PRB A;  4ZBG A;  1TKJ A;  2DF5 A;  1B6B A;  3H8F A;  5F47 A;  4M6I A;  3WC6 A;  4ZY1 A;  5K8N A;  2ZW5 A;  3E0K A;  4K3N A;  1M4I A;  1V0C A;  2G0B A;  1YX0 A;  3KKW A;  4OAD A;  1CPX A;  4A37 A;  3K9U A;  2REF A;  4CAV A;  1MJA A;  3V38 A;  4TWE A;  3TOB A;  1KZF A;  1YLE A;  2PJ1 A;  3P2H A;  4ZY2 A;  2IJZ A;  3FXT A;  4KSF A;  2FT0 A;  2Z3K A;  3PB4 X;  4CGM A;  3TFY A;  1LAM A;  5EC4 A;  3RO0 A;  3ISX A;  4UCN A;  4R3K A;  3TX8 A;  1CPS A;  2ZEE A;  6CPA A;  1BPM A;  1LAP A;  4DJL A;  2Q4V A;  1Q2Y A;  4MHN A;  1Z8T A;  1BO4 A;  4OME A;  3P2F A;  3PP9 A;  3PEI A;  2HC9 A;  1M44 A;  1Q2C A;  1U6M A;  2PDO A;  3IWE A;  4X3R A;  2QIR A;  4OC5 A;  2VZY A;  3R96 A;  4M6G A;  4A2Z A;  2NSM A;  4NEX A;  5C88 A;  1YVK A;  4CGO A;  1R3N A;  3D7D A;  4CYO A;  2AFZ A;  2PIZ A;  2XEF A;  4U9Y A;  2DEA A;  1XIX A;  3KZW A;  4AXV A;  5LYI A;  2F7V A;  4UA3 A;  5J8C A;  1M1D A;  4X8I A;  2VL1 A;  3NH4 A;  2Z0Z A;  4CRY B;  3H8G A;  1BLL E;  2IQ6 A;  1YR0 A;  1HEE A;  1NSA A;  2BCO A;  1H8L A;  5H86 A;  4C2Z A;  4KVM E;  4F0Y A;  2Z10 A;  4QUS A;  3MRU A;  4UEF A;  5JM6 A;  1B87 A;  3RNZ A;  2O28 A;  5K8P A;  2ZXV A;  3FEC A;  4MJ8 A;  3VWD A;  5A27 A;  4MHD A;  3GUX A;  1I1D A;  3NH8 A;  4MFK A;  2BEI A;  4UIA A;  3L2N A;  4F6A A;  1TKF A;  3BI0 A;  3NFZ A;  3UY5 A;  5FVJ A;  2ZOF A;  2ANP A;  4M85 A;  3R9E A;  3PFE A;  4IF5 A;  3FBU A;  4UEE A;  1RXT A;  1A2Z A;  4KUA A;  2PCU A;  1DTD A;  4MRI A;  4P6Y A;  5HH1 A;  3SJX A;  4AG7 A;  4MFQ A;  2FSR A;  2P0W A;  2PJ6 A;  1TKH A;  5F09 A;  1LRZ A;  4NGS A;  2CF4 A;  4BMH A;  2PJ0 A;  2OH1 A;  3DLJ A;  4LX9 A;  3EFA A;  3KAS A;  1IU8 A;  5LYL A;  1IIC A;  2P6F A;  3DR8 A;  3JVN A;  1PU9 A;  2AFO A;  2GIV A;  3GIU A;  3QAY A;  2ZPA A;  2GE3 A;  2VQY A;  4OIW A;  4P45 A;  3D2M A;  4B5P A;  3SI2 A;  1QQ9 A;  4OLL A;  4LQG A;  2GAN A;  4BIN A;  3TE4 A;  3S6H A;  2IL4 A;  3H8E A;  2CNM A;  2WYR A;  4U5Y A;  3JTK A;  4NXY A;  4R87 A;  5HVH A;  4UCM A;  3T9Y A;  4A39 A;  5IX3 A;  2V8V A;  1QSR A;  4P4E A;  3FIX A;  4C7I A;  2Y0M A;  4KOX A;  2P6E A;  3KQX A;  1CM0 A;  1TF8 A;  1XMB A;  3FJU A;  3FVL A;  4KOS A;  4MY0 A;  4CGN A;  3CDX A;  1VHE A;  4OC0 A;  4MHP A;  2VEZ A;  5A28 A;  3I1U A;  4ZYQ A;  1Q7L A;  4XPK A;  4PV6 A;  2NMT A;  2DXQ A;  5G20 A;  1L0C A;  2QML A;  3RYO A;  1M4L A;  2GFQ A;  2HV2 A;  3W6X A;  3SI0 A;  5KTA A;  3CXQ A;  4UFX A;  3T90 A;  4MCR A;  3TO6 A;  4KOV A;  4NCZ A;  3GLJ A;  3R1K A;  3GYA A;  5KTD A;  4KVO E;  2V8H A;  1RTQ A;  2FCK A;  3B3W A;  4Q36 A;  3DSB A;  2PVW A;  5F48 A;  4NGQ A;  4A30 A;  1YRE A;  3SI1 A;  1HDU A;  2EBJ A;  4JXR A;  1IOF A;  2Q4Z A;  4H89 A;  4B14 A;  5BWA B;  2PJ9 A;  4AG9 A;  4P44 A;  2O53 A;  5G21 A;  2G3A A;  3IEH A;  4OID A;  4NFR A;  1JQG A;  2G9D A;  4Y49 C;  5EMI A;  2I3C A;  4UWI A;  1XF8 A;  2QEC A;  3CT9 A;  4KVX A;  4MI4 A;  3DR6 A;  2WSA A;  2OB0 A;  2D4O A;  1I21 A;  3FNC A;  3JUW A;  4E0A A;  2PVV A;  2C27 A;  4G1P A;  2OU2 A;  2B4D B;  2P6G A;  5GCN A;  1Y7E A;  3BI1 A;  4NGN A;  4IHM A;  2R7H A;  5LYD A;  1ELL P;  3TC8 A;  3SJG A;  2Q7B A;  3S9L A;  4B11 A;  3IIB A;  3EXN A;  3KHZ A;  2PJ2 A;  3SHP A;  3PFO A;  3KR4 A;  3V8I A;  2EK9 A;  2AFW A;  2AE6 A;  3D7F A;  4B13 A;  3OWC A;  1IYL A;  3B3T A;  2AFM A;  4UEZ A;  3PBB A;  4F8Z A;  1IOI A;  1X12 A;  4MCQ A;  2C6C A;  3IFE A;  4OAE A;  3NE7 A;  3NE8 A;  2J8N A;  2ZEF A;  4HKF A;  5CNP A;  2AFX A;  2JBJ A;  4P4F A;  3EY5 A;  3CXP A;  2PJ4 A;  3SXO A;  1TIQ A;  4OC2 A;  4FD5 A;  1XRY A;  3PRT A;  4Y49 B;  5F49 A;  1YW6 A;  1YGH A;  3D68 A;  2YND A;  5ISV A;  3TTH A;  2FS5 A;  3FED A;  4PSX A;  4UFV A;  1GYT A;  2RB7 A;  4R57 A;  4L89 A;  1Z8X A;  2B58 A;  4YWY A;  3WR7 A;  4CAE A;  3I9S A;  1Y7R A;  4Q38 A;  4KOU A;  4R7M A;  8CPA A;  5H84 A;  2BO9 A;  1LFW A;  1ZLH A;  3PB7 X;  4RI1 A;  3K2K A;  3LWU A;  2IMO A;  2JEV A;  2AFU A;  4P4J A;  1PUA A;  2Q4Y A;  3IJ3 A;  3FRM A;  1Z8L A;  2OR4 A;  4B6Z A;  4F0X A;  4YGO A;  3ISZ A;  4EWT A;  3F0A A;  4ONW A;  5JH9 A;  5LYF A;  4ZI6 A;  1P0H A;  4GS4 A;  5K8M A;  3N5F A;  3TCV A;  1FY7 A;  4K30 A;  4PSW A;  2PJ3 A;  4KUB A;  2PE3 A;  3KL9 A;  4FBE A;  2PIY A;  4PXB A;  3DNS A;  1Q2D A;  1IGB A;  2ZW6 A;  4HNW B;  4OC4 A;  1AYE A;  5J1Q A;  4ZX8 A;  3NA6 A;  3SJF A;  3RAM A;  4KOW A;  3EC4 A;  2CTC A;  4NGM A;  1ZG7 A;  3BHX A;  1N71 A;  2AJ6 A;  2HQY A;  1ON0 A;  2FL4 A;  1MK4 A;  3F8K A;  3KGQ A;  1I12 A;  3TT2 A;  1KUV A;  1YK3 A;  4B10 A;  4CGL A;  1CP7 A;  2DPT A;  3C26 A;  1XOV A;  4M6H A;  5AG7 A;  4JZ0 A;  1VHS A;  1TF9 A;  2Z3M A;  4FAI A;  2Q0Y A;  2REE A;  4MFP A;  4H2K A;  4YU9 A;  3WAB A;  1XBU A;  1YSJ A;  4EFD A;  1F2P A;  1BPN A;  4P10 A;  4R9M A;  2PJ7 A;  2EVN A;  4PPZ A;  2EWB A;  3I3G A;  4X2T A;  2GRE A;  4CAW A;  2PJA A;  2GU2 A;  2ZED A;  3BXM A;  4UCP A;  4KOR A;  2BOA A;  2JEW A;  4CRZ B;  5HVG A;  2QVP A;  4QVT A;  4GXH A;  1IY7 A;  1XE4 A;  2X7B A;  4MFJ A;  4FD6 A;  1KUY A;  5DWN A;  3VH9 A;  4Q7A A;  3D8P A;  4UFW A;  2JDD A;  3CXS A;  1DE4 C;  4CAX A;  3NH5 A;  2PR8 A;  4ORF A;  2V77 A;  2B5G A;  2OZG A;  2PRQ A;  5HVF A;  4A32 A;  3IU1 A;  2FIW A;  3CPA A;  4LUA A;  4B5P B;  3GY9 A;  4BBH A;  2EK8 A;  1QSN A;  1UWY A;  3SJE A;  4E8O A;  4MMO A;  1M4G A;  3B3S A;  1CP6 A;  4XNH B;  4ZY0 A;  3IWW A;  3D67 A;  2VXK A;  3F5B A;  4JYW A;  2EUI A;  2HUZ A;  2ZEL A;  4TNU A;  3S6F A;  4XPD C;  1AUG A;  1XJO A;  4OC3 A;  2Z3P A;  2YNC A;  4P4D A;  5AG4 A;  4FWU A;  1IYK A;  3D66 A;  3G3S A;  4KSA A;  2PQ8 A;  3FB3 A;  3W6S A;  3B3V A;  2PJC A;  3IC1 A;  2Q44 A;  1VHO A;  2CNS A;  5ELY A;  1NMT A;  3PB9 X;  1VKC A;  3VAR A;  3ZJ0 A;  3FF3 A;  3B8G A;  2FIA A;  2B5G B;  3N7Z A;  4A94 A;  3CZX A;  3VWE A;  1YW4 A;  3B2Y A;  4F9V A;  1YME A;  4UWJ A;  4AVC A;  2Z3L A;  2Z3N A;  4B12 A;  4C7H A;  5CBM A;  3T8W A;  1S5K A;  5DWM A;  4RUH A;  4BD9 A;  3IGR A;  2GLJ A;  3B35 A;  2VBQ A;  4CYQ A;  1KWM A;  2ZOG A;  4H6Z A;  5IV0 A;  4Z65 A;  1BOB A;  2VZZ A;  1KUX A;  5AGE A;  1SQH A;  3V7Z A;  3WC5 A;  1LCP A;  2OZH A;  1Z9U A;  3DGV A;  3FYN A;  2ZW4 A;  1J4J A;  3FX6 A;  4PQA A;  3RBU A;  1S7N A;  4JJX A;  2EO8 A;  1BAV A;  4PK3 A;  2FE7 A;  3H5Z A;  2ZEH A;  5LRG A;  1PYT B;  2F8H A;  4J3G A;  2WZN A;  2WUU A;  2BL1 A;  1S3Z A;  2PSW A;  2KCW A;  4DUK A;  1FNO A;  1XEB A;  3G8W A;  4CS0 B;  3PBE A;  2B3U A;  1F2O A;  1MJB A;  3BJ8 A;  3FEE A;  4OC1 A;  3KI9 A;  2RFH A;  4FUU A;  4O23 A;  4KZT A;  1QST A;  1QMU A;  4RS2 A;  1OZP A;  5G1Z A;  5I0C A;  3CPX A;  3K9T A;  1RO5 A;  2R1I A;  2B4B A;  1MJ9 A;  2QJ8 A;  3DDD A;  2I79 A;  4H6U A;  2ZEO A;  4F9U A;  3W91 A;  1X10 A;  4R76 A;  2H5M A;  4XPL A;  3R9G A;  2ARH A;  3IWG A;  4W9Y A;  1WK4 A;  1Z4E A;  1Y9W A;  5D29 A;  1CJW A;  3D2P A;  3RZA A;  3WT4 A;  4A33 A;  4EME A;  2C6G A;  5E96 A;  3EO4 A;  3S9N A;  1EE3 P;  2V8G A;  2CTB A;  4MFL A;  1Y0Y A;  2NYQ A;  4NF1 A;  5D8N A;  1Z8W A;  4AVA A;  5HXD A;  4QBJ A;  4KLW A;  1YVO A;  2C6P A;  1K4J A;  1S60 A;  1ZO0 A;  2O4H A;  2PC1 A;  2POK A;  4LQ6 A;  3B7I A;  4MCP A;  1GHE A;  1PCA A;  3HUV A;  4NGT A;  1JWQ A;  4HPS A;  4MXU A;  3S6G A;  3PGP A;  1CBX A;  4PXE A;  1CG2 A;  5JQ4 A;  1M4D A;  1S7L A;  2PJB A;  2R98 A;  4OKO A;  4PK2 A;  5I4M A;  3IO1 A;  1ARM A;  4KS9 A;  3D3S A;  2ZEM A;  5J8F A;  4KSI A;  1Y9K A;  2Q43 A;  3MN8 A;  5AG5 A;  4KOY A;  2XEI A;  1ZG9 A;  4A31 A;  3BJ7 A;  2K5T A;  4XPD B;  2WPX A;  3S6K A;  4MBU A;  2FVG A;  3TO9 A;  2QYV A;  1S7F A;  4DNC A;  2BUE A;  2ODF A;  2Q51 A;  2J8M A;  2Z11 A;  4IAV A;  4U9Z A;  1OBR A;  2B3V A;  4A38 A;  4R6T A;  4CYN A;  3VAT A;  2PR1 A;  2J8R A;  4P4B A;  3FH4 A;  4C2Y A;  4GM5 A;  2Q7S A;  4UIB A;  2J9A A;  4XNH C;  3TO7 A;  4MCS A;  3JRU A;  4PXD A;  2ZEN A;  1R57 A;  2A4N A;  5HMN A;  1ELM P;  2R8V A;  3LOD A;  2ZEG A;  1LAN A;  1TXR A;  4JXQ A;  1ZG8 A;  4MY3 A;  5EBV A;  2YGW A;  4JWP A;  4ONU A;  5JPH A;  1Z2L A;  3LD2 A;  2GLF A;  3KHX A;  1AMP A;  4NSQ A;  4FD7 A;  1LOK A;  4KOT A;  1Z5R A;  3KQZ A;  4WJB A;  5KTC A;  3R9F A;  4NJR A;  1F57 A;  3GKR A;  3GB0 A;  4QC6 A;  4A95 A;  1FT7 A;  2Z3O A;  5G22 A;  5IB0 A;  3LAC A;  4AVB A;  4DYO A;  4KLV A;  5IB9 A;  4IUS A;  1VGY A;  4E2A A;  4HNY B;  1YQE A;  2ATR A;  4EVY A;  1R43 A;  4JLY A;  4II9 A;  3PZJ A;  4YRH A;  4C68 A;  2PJ8 A;  4NGR A;  2YNC C;  1ARL A;  2G3T A;  3KR5 A;  1UFH A;  2CNT A;  2CY2 A;  4MHY A;  3MGD A;  1ZLI A;  2VI7 A;  1P4N A;  3ZZI A;  2WPW A;  4C2X A;  2C1C A;  4M3S A;  3D7H A;  4MFZ A;  2BSW A;  4MHZ A;  3IU2 A; 
#chains in the Genus database with same CATH homology
 4WWV A;  5CPA A;  3WC7 A;  3D7G A;  1VIX A;  4IK2 A;  1XFO A;  2XEJ A;  3B3C A;  5K8O A;  4R8F A;  2CIJ A;  1YLO A;  4NJQ A;  4ZX9 A;  7CPA A;  2HB6 A;  4P4I A;  5JGF A;  2OOT A;  2ZEP A;  2V8D A;  5DS0 A;  5LRK A;  4UF4 A;  3LMS A;  5LRJ A;  4OP4 A;  3FMC A;  5THW A;  4CPA A;  3QNV A;  3S9M A;  3PB6 X;  2ABZ A;  4NGP A;  1Y0R A;  2JBK A;  2PJ5 A;  2AFS A;  1CX8 A;  2XEG A;  3PB8 X;  1HDQ A;  3D4U A;  3HLP A;  1TKJ A;  3WC6 A;  3H8F A;  4ZY1 A;  5K8N A;  4K3N A;  1CPX A;  4A37 A;  3V38 A;  4TWE A;  2PJ1 A;  4ZY2 A;  2IJZ A;  3PB4 X;  1LAM A;  3TX8 A;  3ISX A;  6CPA A;  1CPS A;  2ZEE A;  1BPM A;  1LAP A;  4DJL A;  4MHN A;  4OME A;  3PEI A;  2HC9 A;  4X3R A;  4OC5 A;  2NSM A;  1R3N A;  3D7D A;  2AFZ A;  2PIZ A;  2XEF A;  2DEA A;  4AXV A;  3KZW A;  5LYI A;  2F7V A;  4X8I A;  2VL1 A;  3NH4 A;  3H8G A;  1BLL E;  2IQ6 A;  1HEE A;  1NSA A;  2BCO A;  1H8L A;  3MRU A;  4UEF A;  5JM6 A;  5K8P A;  3FEC A;  3GUX A;  3NH8 A;  4UIA A;  3L2N A;  1TKF A;  3BI0 A;  3NFZ A;  2ZOF A;  2ANP A;  3PFE A;  4UEE A;  2PCU A;  1DTD A;  4MRI A;  4P6Y A;  3SJX A;  2PJ6 A;  1TKH A;  5F09 A;  4NGS A;  2CF4 A;  2PJ0 A;  3DLJ A;  3KAS A;  5LYL A;  2AFO A;  4OIW A;  4P45 A;  3SI2 A;  1QQ9 A;  4LQG A;  3H8E A;  2WYR A;  5HVH A;  4A39 A;  2V8V A;  4P4E A;  3KQX A;  1XMB A;  1TF8 A;  3FJU A;  3FVL A;  3CDX A;  1VHE A;  4OC0 A;  4MHP A;  3I1U A;  4ZYQ A;  1Q7L A;  1M4L A;  3SI0 A;  4MCR A;  3GLJ A;  2V8H A;  1RTQ A;  3B3W A;  2PVW A;  4NGQ A;  3SI1 A;  1HDU A;  2Q4Z A;  2PJ9 A;  4P44 A;  2O53 A;  3IEH A;  4OID A;  4NFR A;  1JQG A;  2G9D A;  2I3C A;  3CT9 A;  2PVV A;  4G1P A;  1Y7E A;  3BI1 A;  4NGN A;  4IHM A;  5LYD A;  1ELL P;  3TC8 A;  3SJG A;  3S9L A;  3IIB A;  3KHZ A;  2PJ2 A;  3PFO A;  3KR4 A;  2EK9 A;  2AFW A;  3D7F A;  3B3T A;  2AFM A;  4UEZ A;  3PBB A;  4F8Z A;  4MCQ A;  2C6C A;  3IFE A;  2ZEF A;  2AFX A;  2JBJ A;  4P4F A;  2PJ4 A;  4OC2 A;  1XRY A;  3PRT A;  1YW6 A;  3D68 A;  3FED A;  1GYT A;  2RB7 A;  4YWY A;  4R7M A;  8CPA A;  2BO9 A;  1LFW A;  1ZLH A;  3PB7 X;  3K2K A;  3LWU A;  2IMO A;  4P4J A;  2AFU A;  3IJ3 A;  1Z8L A;  2OR4 A;  4B6Z A;  5JH9 A;  3ISZ A;  5LYF A;  4ONW A;  4ZI6 A;  5K8M A;  3N5F A;  2PJ3 A;  2PE3 A;  3KL9 A;  4FBE A;  2PIY A;  1IGB A;  4OC4 A;  5J1Q A;  1AYE A;  4ZX8 A;  3NA6 A;  3SJF A;  3RAM A;  2CTC A;  4NGM A;  1ZG7 A;  3BHX A;  3KGQ A;  1CP7 A;  4JZ0 A;  1TF9 A;  4FAI A;  4YU9 A;  3WAB A;  4H2K A;  1XBU A;  1YSJ A;  4EFD A;  1F2P A;  1BPN A;  4P10 A;  2PJ7 A;  4PPZ A;  2EWB A;  4X2T A;  2GRE A;  2PJA A;  2GU2 A;  2ZED A;  3BXM A;  2BOA A;  2JEW A;  5HVG A;  2QVP A;  1IY7 A;  3VH9 A;  4Q7A A;  1DE4 C;  3NH5 A;  2V77 A;  2PRQ A;  5HVF A;  3CPA A;  2EK8 A;  1UWY A;  3SJE A;  4MMO A;  3B3S A;  1CP6 A;  4ZY0 A;  3IWW A;  3D67 A;  4JYW A;  2ZEL A;  4TNU A;  4OC3 A;  1XJO A;  4P4D A;  4FWU A;  3D66 A;  3B3V A;  2PJC A;  3IC1 A;  1VHO A;  5ELY A;  3PB9 X;  3VAR A;  3FF3 A;  4A94 A;  1YW4 A;  3B2Y A;  4F9V A;  1YME A;  5CBM A;  3T8W A;  4RUH A;  4BD9 A;  2GLJ A;  3B35 A;  1KWM A;  2ZOG A;  4Z65 A;  3V7Z A;  3WC5 A;  1LCP A;  3DGV A;  4PQA A;  3FX6 A;  3RBU A;  1BAV A;  5LRG A;  2ZEH A;  1PYT B;  2F8H A;  2WZN A;  4DUK A;  1FNO A;  3PBE A;  3FEE A;  1F2O A;  4OC1 A;  3KI9 A;  2RFH A;  4FUU A;  4O23 A;  1QMU A;  3CPX A;  3K9T A;  2QJ8 A;  2ZEO A;  4F9U A;  4R76 A;  4W9Y A;  5D29 A;  3RZA A;  4EME A;  3WT4 A;  2C6G A;  3S9N A;  1EE3 P;  2V8G A;  2CTB A;  5HXD A;  1Y0Y A;  2NYQ A;  5D8N A;  4PXC A;  2C6P A;  2O4H A;  2POK A;  4MCP A;  3B7I A;  1PCA A;  3HUV A;  4NGT A;  4MXU A;  1CBX A;  4PXE A;  1CG2 A;  2PJB A;  4OKO A;  5I4M A;  3IO1 A;  1ARM A;  2ZEM A;  4KSI A;  2Q43 A;  3MN8 A;  2XEI A;  1ZG9 A;  2FVG A;  2QYV A;  2Q51 A;  4IAV A;  1OBR A;  4A38 A;  4R6T A;  3VAT A;  4P4B A;  3FH4 A;  4GM5 A;  4UIB A;  2J9A A;  4MCS A;  3JRU A;  4PXD A;  2ZEN A;  1ELM P;  2ZEG A;  1LAN A;  1TXR A;  1ZG8 A;  1Z2L A;  2GLF A;  3KHX A;  1AMP A;  1LOK A;  4WJB A;  1Z5R A;  3KQZ A;  4NJR A;  1F57 A;  3GB0 A;  1FT7 A;  4DYO A;  5IB9 A;  1VGY A;  1R43 A;  2PJ8 A;  4NGR A;  1ARL A;  3KR5 A;  4MHY A;  1ZLI A;  2C1C A;  4EWT A;  3D7H A;  4MHZ A;  4PXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...