2AG1A

Crystal structure of benzaldehyde lyase (bal)- semet
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
553
structure length
553
Chain Sequence
MITGGELVVRTLIKAGVEHLFGLHGAHIDTIFQACLDHDVPIIDTRHEAAAGHAAEGYARAGAKLGVALVTAGGGFTNAVTPIANAWLDRTPVLFLTGSGALRDDETNTLQAGIDQVAMAAPITKWAHRVMATEHIPRLVMQAIRAALSAPRGPVLLDLPWDILMNQIDEDSVIIPDLVLSAHGARPDPADLDQALALLRKAERPVIVLGSEASRTARKTALSAFVAATGVPVFADYEGLSMLSGLPDAMRGGLVQNLYSFAKADAAPDLVLMLGARFGLNTGHGSGQLIPHSAQVIQVDPDACELGRLQGIALGIVADVGGTIEALAQATAQDAAWPDRGDWCAKVTDLAQERYASIAAKSSSEHALHPFHASQVIAKHVDAGVTVVADGALTYLWLSEVMSRVKPGGFLCHGYLGSMGVGFGTALGAQVADLEAGRRTILVTGDGSVGYSIGEFDTLVRKQLPLIVIIMNNQSWGATLHFQQLAVGPNRVTGTRLENGSYHGVAAAFGADGYHVDSVESFSAALAQALAHNRPACINVAVALDPIPPEELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords benzaldehyde lyase
publication title Structure and mechanism of the ThDP-dependent benzaldehyde lyase from Pseudomonas fluorescens
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 175
structure length 553
sequence length 553
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.38: Benzoin aldolase.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ag1A03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ag1A01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2ag1A02
4MPJA 5EJ5A 1HZZC 1YC2A 1X80B 1UM9B 2EZTA 1PNOA 4JUBA 4UTRA 3L84A 4C7BA 1O96B 4JT8A 1ITZA 4Y6OA 4L2IA 2JGDB 1QS0A 3M49A 2C31A 3DV0B 2IEAA 1B0PA 3F6BX 1UMDB 3ZHUA 4C78A 2Q5OA 3AHFA 1X7YB 4K9OA 3CLRD 4JSRA 3D4BA 3EXIA 4Y6QA 1TRKA 3AHEA 1S7GA 2A1TR 3AHJA 1DJLA 1GPUA 4BN4A 1UMBB 1PYDA 3ZHRA 1YNOA 3AHDA 2PANA 4L3OA 2UZAA 4V1CI 1ZPDA 4FEEA 3EXG2 5I5GA 1IK6A 4UTNA 2PDAA 2R5NA 3AI7A 1V16A 2QTCA 2V3WA 4QPZA 1XLTC 1YHYA 5MFZA 1YHZA 1PT9A 1AY0A 2NYRA 4KXUA 4BVBA 3M6LA 1V1MA 1U2DC 1TKBA 3AHGA 1U5BA 1QS0B 4JD5A 2H2HA 4O8ZA 1Q6ZA 3GLUA 3AHIA 1YC5A 4MPRA 5EJ7A 5MGNA 1J8FA 1Q14A 4JU9A 3EA4A 2AG1A 3FZNA 3OE1A 4K9PA 3EXIB 4X3PA 2JI9A 1PO7A 2BFFA 4F4UA 4K9NA 4XEUA 1M2HA 3LQ4A 2IHUA 1M2KA 2VBFA 1SZDA 1OLSA 2JI7A 5I4IA 2FSVC 3F6EX 1UPAA 2YICA 3ZG6A 4RMHA 2OO5C 1V16B 4I5IA 5EJMA 2WVHA 4HDAA 2VK8A 2BFEB 3GLTA 4C7XA 2Q29A 1NI4B 5HYVA 4UTVA 1U5BB 4IF6A 3MOSA 4UUBA 4Q9DA 3CF4G 1W88A 2O1SA 5C4IA 1X7ZA 3IAEA 5K6TA 4K9KA 4FZ3A 2G28A 5DGDA 2C3YA 2BFFB 5MFPA 4KGDA 3M34A 1V5GA 3CLUD 1EFPA 4BVGA 4K9QA 4BVFA 4J16C 2BEUA 1MA3A 1S5PA 3LQ1A 2BEWA 5BWLA 4TWIA 3RIMA 1JSCA 3D81A 5HGXA 3HWX1 1BFDA 1QGDA 4BN5A 4ZP1A 3U3DA 2R8PA 2FWNA 1QPBA 3U31A 2VK1A 4FVTA 2A1UA 2H2GA 2FR8C 1POXA 3HYLA 1OZGA 2DJIA 1KEKA 2OZLA 1NM5C 5D7NA 4R8MA 3ZGVA 2JLAA 2BFBA 3EYAA 1W88B 1M2NA 1OVMA 1V5FA 1YBHA 4KXVA 2IHTA 2Q28A 5BWOA 1X7WA 1D4OA 2C3PA 3EXFA 4HD8A 3JWPA 2FN3A 2B4YA 4JT9A 3JR3A 5BWNA 2EZ4A 1NGSA 1OLXA 4TWJA 1U31A 5EJ6A 1MCZA 2EZ8A 3UPTA 2BEUB 2WVAA 2Q5LA 3EXHC 2BEVA 3RIGA 4KXQA 2BEWB 5HJEA 4BV2A 3KOMA 1SZCA 4UTZA 2VJYA 2XTAA 4V1CA 1T9BA 3FSJX 2C3UA 1OZFA 5IMSA 5AHKA 1R9JA 5I51A 3EXHA 5MF6A 4GM4A 2E6KA 1UMCA 4F56A 1V11A 3EXEA 4JUCA 3PDHA 4UTXA 2OZLB 2G25A 3DUFA 1T9CA 4JU8A 2XT9A 1OZHA 1U2GC 4WBXC 2UZ1A 2BFBB 3FLMA 2H2FA 4C7VA 1X7WB 4QQ8A 3PKIA 3EXFB 1M2GA 4RJKA 1POWA 1V1MB 2C3OA 5EXEA 2NXWA 4G1CA 4BV3A 4IAOA 2OD7A 2VK4A 1OLXB 2WVGA 1Y9DA 4RJJA 4ZZIA 1OLUA 4D5GA 1YI1A 3IAFA 5I5EA 4J1TC 2BEVB 1UPCA 3ZGOA 1TKAA 1YI0A 1TKCA 1DTWA 4KXWA 5HHTA 4Y6LA 4GM0A 3ZHTA 5K6RA 4V1CB 3DVAA 2G67A 4KPUA 2H4HA 1E3TA 1UPBA 2JIBA 4RJIA 1OLSB 3EXHB 4MPPA 2X7JA 3HWWA 1UMCB 1V11B 3EXEB 1X7XA 1L8AA 4BVEA 1W85A 4GG1A 4JUAA 1U28C 3DUFB 3AHHA 1PNQA 1PVDA 2UZ1B 1YD7A 2Q5QA 1PTJC 5K3SA 2BP7A 3ZHSA 2VBIA 5EJ9A 4K9MA 3CLTD 5FYQA 2W93A 2IHVA 2Q27A 5DGTA 4FEGA 4RMGA 4RMIA 4JUDX 4K9LA 3AHCA 2Q5JA 2QQFA 4MQ5A 3D7KA 5ERYA 4KXXA 2QTAA 1Q1AA 1Z8NA 1X7ZB 2XT6A 1OLUB 2OORC 1N0HA 4QELA 2OD9A 4IG9A 2H59A 5EXDA 5FEMA 1O97D 5K2OA 2J9FA 1DTWB 3CLSD 3RIYA 1T9AA 4KXYA 4GP9A 3EXG1 3GLRA 3DVAB 5EJ8A 1V1RA 2BFEA 5EJ4A 1PI3A 4UUAA 2C3MA 2FRDC 1NI4A 2EZUA 2JLCA 2Y0PA 2BFCA 1X7XB 1W85B 1WCIA 2BFDA 2H4FA 3OOYA 1M2JA 2AG0A 2VBGA 2BP7B 1X80A 4D5EA 1UM9A 4RMJA 4UU7A 4JUFA 2JI8A 2JI6A 3M7IA 3LQ2A 2H4JA 1ICIA 2JGDA 2OD2A 3E9YA 3DV0A 4X3OA 5ERXA 1UMDA 2BRUC 1X7YA 2PGNA 4BVHA 1V5EA 2O1XA 1Q17A 3K35A 1T9DA 5ESDA 2YIDA 2J9FB 1RP7A 3EY9A 2HJHA 5EJAA 4GM1A 1UMBA 1EFVA 1V1RB 3LPLA 4MZXA 4COKA 3GLSA 4GPEA 2PGOA 3PKJA 5DEIA 3ZHQA 2H2IA 4BUZA 2C42A 2H2DA 2QQGA 2BFCB 3UK1A 1WCIB 2BFDB 2R8OA 1YTLA 4UU8A 2EZ9A 3ZHVA
chains in the Genus database with same CATH superfamily
1Z6GA 3KZOA 1SRQA 1XLVA 4DDHA 4L3WA 1SU6A 4A8JB 2FNAA 1WOYA 3M4JA 2Z2JA 1JHQA 2C1XA 3ON5A 4LYGA 4MUBA 4I9FA 4D4JA 4F97A 3NH6A 4QOHA 4Y9DA 3RTEA 1GGFA 3WZMA 3KOWA 4YCNA 4F9TA 1DTSA 4QASA 2F1RA 1YH3A 1C4XA 1TVMA 1EVKA 2R66A 4I66A 4L2IA 1IIRA 3U4HA 2JGDB 2VQDA 1JR4A 3DAHA 2WT4A 5E3HA 3EOAI 3F6BX 3B1JA 4FQ8A 4WERA 1RXSA 4V24A 1FLVA 2Q5OA 3V00A 4C78A 3VGJA 2YHBA 4B9EA 1BH2A 5LDDC 1HORA 1IBCA 3GQBA 1JWAB 4L8WB 4YBRA 4IIJB 1WX1A 3RSZA 4ARVA 1ZONA 3SQMA 4B7CA 2GA9A 3V7NA 2IW1A 2IZZA 1TRKA 4UAUA 4HUQB 4F4DA 3RI3A 1O0BA 4UD6A 5JVDA 1OX5A 2YHIA 3IBCA 4QSMA 1G59A 4C3VA 4XFDA 2V3CC 3U3MA 3LT5A 3DOEA 4QUAA 1HSZA 2V7TA 3KPYA 2XXAB 2VHTA 2R11A 5G1PA 4DWOA 5FFMA 5IT0A 3GELA 1EWQA 1UZNA 5H0IA 5C7OO 3IEVA 2HW8A 2H8GA 1AC5A 4KPEC 2Y92A 4CUZA 2A7QA 2IYRA 4G0YA 1SK8A 3TWOA 4F5EA 4MDEA 3IYLW 4C14A 4NU8X 4OLBA 5CT4A 2Z3WA 1YA6A 3L8CA 1Z5WA 3WK9A 1FOEB 3IP3A 4N5HX 1E32A 3SE7A 1B6GA 2GKSA 2BKEA 4DBVO 4Q3OA 2BEKA 1GPH1 1N6HA 2QSZA 1KIMA 3COSA 3KQOA 4OYHA 3ZE7A 1KEPA 3T95A 1ZCBA 1JIIA 4EGAA 1A7UA 1DEHA 2XTZA 3RRZA 3SFTA 3SJZA 3T1TA 4DLPA 1M8KA 3VSDA 4H1UA 5KWJA 4AF7A 2Q9BA 1CY8A 3GLHE 1E1RD 3Q9LA 3QFTA 3H2KA 3ZWAA 1FTYA 1F7UA 3GJ5A 1CLUA 1TA9A 2HLDA 2C4NA 3OIWA 3MBIA 3NVMB 4XIGS 1W5SA 4CCAA 2WK1A 4YJHB 4ZGWA 3LD9A 1NOIA 3EEFA 4GIBA 1ISFA 2JBAA 4DSAA 1JR3E 3JYPA 4O1IA 1PJ3A 3SQNA 1DC8A 4OATA 2WMNB 4R9SA 3BGOS 3KUXA 1G60A 2D8MA 2YWJA 4LVCA 1L5LA 5KQLA 1E62A 1F9EA 1PT7A 5FUYA 4ZVRA 2WHQA 4ASUD 3PITA 3QV2A 1MG0A 2ZB2A 4H17A 5CVTA 3MINB 2N9UA 5GIPE 1MH1A 2ZROA 3O8CA 3PGVA 2J3IA 2WPDD 1JPUA 1VIVA 4JBHA 1UMKA 2OZEA 3LP5A 4BPRA 4D9NA 2IY7A 3DOOA 2I2DA 3HJNA 2QN1A 1T2CA 1C8BA 4LTNA 5D2CA 4HGZA 2OHOA 2PH3A 3I32A 4JI6B 2JJ1A 2YYAA 2JEYA 4G63A 1XTZA 4G4IA 3RD5A 2MR6A 1ONPA 2XNCA 5DHQA 1SUCA 2FFQA 2BTQB 1M2KA 2V97A 3IIEA 4FOPA 4N47A 4E5DA 5JSZA 1OHHA 2L82A 5FIUA 2QDXA 1XRJA 3O8QA 4GI1A 3RF6A 3EFEA 3LSYA 3PX7A 3DDZX 4LY0A 4QDUA 3EFHA 1RPZA 2M6SA 1GPJA 3LA6A 2DSNA 4QL3A 4CLOA 3GFSA 2MHCA 5J2UF 1PL8A 2AFIA 2GLUA 2QG6A 2VZEA 4PLWA 3BILA 2X0DA 3U37A 1UPAA 4C20A 1SELA 5JIBA 1BW9A 1I7PA 4O4IB 1IHYA 3T3DA 1HNZB 1B0AA 3FPCA 3MBOA 5E95A 5D3MA 3AR8A 4HP8A 4Z9YA 4MV6A 1TF5A 2VKQA 1XYYA 2B5WA 2J45A 2JGIA 2JW5A 2WZQA 2Z4RA 3GRPA 3HCBA 3IV9A 2H85A 4MYUA 4Q9HA 3WGKA 4BRSA 3FW1A 1L7PA 2IA5A 3C39A 1JQAA 3GCWA 2BMFA 4GP7A 3R74A 1F6DA 5SZKB 4WZAB 4N9WA 2J4FA 3MOGA 5JD5A 1U63A 5EE9A 2ZR0A 2O2HA 2HCRA 3TVDA 1CEEA 2XA1A 2HN9A 5KQSA 3HUDA 3SYMA 2OCAA 3G13A 4ZC1A 4EEZA 1MO4A 1YVUA 3MOSA 5HF9A 5CA1F 1O77A 5DBOA 3NCHA 4Y2UA 3R8XA 4Z6KA 2GD2A 2QLNA 2B8EA 2XWSA 3CF4G 1KI6A 3KUCA 3MJDA 1KYVA 2R84A 3HBFA 3ORYA 3KKZA 2H0RA 4HGOA 3ADKA 3Q5EA 1SA0B 4IDPA 4JSTA 1JLRA 2G9RA 4BNLA 3ZNOA 4MA0A 3FUXA 3EVDA 2WSMA 3IV6A 2E5FA 5KNCA 1PE0A 4LFAB 1GIAA 1XL1A 3TFQA 2CMDA 2YN2A 4R4JA 1IEXA 1INLA 3HJCA 5MHTA 1U8ZA 2CLSA 3B52X 4LNUA 3VUEA 4JFAA 4M22A 3N3AC 5H3LA 3VR5A 2ONCA 1GGMA 2ASEA 3TB6A 3SMQA 4K3UA 2QZSA 3HBAA 4J76A 4UPDA 2ARKA 1CX9B 1JQEA 2HLPA 1CETA 5FBQB 1U81A 3QVSA 4RLQA 1JFFB 1YWGO 3EDOA 3Q11A 4N5NA 3DTNA 4NBWA 2J9RA 3PWKA 5IG2A 4O29A 3EYWA 4E5YA 4QDZA 3DO5A 3OD5A 3SS7X 1S5PA 1N0WA 3VSBA 4WOPA 1XTBA 4MI6A 3O84A 3DTYA 1VI6A 4E4YA 5AP9A 4CIWA 3MMSA 4I9UA 2REQB 4ZXFA 1R0XA 4FS3A 1ECGA 3OFJA 4GL2A 2QORA 3FHTA 2ZATA 1F38A 1QGDA 4OO3A 3A26A 5FT9A 4O4LA 5EQDA 2DBQA 3G85A 3G8CA 1XGKA 1QKKA 5KYUA 2VK1A 1JPJA 3OAAD 1VLMA 4S0XA 2Y71A 3GGCA 3O3MB 2ZBVA 3NALA 1D9XA 1KEKA 3K2QA 3MAGA 3TOZA 1KQ3A 3ISJA 4ALMA 3SIWA 4XUGB 2ZBUA 3WO1A 5KJEA 4DBLE 5B3KA 3L9XA 1E2LA 4G85A 4BX0A 2HJWA 1UL1X 4PGMA 1FDOA 2M6LA 3ILXA 1KMNA 1G1AA 1LDNA 3O8LA 4BU1A 3GA5A 3PFBA 1ZWLA 2FR8A 1GNSA 2W2KB 2R6JA 2C7PA 3OZSA 5SY4A 3QJGA 3ASUA 3RVOA 4JENA 2ZJBA 2JJYA 4LA4A 4LXGA 1DT5A 4DA4A 1JFTA 3VNVA 3O4RA 3GZ4A 2F8LA 2X0IA 4B4DA 3ENZA 1G8MA 2QT0A 4LHWA 3PNLA 3L7JA 5DNWA 1LV7A 3CUKA 1CUYA 3L41A 4P7GA 2ZXUA 1NSFA 3EEIA 3QGMA 3P0IA 5IVKA 4TWJA 2HFKA 3G5LA 3VNAA 1KDYA 5ECYA 1CERA 2A8YA 1O9BA 3KSBC 3QVJA 1G5TA 1Z33A 2WVAA 2ZKLA 4J07A 3LAWA 5ADWA 2QTWB 4MEAA 4B2IA 3UC5A 3ZBPA 1QZ3A 3WL3A 3THXA 4OQDA 1UAAA 3CQ9A 3M1LA 4FDAA 5GZ1A 4B17A 3OURA 1ZOIA 1RXYA 4H15A 1JHDA 3R5FA 2HU2A 3L8EA 4LJKA 1VL8A 1YIDA 3AY7A 4KQHA 2W6QA 4WDRA 2V5UA 3P96A 5TY0A 4UXIA 1JKIA 2G6BA 1PW5A 3K05A 4UARA 1MU0A 1VP9A 2VAPA 3BWYA 4RTSA 4WXRA 4D44A 5F1OA 3SWWA 3EXHA 1GZSA 5IK2D 5HIAA 1EG7A 1SZPA 2GVDC 1VQ1A 4IHQA 2H8KA 1H6BA 2AG8A 3F7MA 5E6RB 3H6HA 5E6UB 1XBTA 4HNHA 4O2BB 3U1TA 3PWTA 5HF8A 5D8DA 5FTNA 5BV2P 4LF8B 1T9HA 1HLFA 4EHLA 4BNGA 4YP9A 2WV7A 3BQNB 4HQ6A 3OQ1A 4MUNA 3K73O 4AQ7A 1Z62A 1DRKA 4YS6A 1IM5A 1TNDA 3LX8A 4PAOA 3TGPA 3H2HA 3A1DA 2JFZA 2H1FA 2ESRA 1CUDA 1XMIA 3PL1A 4N82A 4NF2A 2UYHA 1TA4A 2Q3HA 3QELA 2J5RA 1GADO 3ESXA 1NUQA 4UEJA 2B0JA 3PNMA 1UQRA 3VU8A 4BV3A 4NYMQ 2GAIA 2Z43A 3Q3IA 4GGPA 3TLKA 5JCXA 1ECPA 1T8YA 4MRAA 3WNDA 4BWFB 3I6QA 3BYZA 4F21A 3D8NA 3QU4A 5KKNB 3B82A 1I3LA 3DLCA 4XOIA 1YJXA 1KY2A 1Z6ZA 1NMQA 2VDWB 2PMBA 2BEVB 4KFRA 3T52A 5KINB 2WUFA 1GGEA 1MJHA 1FPQA 4KQFA 4UUOA 4MVJG 4Z9AA 3RTGA 3SPXA 1TKCA 3GU3A 3I30X 3UM9A 5I3CA 4B6FA 3ML1A 1CU1A 1AO3A 2ACKA 2ZFUA 3BIFA 3LM8A 2QUHA 1R9GA 2JK1A 4QA9A 4MJLA 4B3RB 2RAFA 2GF9A 2W0SA 4R51A 1FYVA 2ZWVA 1L2TA 1TZCA 4P4SB 3Q72A 4WLVA 4HY3A 4AN0A 2QN3A 4J1TA 2VYCA 3HFSA 3PXBA 3NIWA 2VPPA 1FL9A 1NNI1 4YY3B 1V8OA 1XZIA 5FH9A 1KVTA 3S99A 3PPVA 1X7XA 2ZJ5A 4GWKA 4IWYA 3LWDA 5BR8B 2CLMB 3B3GA 4RTJA 1DEAA 2EWWA 1F9AA 3V6LA 2I67A 1QV7A 4RV4A 3DUFB 5C5IA 3ZZTA 3LOPA 2IBTA 1B7GO 4YMWA 1U9IC 4MP3A 5T67A 3TX6A 4F6CA 5IHPA 4WKPA 1NLZA 1B43A 1DKMA 4J6FA 4AAYA 4BEJA 4FWBA 2W70A 2C2HA 3RS5A 2OK7A 1T0PA 1PBNA 5CXXA 3T5TA 1AF4A 1ONOA 4G5YA 1NDQA 2GK7A 2PKWA 3GGPA 5BY2A 1A2QA 2RGNC 1KETA 4CKWA 4LSWA 3O8BA 3RC8A 1SQGA 4ECEA 5B1YA 3Q0TA 1RZ3A 2GUGA 1BE1A 4JWTA 5EJ6A 3E8SA 2P30A 1BH6A 4HQFA 2IYXA 2WKWA 1MQ8B 3ZDZB 3HO1A 1GPNA 1EDZA 1RQXA 2QSYA 1W47A 3IUJA 4P4UA 4AXBA 1DARA 1EE9A 1Z8NA 1GSOA 3CV3A 2AV6A 2GM3A 3IKLA 1OWLA 3LG2A 1IQRA 4ABYA 4O5OA 1N0HA 1NDHA 4YJ2F 3U60B 2P11A 5CIWA 1QLWA 2VT3A 1MT3A 2IU4A 2DPMA 1PNVA 4HWOA 4KEAA 3OECA 1O97D 4OOEA 1UPTA 5EXDA 3H16A 4REOA 4PSCA 4TT3A 5D87A 4CCYA 1MAUA 2YWEA 2A33A 4BE7B 1JT2A 2PSFA 1WPRA 3NUGA 5KDLA 1J6UA 4GOLD 4U7WA 2FFJA 3DL4A 1A8SA 3UMVA 3KQPA 3LY9A 5K3BA 3HQ4O 3DM5A 1D2HA 3EODA 4PG4A 3TQSA 1FQJA 4HLUC 4LNAA 4Q93A 2Q4RA 3UB2A 1L4FA 1DFGA 2EZUA 2R1ZA 1JEOA 2ZT5A 3SXJA 3VDMA 1MEOA 1MJGM 4BX8A 4R7TA 3TEJA 4NBRA 2QZPA 2JHCA 4HDMB 3MOIA 1C4KA 4AECA 4G8JA 1PR9A 3LWNA 1WCIA 1UT5A 1YB4A 4URZR 1COWD 1II8B 1TCAA 3QVVA 1XZNA 5E9WA 5JJKA 3HLYA 1O95D 3P9KA 1KA9H 1T5LA 1JA9A 3EWAA 4D92A 4QTUB 1WA5A 5HXAA 2W2OA 4HRAA 1L8LA 5I8WA 2Z3VA 1VHJA 3L18A 2II6A 5CW2A 4MARA 5ADHA 3RSLA 3W7AA 3LKVA 4C4PA 2QTTA 3E1SA 1V3UA 3IAAA 2XYGA 4BQPA 1V3QE 1C3OA 5LNK1 4PIPA 3HXTA 4NV3A 4AB1A 4AVYA 2BI8A 2AI1A 2M32A 3KVYA 4J75A 3FWNA 1A4RA 4L51A 2G17A 1JKXA 4UQOA 5IH3A 1KVSA 4NOKA 1N8KA 1KK3A 1P2TA 2P9GA 3LHSA 4YIKA 5H82A 2PH5A 2AJBA 2WP8J 3NBUA 3SIRA 2K7ZA 1TJ5A 3GMDA 2Q4TA 4UJ3A 4G0WA 3U4MA 5AM3A 4BVHA 1S9HA 4J0FA 2QUIA 4QXMA 5EQFA 1BN7A 3DFZA 3PGLA 5DB4A 2O1XA 3NS7A 4M9UA 2DR3A 1FPMA 5LA6A 3R7LA 1XROA 1RYNA 3ROKA 1G8AA 3F5SA 3PQCA 1HDEA 1ADCA 1HDXA 1NQVA 1LU9A 2G5GX 3OCWA 3OOWA 3CKMA 4AX8A 1U8TA 1KMQA 3EY9A 1V45E 1PGNA 2C82A 3H5NA 2ZITA 3VTFA 1IN7A 1H0SA 5TC4A 5E4JA 4KQ1A 3ZDCA 3SKYA 3TSOA 1RJGA 2QRVB 2EP8A 3FZGA 3QHAA 5JCZA 2FKAA 4HMQA 4OYLA 4WINA 5K0GA 2DBZA 3QXGA 4BUZA 2XNHA 3PNSA 2C42A 1UPFA 2H2DA 4QOIA 3GDFA 3LOQA 4RNCA 3OLQA 1L7BA 3UC9A 3UAGA 1XRNA 5C8ZA 2ZSFA 2CFSA 4W5JA 3FPJA 2JRCA 1D4ZA 1ZD1A 1JPVA 1FJ2A 2X4GA 4FC6A 1J2EA 2FZKA 4M89A 2FWBA 3TEFA 3INYA 4CKXA 5DM70 4FJ1A 1GNQA 1TI7A 3GLKA 1E77A 1SCJA 3A1CA 1J25A 4ITRC 5CAEB 4CLRB 4EI2A 3W6OA 4I4NA 1QRUA 2XQVA 4LC1A 2YN0A 1YC2A 3L92A 1TLTA 2WZCA 3EHDA 3HNRA 2WWHA 3P9ZA 4IGEA 3WYGA 9ATCA 4ZAVA 3ZU5A 1H6AA 2EZTA 4H3KB 5DYIA 2ZBQA 4AP5A 4F5WA 4UKDA 1D4AA 4B7UA 1IULA 4LV5B 2B69A 4PVCA 4Q15A 4BUJA 1J9EA 1MORA 3DE6X 4LGVA 4EKDA 3ZZMA 1FVXA 3RRXA 4BFVA 1I36A 2WJJA 3ETLA 3UWKA 4D41A 2IUYA 1MIHA 5ARBA 1YMQA 1LQ2A 3ANTA 4MINA 3RASA 3BXOA 4Y8VA 3ZHUA 2AUNA 3C3EA 4M7WA 4XWOA 5CGQB 5FHQA 2FUG1 3IMEA 3ZVRA 4GRAA 3ZXUB 2OT3B 1I2DA 1A5TA 2W2MA 3GT0A 4WVLA 3R0QA 2C4HA 2AXQA 1VYTA 4JSRA 5KYWB 2DP4E 1QDEA 3ZHBA 1Q91A 4F3NA 3RUFA 3UANA 1E1YA 5FA6A 2PGDA 1S3SA 4HNTA 4DLRA 1S7GA 5KU7A 2HCTA 3CEAA 5F5XA 1H1DA 2QIPA 4MUGA 4J0QA 3UOAB 2NU8A 1I2ZA 3EGOA 3LV8A 5GM1A 3B2NA 1XELA 2V8BA 4KUGA 4R2XA 3QEOA 2XMQA 1X15A 2Q49A 1VJGA 1KVQA 3OBIA 3OPVA 4TUYA 3ENNA 1R0ZA 4UHEA 5L7YA 1KQOA 2JFFA 5ESWA 5EJEA 1CRQA 4LMPA 1BSVA 3BREA 2ET6A 3OZTA 4KQ2A 1RQGA 3MHTA 2HAEA 4BZZA 1GN9A 1JYEA 4M1YA 3E9EA 5IDYA 4RK5A 2VYQA 1SBTA 3V4PB 5AK0A 2NVOA 1O6ZA 3ZBTA 3ZNQA 1CE8A 2AG6A 3SLGA 3NIFB 4H18A 3EDRA 1U90A 4JKIA 4Y9SA 2JD0A 3NJ4A 2BAGA 4WNAA 4DA0A 2D0OB 1UFOA 3TW6A 2GD0A 1JJAA 5B3JA 3MYYA 3Q88A 3WLSA 1JFSA 3DDWA 3MTDA 3ELDA 1KBZA 3X0DA 5K99A 1V71A 3LUHA 4DS3A 5BSFA 3LC7O 5CB4B 2FUEA 3CF2A 1U04A 3FJ1A 5ECGC 3PQ3A 1XZLA 2QSUA 4FHCA 1ENYA 1PQ4A 1XNGA 5K0TA 4KR3A 4A6EA 1GTL1 1DS6A 1Z5GA 4QEZA 1QS0B 3I9OA 4PWYA 4W82A 2P4EA 2BMAA 2O52A 3HJHA 3IKVA 9LDTA 4FIZA 3EPJA 4KYUA 4DTCA 3WK6A 1NJ6A 1VHWA 2GPSA 2HT6A 4WJKB 1PNRA 3O8NA 2EW8A 3WJAA 2AJDA 4JQYA 1XPRA 1PIWA 1XZAA 4S12A 2PYZA 4P4TA 3FBWA 2LUOA 2WMOB 4K9PA 4CEHA 4LF7B 2OO3A 1ATIA 1Y8QA 4LK3A 4M9XA 3HYRA 4RNDB 4DY4A 5LPNA 4F60A 1O7JA 2SBTA 3V9AA 1JHMA 3UJ3X 4YDQA 1EA7A 1EESA 1GG9A 1NQUA 3GVIA 4MMZB 3ZPXA 4URVR 1RMQA 4GL4A 3EZYA 2P4QA 2ZWIA 1PJBA 2Q3JA 3DBVO 3OICA 3UG6A 2F3TA 3V4OA 4I5EA 4NDZA 2QF7A 4H7JA 1WTAA 5IUJC 3KL4A 2WABA 2PTGA 4UM7A 1EINA 1R66A 1UP6A 1JB1A 1QO0A 3ANNA 5ER9A 1QM5A 4CG3A 1S1CA 1E1QA 1KC3A 4HNUA 4Y1RB 1AB5A 3GC6A 3KSRA 3O8OA 3I12A 3PVCA 2X4IA 4WDQA 4ZQIA 1MJGA 3CIFA 5BT9A 1KI9A 3TRDA 3Q2IA 2FX3A 1RBZA 2X0JA 4R8RA 1EJ0A 2ZYTX 2YOHA 4RTPA 3P71T 4IINA 1A1SA 2V6JA 1D2GA 2ZT7A 4I5IA 4WLFA 3SC6A 2ZT8A 1ZL2A 3ZWYA 2EKQA 4YIHA 1EJ6A 1IK4A 2YNMD 4NYJR 2CBXA 3QXCA 2BFEB 2J31A 4RS3A 4TTVA 3ZYCA 2HWKA 2XA2A 1AF7A 2ZBRA 5FO0A 5LQRA 4RHYA 5AH0A 1W36C 1IY0A 1XZEA 4D8TA 3D3WB 2YR0A 1I4DD 3PJGA 1T1GA 1UADA 3U6BA 5FFFA 4YYZA 1AM4D 3H17A 1VL1A 3MXOA 5AD1A 4DWVA 4OK3A 1KKMA 1KMIY 2E6UX 3S5UA 1XZMA 5DSTA 3TSWA 4QFBA 2MMGA 2GHTA 1RADA 1P0CA 5ITWA 1Z29A 3KAJA 2GN4A 3J7AC 4UOZA 4FXOA 3K0BA 3T5AA 1S6YA 5EPOA 4CEJB 3JWIA 3L4SO 2QR5A 2HZ7A 1X1CA 4JBWA 5HA5A 4EJ2A 2Y2UA 3QKRB 3STYA 1C2TA 1C4OA 3BMNB 4J3NA 3UUEA 5TGTA 3GBSA 4PGFA 1NJ2A 1RWPA 1Z75A 3G8YA 4X54A 2WJVA 5AJVB 3SKXA 4YAKA 1ECCA 1T5OA 2XB6A 4J29A 3U5ZB 1DHRA 4DBLC 5CT6A 2NYAA 3CINA 2YS6A 3RYIB 4ND5A 3PFKA 2D06A 2YYYA 4E6PA 5EAIA 4F9GA 1F8UA 1DKUA 3MYRA 3ZE2B 5HJ7A 3H18A 3UBTA 1QTIA 4RZQA 1WB5A 4MLDA 4NNPA 3VRHA 4X91A 2EHJA 4O2AA 5BR4A 3FRIA 4JEUA 5AJUA 5EMJA 1J90A 3L4BC 4DPKA 1JAHA 3C3YA 1Z56C 4OJKA 1Y8CA 1B26A 2P6MA 1DKLA 5KAPA 1CDOA 1GGHA 5HIJA 2AXEA 1JSCA 2Z9DA 4L07A 4K6KA 3KQNA 2WIJA 1Y48E 4IHAA 3AUSA 4UBIA 1BE0A 4PTLA 4RVCA 4ZT7A 5IUKC 4A91A 2O2ZA 1DKOA 4CDGA 2XJ9A 5BWBA 1MJ5A 5KYXB 3ASYA 1GZVA 1JQDA 2PFSA 2PKRA 5FWDA 3H11A 5F2NA 1XAHA 1X1RA 1Z06A 1QPBA 5C8YF 4J43A 1V39A 4JYZA 4P9NA 5FUWA 1T15A 4GT1A 4NICA 1O89A 2JHAA 1L7XA 1T9GR 4KO4S 4G5FA 4AZ0B 5D7NA 3GVXA 2WV9A 4DR6B 3O95A 1YULA 3BBLA 1LX6A 3FCXA 1RXEA 1W4RA 1YS4A 4WK4B 4JJZA 1T3HA 4KR9A 4D9JA 4I8IA 4E12A 1E7YA 5BMOA 5KDDA 2JJ8A 1HYGA 2QQ5A 3EDCA 2AH5A 4OHUA 4RL4A 2ZYDA 3C5CA 3F5MA 2X0EA 3DTVD 1EHIA 3EEQA 2R62A 3HKEA 4PRKA 1EK0A 1MC8A 4G25A 1UDRA 2E3JA 4MEJA 1TB4A 3TM5A 5KO2A 3TTSA 1KORA 2CE7A 2PVPA 2XUPA 1GZ7A 2I71A 3NRCA 3HB4X 4DLNA 1MHTA 1XA3A 1ZU4A 3KAPA 5IXJA 2XCSB 3NETA 1JEEA 3R7FA 1XU7A 4GOJA 3GJRA 4UE2A 4P4LA 1M6VB 2I33A 2WHPA 3I01M 5H70A 4GBGA 3L4JA 3GMIA 3BTOA 4AL4A 3C45A 3ENWA 2FPPB 2B83A 1V47A 2Q5LA 4KQXA 2P6UA 3IE0A 3I2KA 4QREA 5CNKA 4OBBA 3PTAA 4TZTA 3MBKA 4G0ZA 1E99A 2JAHA 2F90A 5J4KA 4J2OA 1XTVA 4X97A 1CWUA 3H1PA 5ESRA 1SCUB 4MVCA 4XM2A 2ONJA 2JZCA 1XDUA 4YAFA 3SZOA 1E4EB 1V6CA 1WM1A 1Z5UA 3LL7A 2W4MA 5G53C 4MDYA 4P1ZA 2HUPA 4E15A 4J6EA 2FB9A 3AO0B 3BCSA 3KUDA 4V0SA 5FOQA 3P97A 4B44A 3OJ0A 1RI4A 2JCVA 2WYWA 4JROA 3LF1A 4YVFA 1ADBA 1DC3A 4CG1A 5JZBA 4EYGA 4C7OA 5EJIA 1VKNA 2MSLA 3PNYA 3PZRA 3FETA 5DO9A 3EZ7A 3P9PA 3O31A 2QRNA 3PQ6A 1FP7A 1R9NA 4U2DA 5F1PA 4NWIA 1GNVA 3MILA 5DNCA 4OQYA 1Z7BA 4NCHA 5LMCA 4S1NA 3M6VA 4FDUA 4DSNA 3FB4A 4FYXA 4D4GA 1W0CA 1O0SA 2X8BA 3EVNA 3DNMA 2N46A 3GFPA 4KREA 1J9GA 2BFBB 3E8MA 1H2YA 1IZ9A 2QVCA 3UWSA 1JJFA 4JI2B 3JQCA 1E2HA 5DVZA 1YGYA 5FUMA 4DLZA 4PN7A 2WU4A 2JLRA 2R6ZA 4MWBA 1N5LA 1PCXA 2O2CA 1RPAA 2CVHA 3R5HA 3F4KA 5DOVA 5AJZA 2OLKA 1V1MB 3DBRB 5EGNA 4EQ6B 3TIFA 3G7UA 1XF9A 2CYBA 3EIOA 3FOBA 3BFXA 1N1GA 2EQAA 4N3CA 1L7OA 1P9RA 3ZLVA 4BNMA 2GKOA 2Y3IA 1VLJA 1AGYA 1NR1A 1CR0A 4G89A 1MOSA 4HZGA 3KVVA 4EHJA 1XPUA 4XLTA 1Z5VA 4MKFA 2R1TB 1E5QA 2IPAB 1NBAA 4QVKA 2XDQA 2JAPA 4ZU1X 4TYYA 4R2MA 1P2FA 1HEUA 3IAFA 3PHIA 2XWJI 4RY0A 1PTKA 4X0EA 1SUPA 2VDJA 1ZP6A 2GASA 2RARA 2X8WA 1KAEA 4EI8A 1UJBA 5AJXA 5K6RA 3OPMA 2ZI9A 2FHSA 3FNEA 4HL6A 1RNLA 4JGBA 2GO7A 4UD2A 5EZSA 1F8YA 2HMVA 1ZICA 1A50B 4TLCA 3RHZA 3DGEC 1K5HA 1P0FA 3WWEA 2F3UA 3AOEA 4K6HA 2PPVA 4CKEB 5BPFA 2I1LA 4RU1A 1RRCA 2HIAA 4JQZA 4Q0MA 4MQUA 3HU2A 2AG5A 2P65A 4OQ4A 2MYPA 3LXMA 4WBSA 4CU5A 5CDFE 2IP1A 4JLAA 2QPTA 4KWTA 4AWAA 3PEWA 5EZYF 2QTFA 4IRUB 3T34A 3U9LA 3HSKA 1YD7A 1L8XA 2AXNA 2F1KA 3BWDD 3FVVA 5IBRA 3DZDA 1QH9A 2R47A 4OLHA 3SSAA 2HYDA 3R6TA 1N3LA 5AMXA 3T35A 3VKHA 1TAHA 4X62B 1MX9A 4MS1A 1JEYB 2X9GA 3KDAA 5EXXA 2K7FA 2XKBA 2A0XA 3TZQA 5FTLA 1QQTA 2PXXA 3P5BA 4P3YA 2LW7A 1E0DA 4G2TA 3F4LA 3GJ3A 1GP2A 3LCRA 5CUQA 1UOOA 4UW9A 4YRBA 1XTIA 4LXXA 3V1MA 3ET4A 1VPTA 2C00A 5C1BA 3QI2A 4DCGA 3BHNA 1FLAA 4Q1VA 4OREX 2IXAA 1P7ZA 3GG9A 4HPXB 4IG9A 1D2MA 5EHQA 4TVSA 2BLNA 2J1LA 2XZPA 3UXEA 6NULA 3NGXA 4UM9B 4JP5A 2R25B 4ZZ3A 2B1JA 2M1ZA 3D43A 4XQ0A 3ZGNA 2ODEA 4BL5A 5K2OA 1VIDA 2SHKA 4RTKA 2VT2A 3UMMA 2FR0A 2MIIA 4EFMA 1A98A 3ASVA 1SUSA 2LVBA 3EXG1 1USUA 3I4CA 3VHXB 1EFRA 3VZSA 1GQYA 1YR6A 2PTHA 3WIOA 5AYVA 4C5AA 4GE0A 5JCJA 4BLRA 5JYDA 3JQ8A 3AWIA 5CU7A 1JX6A 4OA5A 1Q3HA 4PV7A 4UHDA 4EPXA 1SCKA 2H4XA 1Q95A 4YT5A 2APJA 4EWLA 1TECE 3R5SA 2PV0A 5EMLA 3OF2A 3UJDA 1T6ZA 3A3NA 2C4VA 1NW9B 4IKEA 1K4YA 1MBZA 4WKGA 4TV9B 3TCXB 1RQ7A 2B82A 2ISSD 3ZYZA 5E9QA 4QQNA 4BCDA 3OZEA 1IHPA 4A8JA 3AYZB 2GUWA 2Y6VA 3AKYA 5A71A 3ROPA 2WSBA 1GJRA 1JFLA 3CRZA 1XRLA 4ZVMA 3PD0A 5EFOA 4OI1A 2O1EA 1U0FA 3RIHA 2P6RA 1Y9JA 4OUDB 4CG0A 5KVVA 2GPYA 4H6PA 3NXKA 1YOBA 3OQIB 3UMCA 3I53A 4TSRA 2JGDA 3Q1KA 2GYVA 3RFVA 1CDEA 2XUQA 2YIMA 3E9YA 4L4RA 1SBCA 1P3JA 2NZWA 2YTZA 1Y5NA 4XAQA 5ERXA 4EPYA 2P3SA 1YIOA 1YFJA 2QRUA 3E6AA 3QX3A 1LEHA 4W9RA 3A9TA 5CPBA 4K9SA 1YZKA 2PVCA 3I01A 4YWHA 5E7QA 4IIJA 2RIPA 1CB0A 3WO0A 1KJ9A 4EB3A 4R3NA 1U9YA 4ES6A 2FSHA 3QF4B 3KD3A 3PQ8A 4OHOA 521PA 4HUQA 5BVHB 2RK6A 4EQZA 1G17A 1F1JA 5LQMA 2XUOA 4RL6A 4IVNA 1RRGA 4ZAWA 2PZFA 3PYLA 2R6HA 2XXAA 1TEXA 4PSKA 4UAVA 3LO5A 4COKA 3O21A 3E2IA 4JLKA 3WRYC 4TM7A 4GZ6A 1QCYA 2C58A 2CXXA 1OFHA 2QRQA 1T2AA 4WXMA 1VC2A 1QFMA 5BNFA 3W6PA 4N8EA 4LF6B 4OKSA 1WHSA 3CT6A 1YFKA 2D1FA 2DWQA 3WKEA 2VPZA 1O03A 1O94D 1W34A 4NENB 1R0CA 3L1HA 3WJ7A 1YCDA 2ZIFA 4UMVA 1D2RA 1YQGA 2YRXA 3IEKA 4NLLA 5FFNA 5U4QA 4A6PA 2XD4A 2XKAA 3HXPA 4A27A 3PFFA 3QPWA 1NVAA 5J47A 4YMHA 3L4KA 3FYDA 5KHOC 5EJ5A 2HEGA 3CPSA 1PZXA 1N5RA 4WADA 2D2VA 3RAGA 5HILA 4D98A 3A9SA 5TE9A 2O19A 4JLSA 5CT9A 4C7BA 1JVBA 2ZJ2A 3FKSA 2P9BA 4YJHA 4N3NA 1KSJA 2DPYA 2IY9A 2OXRA 2VOEA 4INOA 4MHOA 4WEQA 1RZRA 1DZIA 2NSHA 3KDSE 3ESYA 3O38A 5MN4A 5KC8A 3TGLA 1L7DA 5LB2A 1DT3A 5KUTA 4KGXA 5ARCA 3PHLA 4LI0A 3AKZA 1GTMA 4O4HF 1ZHFA 3FNFA 3MINA 4LYYA 4QXOA 2XRMA 3R7AA 5M7EA 4B7XA 4BB9A 2ASVA 4M38A 1KJJA 4G0VA 4YCJA 2QN2A 5G02A 1WETA 4WY2A 3DMGA 4LDPA 1DELA 4IDAA 1CJMA 3EUEA 1GPUA 1W30A 2Z5FA 2V55B 3INRA 5BP7A 4MNTA 1SXPA 4TLLB 2ZRQA 4V0ME 2ODAA 5K0BA 4DANA 1GTVA 1RVV1 1A69A 2BTQA 1I9GA 1KJYA 1NXVA 1I5OA 1BFKA 3TMYA 4CR6A 2QM7A 5F7OA 1EVZA 4NBTA 1IEWA 2ZXEA 3D02A 1YJ8A 3T9FA 2ZRKA 5M04A 4EA7A 2IRWA 4O4IA 5ILGA 4Q48A 1UH5A 1I51A 3KZVA 5J2TF 3I0MA 5C8VA 1Y5RA 1IK6A 3K1JA 4H6WA 2PQMA 4KN9S 4QT0A 4BB6A 5DHRA 4C29A 1YR9A 1M75A 5KWEA 4Q5IA 1SY7A 1M0WA 4INAA 1Z73A 5D51S 1HT2E 1USIA 2NU6A 1T26A 4URYR 1DWOA 3E1KA 1YFLA 3C6BA 1X86B 2QJRA 3FFTA 1IAQA 3QVGB 2QTMA 4LXYA 4Q3AA 5FBHA 3DO8A 3OO1A 4WZAA 3TOXA 3TG8A 1BCSB 2CDNA 3DWGA 1PUJA 4ZODA 2PNJA 3ZEAA 5KTRA 1W48A 2J5BA 3C1AA 3LLCA 1CULC 2CEAA 3AHGA 4PX3A 4PC2A 5FDFA 3M33A 1BQEA 2QE6A 1JI0A 2HSWA 3ZWXA 4RVFA 1I4OA 4PSDA 1LY1A 1UBNA 1NPYA 3DWFA 2O0JA 4J1NA 2CNOA 5ECDA 1P6UA 3K20A 2YC4C 1YA8A 2NTYC 2ZTLA 4K2AA 1MQ9A 1M10A 1SA0A 2VYVD 1GPAA 3KT6A 3LA8A 5ICCA 3DFKA 3FHJA 1IDOA 2GZMA 2VKTA 3A6DA 3DAOA 4PPNA 2H1OA 1CQPA 2FWMX 3G0OA 4HTAA 4Y2TA 1OXBB 3ZWKA 1XD9A 2GCOB 3W5IA 2X1HA 4NCKA 1HDZA 3BWBA 4ZKEA 1U0TA 3A32A 2NMVA 4YRGA 2GETA 2H5LA 3HJGA 1M2HA 1Z4LA 1QVAA 2V6GA 4DQ0A 1C9JA 3PJEA 5BV7A 4DMLA 2VBFA 1WD7A 1O6CA 1P7VA 3NBZC 4XYGA 1OLSA 2B8TA 4ZI5A 1JFFA 2VRCD 4AO8A 1THGA 1KS9A 3CM0A 2W0MA 3QLTA 4GRIA 2X42A 2DQYA 4OFZA 2PFKA 3A6EA 1R6VA 3U7GA 1WZ2A 3O2NA 4LJ8A 4PIMA 4IFIA 1ZC4A 1C7IA 4G4JA 5LZ7A 2G9VA 1DUSA 2J9ZB 2WJ6A 4LPSA 1KK0A 1X9GA 4NDAA 5HEKA 4JI4B 3CKKA 2UKDA 2REQA 4M1TA 2XYRA 3JZDA 2RKWA 4P2GA 3VAZA 4J0GA 3OJLA 3NHUA 4G4SP 5DW0A 1W5EA 4HWTA 3GLTA 2UZ0A 4D4KA 3ZLJA 1M2OB 3OBBA 2I4LA 4B34A 1N6NA 2F9MA 2VATA 2MYUA 2WFLB 3C3KA 3G1WA 4MVJD 4YCSA 3W5BA 5TR9A 4X90A 2GKGA 2JFUA 1RM3A 1EVLA 3FI9A 3WK7A 2A9OA 3IT1A 3K5WA 4E5KA 1U5BB 1SHUX 1JJBA 1KFCB 5JMPA 2H51A 1JBQA 4RANA 1ID8A 2GN2A 3E48A 3L93A 3O9VA 4RYLA 2OP0A 4MIOA 5DXJA 3MUFA 1RT9A 5CFOA 2O5VA 2HADA 2ZSDA 2R4TA 3F2VA 3LYAA 5C4IA 3CZ9A 4GSYA 3EGCA 4TN1A 4KRXA 2FCAA 3FVQA 3UAOA 5J1SB 3LQYA 1X8LA 2G28A 2W2KA 3OCYA 2GWRA 2GXAA 2C3YA 2JFXA 2YY7A 3WLKX 1QK5A 2Z2IA 4GMXA 4LE0A 4G8BA 2YNMC 3PUWA 2J9XB 1K8ZB 2AZ4A 2AMJA 1IWOA 3FCSB 4OQZA 3WP1B 4HDOB 3QHPA 5KNCH 4FEAA 5T64A 1F48A 2TYSB 3IXQA 1SM4A 3KBOA 3P8ZA 4BAUA 4MVJF 4EKIA 3CVJA 4IVQA 2LD4A 1PD0A 2IZOA 4NYMR 1TK2A 2ZAMA 3ZH9B 2WWVD 4ZHQB 1BHSA 2NM0A 1W35A 1J20A 1L5VA 2UVDA 3G79A 3VR5H 2C29D 2GBCA 2VZLA 3PUZA 4M76B 3PR2B 4Y0VA 3GAFA 1VDMA 2JKYA 4TWIA 3ZE8A 1QOZA 2VP2A 3PYMA 4TKVB 4FX2A 3DLBA 3WLMA 3IPYA 1PQYA 2NLOA 1PVVA 4MH0R 1QQ6A 2PY6A 3CNQS 3CN7A 1XQYA 4ND7A 5JZVA 1M34E 1PL7A 4WK6A 3D3EA 1H9BA 3K6KA 1YZGA 1J42A 3SGLA 1EAYA 4WNCA 4Q3LA 5EGSA 3PD7A 1WPQA 2FAXA 1THMA 2JLQA 3CONA 4X6LA 5E6RA 4UTPA 4LYAA 4IS3A 4WMLA 2DPHA 4NV1A 1UBCA 2OLJA 5E6UA 3WHLA 3J81k 4O2BA 4W6ZA 1TIKA 4MRVA 1FYWA 2EHDA 2Q2OA 3C6XA 1K3TA 3I1FA 3WGUA 1W94A 5F9HA 1U80A 1OYYA 1B8PA 1TCBA 1QHYA 1TPYA 3D6TB 1RWXA 2HQBA 5FOVA 2ZRBA 4M54A 3O82A 1M9NA 3QY9A 4GR5A 1UJ2A 1W9HA 2TMKA 5LKRA 2BH2A 2GZAA 3EZNA 1M6EX 3VSEA 3JQDA 4QYSA 5EIAA 3BJEA 4R6WA 4NZ9A 4NI5A 4Q03A 4UEWA 2HFJA 1HE3A 2ZSAA 1Y4AE 3PC8C 4LFCB 5ITVA 4YRPA 5F2OA 4YAUA 4JT9A 4EHKA 2Q5CA 1MAWA 3GCDA 4PG6A 3AUXA 5ELXA 3FLBA 3E9RA 2AFRA 1L4UA 1Z68A 1NWCA 1GV0A 2QJWA 3C3DA 4L5YA 5JZ9A 1SHJA 4O3FA 1YRWA 5HDQA 2RHHA 1QRRA 3KHKA 3QBJA 4H2DA 4KCGA 1DXQA 1JMVA 2EKLA 2ZR9A 3UPTA 5IWAB 1VXRA 2QNIA 4IIFA 4LCEA 2B2NA 3LL4A 1MXHA 2VDWA 2BEVA 3RIGA 3RRNA 4BTVA 4DDUA 4C9BA 1T2NA 2ZCUA 2QZ9A 1LPPA 3NATA 2P5TB 1MEEA 3GRYA 3WICA 1ZI6A 2H1RA 4KSCA 4EUFA 2AHOA 2XA9A 3H1GA 2H7XA 3HKDB 1MTZA 2RG1A 1RYYA 4KN8A 4UCFA 2XTAA 3U7QB 1IBKB 1J0AA 3IUEA 2JJ2A 2ILVA 4XASA 3T3PB 4A6XA 1M7HA 4P4SA 4BV8A 1MTOA 1UKAA 3EPLA 3KTFA 1HFWA 3U3RA 1P80A 4IDDA 1VBMA 3V4ZA 4TZ6A 3CLSC 4HX2A 2EARA 2H4WA 4D4LA 4ZI7B 3AR2A 3H05A 4IH1A 4DC0A 4H16A 3V4SA 4RH3A 2CSXA 3ADCA 2G63A 4IDNA 3M4NA 2QX9A 4FKMA 2VK2A 4YYEA 1D0IA 3DUFA 5BV1A 1EVEA 1U8CB 4RELA 3B51X 4DLAA 4LZAA 3EWNA 1NBMA 1ZISA 4C7VA 1YK1A 5FPQA 1L4YA 5HM8A 2YJZA 3U4GA 5C1PA 4JFRA 5JROA 1I3CA 5I9BA 1WEHA 2O8NA 3G8BA 4ZYXA 3FUWA 1L1QA 3A4LA 1G2PA 1EP3B 3P20A 1EZZA 5EZ6B 2XAAA 4GX2A 1KK2A 4HC4A 1KU0A 2HA4A 4YMVA 4G24A 5HRAA 2ZWPA 5IXSA 1QFJA 2NO9A 1LDEA 3SK0A 4K0KB 2RHJA 2YWFA 3Q7SA 2ZSBA 1OZ0A 2JRLA 3B1WA 3DV2A 4MMXB 3IULA 2OQRA 4D7AA 4EMBA 3ZY2A 2A9RA 2DHDA 4KO1S 3QOFA 2JGKA 4W5NA 3SS9X 3CO5A 1JHRA 4KODA 3DOHA 1T3GA 2PXAA 5BPHA 4V1CB 3DE4X 4WLUA 4WCFB 4AULA 2KPOA 3IMGA 3ZZ0A 4EZEA 4PY2A 3LQQA 4RTLA 2XMSA 3REQB 1CUXA 5DGXA 4GGOA 3C7TA 2A35A 5BSWA 1UMCB 1V11B 4KMMA 3HTXA 1SKUA 2WF7A 4UE3S 4DXDA 1UWKA 1MKYA 4QAJA 2P35A 4BVEA 4WUVA 1XZQA 2ACWA 1EWRA 1II8A 5AW0A 1FDIA 3CB2A 5MGBA 1N78A 2AK3A 3Q7EA 4PVDA 4O08A 4KBFA 4Z54A 1I7SB 2E49A 2WJIA 4AFNA 4Q9LA 1MPTA 5K45A 4UBOA 2VBIA 2ZI3A 1V5WA 2W8ZA 3D2LA 1XJWA 4K9MA 4I55B 3SZUA 2RKBA 4FW9A 3BCRA 5FYDA 3A1TA 2ZYUX 5K0LA 3TD2A 4Z86A 2WJ4A 3NHKA 3CVOA 3OEED 3GBPA 1AN0A 1HR0B 3JQBC 4M1WA 1ZGGA 5E1MA 1GHTA 5JARA 3AK4A 1ZD4A 1A5ZA 1EMDA 3G9QA 2B7CA 3LUFA 2R4QA 5AVYA 3G1UA 2JAUA 3HGMA 1YOVB 2UYYA 1IPHA 1PTJA 3P52A 4PS1A 3PDJA 2OQVA 4EUKA 1YVPA 3DEZA 2F2TA 2XT6A 5BMVF 5KPDA 1J5PA 4LG1A 1WB9A 3R3HA 4HGYA 3CYFA 3WL5A 1LS1A 4FPXA 3NJ8A 4TOIA 2F3RA 2HWUA 3F8WA 3GRUA 3Q87B 1T9AA 3CNLA 3FOEC 3PVSA 5KJ1A 1D6NA 2HDNB 4RHXA 4UUMA 4XR9A 3RYFB 2XCUA 1DAIA 3G0BA 4ONEA 4F3CA 4LOHA 2YMMA 1OFUX 1N6KA 4JI8B 1OGIA 2QRVA 4N0EA 1LLCA 2NXCA 3E3MA 3QTTA 4PXYA 1P1FA 4ZOEA 5BUQA 3Q41A 1W7AA 1V6AA 3L0CA 2EFGA 4BATA 4OXQA 3W06A 1MN6A 1UFRA 4HAYA 2BR4A 2ID9A 4GBMA 2CL5A 3T7SA 5AW1A 3TFOA 1Z0FA 4NEHB 3OCZA 4QDOA 2CXHA 3SQOA 3M2TA 2QZJA 1L4KA 1NQ5A 2AR0A 2MSNA 3NYRA 2O4CA 3E7DA 5DTJA 1SBYA 1S8FA 4PAGA 2PCLA 4CLRA 1MIOB 2I7CA 3IALA 2OG1A 1I7DA 1EX6A 2CXQA 1Y33E 2BP7B 4OXYA 3T7AA 1IM8A 2JFHA 1AQYA 2WD9A 4F96A 1TU0A 1Q19A 4CGZA 5TXGA 3D2BA 4ZU3A 2AI3A 5H3CA 3WNBA 1XNRB 1QYRA 3GBVA 2XT0A 1GKLA 3HM9A 5J3JA 5JECA 1MV5A 2QLJA 3QLUA 3ITEA 3PSAA 2ECQA 4JX8A 4QDJA 3RU2A 3M6AA 1Z45A 1Y5MA 1PGPA 2VHZA 2XTMA 3EY4A 4KNWA 4DEYA 5JISA 1YJQA 1VE5A 1M5UA 1DRVA 1TTPB 1WBJB 3F5QA 3Q12A 4B8YA 4KXFB 3LT1A 2H54A 1G8HA 1Q2XA 3G02A 3TOVA 4E4TA 1UINA 3OM8A 5KYYB 1XT6A 3MS2A 3AVWA 4QHYA 4Y6PA 2BGRA 1QX3A 5DTRA 1GR1A 1KE1A 5CIQA 1Z34A 3VNUA 5IVIA 1U8YA 5DK4A 4KSYA 1AT1A 1T1EA 2H0AA 4I6JA 2BGKA 2EWMA 2V5VA 2YUIA 1UXJA 2IU3A 2JIZA 3EIXA 3MFQA 1SEPA 5FV7A 2Q4DA 2GX6A 1QX4A 4YHBA 4PZDA 5IJZA 4GC5A 2GBPA 4OM8A 2X2OA 4HDQB 4CR7A 3P2MA 4NP6A 4URUR 4D0GA 5HKOA 4DAOA 3TH5A 5EINA 1RE1A 1ZGBA 2HZBA 1R0YA 4ER3A 5AW4A 4DV7B 1BOFA 1R37A 4AMVA 3RIXA 1KO8A 1V35A 4EG7A 4UTOA 1SBNE 3B5JA 5FTMA 1NT4A 2NUBA 2ZUBA 4FYYA 5ALTA 3V32A 4UUQA 4BLSA 2EJCA 3NIBA 4IUYA 1ZGJA 1A8IA 4PC6A 5HUJA 2PE5A 3G9UA 4OLFA 4CL0A 2GN1A 2CY0A 3U4IA 4NBKA 3MWFA 2GF0A 2Q1WA 3L02A 4H0NA 4MV4A 2GLTA 3C4QA 3VV3A 4DXHA 2P9ZA 4MI9A 3THYB 4JUBA 4CF4A 4Q3CA 1JHAA 2ATCA 3QYPA 4OGLA 1O96B 4P58A 2Y4NA 3VMMA 2ZJ3A 2XNDA 1X7HA 1FFDA 4JT8A 4QG7A 3WADA 4CEJA 4B09A 5J9FA 1FQKA 1Q7TA 1TO1E 2V6FA 2W8BA 3G17A 1MF7A 5FNZA 3VSAA 2SECE 1QS0A 3ZS8A 2GJKA 3CWQA 4IMIB 4X6UA 3DV0B 2IEAA 3PX3A 3T9AA 2IT1A 4BBZA 2G09A 1AZWA 2FSUA 2WNSA 4NTZA 4AJJA 4U0JA 5BORA 1BKYA 2O2EA 1X7YB 1SKYB 3WFJA 4N5MA 3LDAA 4OMCA 3H8WA 3TUIC 4EYEA 2ZBPA 3FWZA 2OUIA 2Q1TA 4X00A 4HLQB 1VGVA 5HFJA 5EUCA 1CY1A 2FVYA 1DFIA 1EVIA 1DIRA 3NAGA 2JEOA 1JHZA 4C0LA 3A7EA 4EJSC 3RB8A 1PYDA 5K4HA 1EFVB 3LZCA 3MMPA 4BCCA 3ZHRA 4D0LB 3R09A 2C4KA 4JAVC 3N8NA 4PYMA 1WB6A 2VZ0A 5FI3A 4D26A 3L7BA 2B8JA 1JDZA 1E9RA 3A1NA 5AIBA 1U8XX 1XZJA 4M86A 5TGDA 2PWZA 1SD1A 5ALUA 4CV2A 4EPVA 4DVJA 5J63A 5CITA 5B6JA 1LBHA 1A7KA 2GESA 2QJTA 4U6QA 2O5EA 1NQXA 3AXTA 2EJUA 2E85A 1OI2A 4R8LA 2V65A 1E9VA 4YUAA 4WKBA 1OXSC 3D8RA 3VTAA 1JNYA 1RD4A 3QE3A 3COPA 4ZN6A 3N86A 1CCWA 2QZZA 4B3FX 1BHQ1 1OWMA 2AYYA 3C43A 5ENVA 1HL7A 2FPXA 2IYQA 4M7RA 4GSKA 4EVRA 3KPUA 3NT2A 4LRUA 3T3OA 4CI9A 1KP2A 3AKCA 3D3WA 3K0CC 5IYZF 2D2IA 1P91A 3PNBA 1Q0SA 1ST3A 3RUAA 3SSOA 4KUHA 2ZCJA 2NSJA 4H7IA 2VSFA 4EB0A 1YB7A 3NVDA 2ZYHA 3ANLA 2JAXA 1YBFA 3AGQA 5LP6C 1CY2A 3B20A 3BULA 3HB1A 4MPRA 3AF6A 1HG1A 3NTOA 3K9LA 3O83A 4F7WA 4HNVA 5L4NA 4YASA 4KL8S 4RTMA 4LJ5A 1H69A 2H17A 5TQ2B 1XO1A 5IZCA 1LPBB 4UBNA 1DEKA 2W9XA 5ICEA 3GXOA 3NC1C 2ZPUA 8OHMA 1NW6A 2R8BA 2YWBA 1TJNA 3BRCA 5KIAA 3EFOB 1KC1A 1QANA 3QKRA 3EXIB 4MW5A 4X3PA 121PA 3BMNA 3LU1A 4HADA 3ADPA 4X6XA 5K3DA 3VYRB 4F4UA 3ILYA 4JIGA 1G0NA 3DGFC 1YE5A 3GROA 3L8GA 1YQQA 3KOXA 3LLVA 3OH8A 4Q1DA 4ENUA 3I9NA 1ELOA 1N6PA 4OHVA 2DFVA 3PDIB 4LJ7A 2IHUA 4P31A 1IU9A 1U9ZA 2VQ3A 3FGNA 3RYIA 3C48A 1KL7A 4GMHA 3FHCB 1W0JA 1P17A 5HUQA 1U0EA 2JI7A 1N2BA 2JGFA 4G8DA 3CGWA 4DLYA 2FSVC 4IDBA 5KOJB 3NAQA 4N5IX 1CXZA 2E7ZA 4TRJA 1DU4A 2DBVO 5GAJA 2TMGA 4UEKA 5AW5A 5G40A 1UJ4A 4L0CA 5K9ZA 1C41A 4JELA 3SLKA 2OO5C 1E7RA 3GUCA 2P7IA 4BNXA 1A5SB 4RF4A 3KOZA 4I9GA 2JKVA 1B1AA 3IJRA 1SVSA 2X58A 1H2WA 2EGUA 2Z95A 3PC4A 4K87A 5CH5A 3X1YA 1D1QA 1VRVA 5EIBD 4FX5A 2Q4BA 5B1EA 1ZD8A 4XYLA 1TEHA 4UASA 1T6NA 4DABA 5HYVA 1VA4A 1Q1NA 3Q2OA 4BASA 4PE5B 5C81A 4HLCA 2L69A 2ORVA 3SDZA 2CFIA 1RKUA 3F3MA 4DV6B 4ZCQA 5HIIA 5JMOA 1NURA 4AZ0A 3ZKAA 2QBYB 4KNYA 3WA7A 4JCOA 6REQB 1QIMA 4NPHA 5EZ5A 4MV3A 2QPAA 5IJAA 1UBOS 3TL2A 2ZE6A 3JVIA 2FUKA 4D9IA 1QRSA 3IUYA 2G06A 4FMCF 2J87A 4EECA 5AM2A 3BT7A 2JA2A 5A0TA 2PMDA 3KSMA 1X8XA 2W4IA 1G20E 1XJQA 3QP9A 4BNDB 3FD8A 1HNXB 4Y9TA 4MW7A 1FSZA 4P35A 2FSFA 3DLHA 4LPKA 3M34A 1SXJD 1C7QA 4KPFC 2G70A 3IBYA 4DZRA 1L5YA 3ZV6A 1U3CA 2XITA 1E1NA 5A6SB 3CJQA 5EZQA 2GHIA 2X77A 5KVQA 5TSDA 4C3OB 1SBIA 3RJ9A 1MC4A 3UMSA 5F4ZA 1M6VA 3GX1A 3W9SA 3ED5A 4PHGA 2PWYA 1YS6A 2EF0A 4D82A 3L9WA 2FPPA 5FPKA 1K6JA 4HH1A 2C57A 4RVGA 2AR9A 4AY2A 5F33A 4XDYA 4UREA 2LE0A 3LXUX 3FFWA 5LC1A 4EKNB 1NQTA 1F8FA 3ODGA 4DC9A 3UXHA 3QWFA 1Z5ZA 1SCUA 2JGEA 2ZSJA 4EJFA 2ERCA 1E4EA 1QLJA 4M9SA 4G5HA 3V7WA 3QUCA 5E4YA 5F7JA 4B32A 3VR2A 3K09C 2WWFA 5LIPA 2YMLA 4M53A 4ZP1A 1V5IA 2IU6A 4M4SA 5BV8A 1SU4A 4A15A 1LFAA 1NX6A 2ZJYA 3LUBA 2P91A 4ZTBA 5EOVA 1GCOA 1T3SA 1M73E 4JIMA 3U31A 1P74A 3I5AA 1HTTA 3WGZA 2A1IA 1Z47A 1DQNA 1FQWA 2H2GA 2IDMA 3B9QA 3D0OA 3KB6A 4P82A 4EA6A 2WJWA 3NORA 2UZIR 1AKTA 2I6SA 3GAZA 1BWRA 3KYBA 3W3AH 1NM5C 5SYMA 1GQOA 3BWVA 1CR6A 2VR1A 2Z3ZA 3QUAA 4R8MA 2XLCA 1NMXA 1U6KA 1WL8A 3QNWA 2D6FA 2BFBA 4BKUA 4OHZA 1SWVA 4X92A 4EKGA 1S02A 2GEKA 5B4VA 1T2VA 4ZXPA 3RODA 1C50A 3ICVA 3DBRA 3G6KA 5FA8A 2RMKA 4EQ6A 4FKBA 3WGTA 1VE9A 2AB0A 5ALJA 1SKAA 2J3JA 3I8XA 4DLLA 2FR1A 4O6VA 4C5CA 5BWCA 1RFGE 1NKTA 4EPTA 5CA1B 1QHXA 5HE8A 1W5TA 1A9QA 5LZ2A 1BS9A 5IAGA 1FRZA 1NGSA 1R00A 4GKBA 4HGQA 3V8PA 3HCFA 1N5OX 2QWXA 2R1TA 2BM9A 3B3AA 5FLYA 1D5CA 3MG9A 1UZMA 1PGQA 1P3Y1 2NZYA 2WSYB 2Z9CA 3AG5A 4LWPA 1EU1A 3V55A 3HRHA 2EXXA 2D2FA 3EGEA 4KXQA 3ZZUA 4HNAB 3AL3A 2PUTA 3HDTA 2WRZA 3PCTA 1MG5A 3GLFB 1CR2A 5AOCA 2PQ2A 3L8FA 3NXSA 1BVYF 1JA1A 4QYIA 5ULLA 1QONA 4E46A 3OY7A 2ANCA 2VJKA 3DMTC 4U2KA 3ECSA 1VJCA 1L6IA 5DNYB 4GVXA 1KEWA 2NO6A 3R20A 4YGXB 2PBFA 4UUNA 5I51A 1DCTA 3D1LA 3RKUA 1WSWA 2GSWA 3HB5X 3IPRA 4CKEA 4F3TA 1W0KD 3PEEA 4XUCA 1EVQA 1Z4KA 5J5AA 3WDLA 3UOWA 3FTPA 3OU7A 1PK9A 1MO2A 1A9PA 1EQUA 1M8FA 3TEMA 2WJAA 4EJ0A 4UCQA 4MULA 3QPAA 3AB8A 4N8DA 4FMBB 4KTVE 5IVDA 5K1ZA 4P08A 4NJMA 3KKKA 1PS0A 5D6OA 3L40A 1F3OA 1AUVA 1TGYA 2Q9AA 2CV0A 1VYVA 5DGIA 1E3LA 3CT4A 2JLBA 2CLOB 1A9RA 2GO1A 3IFSA 1VL0A 4MW4A 2MCFA 5AQ1A 5IRCD 1JEYA 1H4VB 3S2YA 2EX1A 2C3OA 1CD5A 4HXEB 4QU8A 2NV0A 4YWJA 3UGQA 4XIYA 2IXFA 4ARCA 2P1RA 2WA1A 1VSQA 3W9YA 2R6R1 2PK3A 1W59A 5LM3A 1R4MB 3FPSA 1RWMA 2RBKA 1UPUA 1NMYA 2D5IA 4U7PB 1WUJS 1N8TA 5DSXA 5TMEA 1IZ7A 4GLLA 2XH8A 1OLXB 2PMFA 1TUIA 3QPDA 2YW2A 3RAEC 4PRLA 4JI5B 4XX1A 2V0NA 4FXPA 3C16C 1VM6A 3K9BA 4NAVA 1M7BA 4DGSA 2C9MA 1T4GA 1BXZA 1C4WA 4QPPA 4BZWA 5CFZA 2UXDB 4Z1MA 5K8UA 3T38A 4P80A 4W9NA 2J08A 1PG2A 5IEBA 3QBEA 5CCXA 1SHTX 1Z5OA 4GBED 5HHTA 4FTWA 1OX4B 4Y6LA 5B3LA 4AJ9A 4N3BA 3O7WA 3T3MB 1KEEA 3DZKA 2JJMA 1FSPA 1ZCZA 1IPEA 2IXGA 3I61A 4NU0A 1KOGA 3G5UA 1V41E 4JP2A 2H4HA 1OMOA 4FR5A 3V4LA 4KGZA 1VI5A 4JLWA 2GH1A 2Z8YM 2D1YA 2ZZMA 2X7JA 1GL9B 3IVCA 5DLDA 4C2UA 1ESNA 2I66A 4M0KA 3ZCPA 4RK0A 1I1QB 4J0HA 4ZDWA 1BTOA 4U8GA 2IDKA 4LISA 3FPLA 3SBDA 3ZVLA 5DTEA 3NWBA 4D80A 2VZ9A 3U9TA 1BMTA 2J07A 3K6JA 3MJEA 2AN3A 4TV9A 4C06A 2D00A 5NULA 4ND6A 3W1WA 4EY4A 3A1VA 3H9EO 3M8KA 5HMMA 3B85A 5I7AA 2PJRA 1GAXA 3ER6A 3QNUA 4EB8A 4F8EA 5H5JA 4BRUA 1DLJA 5KKAA 1KARA 4OUDA 3DHYA 5I7HA 3OQIA 1S96A 1N3YA 5F64A 5HFAA 4QECA 3Q40A 1YCFA 2JCXA 4CCWA 1YS1X 4IL5A 3ELUA 3I6YA 4YJGB 4WPGA 4R2JA 4WZZA 2UYCA 1H2HA 3D3QA 3MGAA 2J5QA 4NCAA 4WXHA 4ZA2A 4LJ4A 3VVBA 3ZE9A 4OGGA 4EW2A 1KEVA 3LX5A 4LHXA 2AJ8A 3W2EA 2YMQA 1ZGHA 3HZRA 3C8ZA 1QQ5A 4IKPA 5FEMA 4WA8A 4XE5A 3L7DA 3QF4A 3HR7A 4F6RB 2W58A 1XHFA 4TLMB 5BVHA 3UN1A 3L01A 4L9AA 2SCUB 2WTBA 3R3WA 3EUAA 4OB7A 4CL8A 4K0RA 3ECAA 4ZCTA 3R5TA 2FY8A 4GPAA 4ZT6A 4CV1A 2FDXA 3CKLA 3DNPA 3GRZA 4BGUA 3DCYA 3R6GA 1N5DA 2XCLA 4MJ7A 3HA7A 3LY7A 2FRVA 1XK7A 1QHSA 2QN7A 1ZU5A 3HVUA 3IVXA 4IX1A 4JC4A 3DZCA 4OSOA 3TRFA 3QWIA 3L6OO 1ESEA 1NI4A 4MWTA 1Y1LA 2JLCA 4QQKA 5EQTA 1P1BA 3G0HA 2ZRJA 1I33A 5HK9A 3VR4A 2EGHA 3ZCTA 5HZGA 5HOEA 1LDBA 3ENKA 2H9AA 3U16A 1QLHA 3EGWA 3QUBA 3HEMA 5JHGB 1ZIOA 1HRKA 1QHFA 2YIVX 3OOYA 3VC2A 2XB2A 2XR1A 1T36B 2F8MA 2OLEA 1YS7A 2PZMA 4M2LA 3TNFA 3Q98A 4OH7A 3HXOA 4B40A 2UXBB 2IUUA 1F17A 3DT6A 4BNVA 2OKGA 1FFHA 2I8CA 3I2YX 4BMVA 1E2KA 4P53A 4QDXA 3PPIA 1FDUA 3TLGA 4OYRA 4OM7A 3FPBA 4FLFA 2EYUA 2VDKB 1GR0A 1R0BA 10MHA 4H3HB 3STUA 3WYDA 1HRDA 1E2JA 1D3AA 3A8TA 1UBFA 3D7SA 3P2KA 4UJ5A 2ZDGA 1RM0A 1Y3BE 5A3QA 4K2HA 3AVPA 2O59A 1ZSYA 4G9EA 3H0EA 3I9FA 5KQPA 4BQFA 2G5CA 4TMVA 3QE2A 2PXHA 1JSZA 5LUBA 4B6RA 2PGNA 4F45A 4RHFA 5C3UA 3P9QA 3LVQE 2GB4A 1SHKA 1Z2PX 3M6MD 4ID9A 3K70C 4DNQA 2AMVA 5E0KB 2XQIA 2BSAA 5LLDA 2MWMA 3VVLA 2H08A 3WMRA 2G8LA 3OSUA 5GY7A 5JW6A 2F00A 3TUJC 4D1YA 4GOOD 3ITDA 3E53A 1IXKA 2BRUA 1E3MA 3EH2A 4Q6WA 2JS7A 2VPTA 4Y1FA 3WY9A 4YJ2B 4DV0B 5NLLA 1NY5A 2I22A 1NVKA 5TV2A 5CHEA 1OPRA 2F62A 3TG2A 3S40A 2IUFA 4N18A 3A1WA 4YRKA 1GNTA 4HNSA 4CLEA 1NV9A 5B7PA 3A14A 2OBFA 3DKKA 3NTRA 3OEHD 3DTTA 2J67A 1SNYA 2HU5A 1YHNA 2PZJA 2WSLA 4TWAA 2BFMA 2X22A 3AP3A 3IAXA 2NQ8A 1U7PA 2E55A 3KLNA 2WHXA 4WKNA 1U5AA 4B3JA 1KPIA 5IJ9B 4Q9KA 3ZJVA 4B71A 3VR0A 8LDHA 1J21A 3G0DA 2F4NA 6LDHA 1T91A 1JIQA 3FPFA 5IUNC 1NZDA 5JPCA 2YZ7A 2QI9C 3E9CA 4GICA 1K68A 2HGSA 5L51A 2ZUUA 3RG8A 5KTSA 5CA0F 2PBLA 1SG0A 1BCSA 2C03A 3KVNA 2X5NA 4GLBA 4W1SA 5EI5A 4A03A 1YRLA 1YUMA 3NAZA 5DM4A 3TQIA 4WCDA 3OCCA 5BO5A 1GGJA 1OX6A 2KSQA 1OSNA 2Q1YA 4F1WA 4DM3A 3MMXA 4FSDA 3RJTA 3ZLBA 2IP4A 4KRFA 1A96A 4IJUA 4K6FA 1E8DA 2HX1A 4OHYA 3P2EA 1QGAA 2VBCA 2EX4A 3BRWA 4OHPA 1KAOA 2OM6A 1Z2AA 4M0MA 1WSAA 2AWNA 1DMSA 1OZAA 2I3DA 4GZ3A 2IYAA 4I3FA 5FBWB 3CLRD 4ID3A 2P40A 1ND5A 1UWCA 4HX9A 2W71A 3CY6A 2ZTVA 4RZ2A 1O2DA 5FNVF 3D6UA 3M9XA 3WK4A 1HO3A 3QX8A 1US8A 3RDPA 5DN9A 2GCOA 2QU7A 1IXYA 3NMUF 4DZTA 3WJ1A 3MELA 4WLOA 2F17A 1FNNA 2Z6VA 4X24A 4BN4A 1VB3A 3ZW9A 3M2PA 3KBBA 1OYOA 4LDQA 2CN1A 1IH8A 5AM4A 3WKBA 3KT3A 2FDRA 3LQKA 4KI0A 4RA6B 4GX0A 4FYVA 2AX3A 4XIFA 1IXSB 3SYKA 4ERXA 3ZVKA 2B4KA 4ZOLF 4EM6A 4H4CA 2ZRHA 3Q8LA 5JTTA 3R3JA 1WR8A 2Z8YA 5E38A 1YVDA 621PA 4RD1A 1P8JA 1FS5A 5BYBA 4ARAA 1WCWA 1VYHA 1B73A 1ZPDA 2IC5A 4CBVA 1WE2A 4ERNA 4XYBA 5JQWA 3OX3A 3AOGA 1PF7E 1CUWA 3U7IA 3ESZA 5J5VA 5AHWA 4G0PA 1ZSVA 3M3DA 1JDNA 3HA3A 3MRTA 1U0JA 2KWIA 3AF3A 3CXRA 2Q3LA 4NFYA 3GYGA 4EVIA 3F67A 3CB4A 1I0ZA 1SVMA 2GJ8A 4Y2XA 2DG2A 1M2OA 4KGVA 2WFLA 5IVHA 1R0LA 1FC0A 1QNLA 1PR6A 3LPDA 1UK9A 5IX8A 2BKLA 3KKMA 1SUBA 1U5BA 5AQEA 2E4YA 5TGZA 4JCCA 3B36A 3HPQA 2HHAA 4A26A 1J97A 2HSEA 3RS2A 2NXEA 1AXGA 3LK7A 3AUAA 5BQ5A 5DWVA 8ABPA 3UENA 3AVQA 1SVKA 3AX6A 1RVDA 3AB3A 5DN6D 2O0LA 5JD4A 2G40A 2PL5A 4Z0NA 3F7OA 2VZ8A 5DBGA 1FBNA 2DAPA 3UB4A 3M4XA 4DV3B 2RH9B 4I50B 3WQSB 1ZITA 3BWCA 5LVAA 4JVMA 4ZVSA 4XARA 4C0BA 3GFBA 2Q6TA 4X66B 2ZWOA 1Y8AA 1WULS 3KQLA 2XCRB 2CNKA 4M1OA 3TZKA 1VL6A 2VF4X 4GUDA 4LCJA 2AE1A 4R05A 4RKRA 4WASA 1XA0A 4LBWA 3ZI7A 4YMIA 4LHVA 1E7MA 3MWDB 4DIBA 3JWGA 1UK7A 4ZYWA 4DR1B 3ESRA 5DCYA 2C2MA 2K87A 3AEXA 3H8VA 1MDBA 3VQTA 4ZHQA 5A4KA 3FVWA 5AXBA 1X0VA 3HXLA 3OX1A 2PUAA 1N7GA 2ZWAA 4RMHA 1FDWA 2X15A 4RE5A 2HYIC 2P6NA 4TKVA 1IB0A 1PV2A 4YCBA 1AZSC 3T3GA 4D4IA 2QB5A 1ZM9A 4ZKDA 1MQSA 3NKFA 2FPIB 4PZLA 1RPJA 2GCPA 3AP1A 3PNQA 3DPIA 1MW8X 4HDAA 2N1BA 1Q2UA 1YMUA 5COAA 1VLLA 5A3JA 5D6NA 4XGKA 2E5LB 1BDJA 1PHRA 2NUTB 4P98A 1CW2B 4JDUA 2VDVE 5LP1A 2Q07A 1E0SA 2VLBA 5F52A 5FUQA 1ODCA 5A5DA 4XTCS 2GF2A 3NHFA 2I78A 4C89A 4PGGA 3DVLA 2V98A 1MJFA 2RHTA 4KLAA 3D4LA 1RJ9B 4Q9IA 4XGIA 3ZJUA 4KI7A 1DQZA 2XNKA 3VHRA 4BNFA 1L4MA 5KTYA 2QNRA 3NYQA 3P19A 2C88A 1CJSA 4YJ3F 2OGZA 1UDBA 1WZUA 5D85A 1I2AA 1OU4A 2FPGB 4HH3C 3SYTA 3TSCA 4TL8A 1P4GA 2O1SA 4TVBA 1X7ZA 1EWTA 1QC5B 2IFTA 5JC8A 1QV6A 2OCBA 4OAQA 4MUAA 5DIZA 5E6SB 2Y66A 4D25A 2C7VA 4P8RA 1J49A 1B8UA 3IJPA 1EXDA 4BNIA 4Q19A 1XVTA 4FJ2A 3DQQA 4KGDA 2YY5A 5DGCA 4HUJA 3ZK7A 5LFAA 2MINB 2HLDD 4MQBA 5IDQA 1OAKA 5JVDF 5JALA 1S2DA 1N6LA 3PRHA 3I6ZA 1D8AA 4ARIA 3SJUA 1RWKA 3LSTA 5EERA 3WLNA 2CD7A 2I3GA 3EZ9A 4MAMA 6CHYA 4Q4AB 5I9TA 2VJMB 4MKRA 4A8PA 3SC3A 1DADA 2WD8A 3SSMA 3QEMB 1II0A 1XVIA 5DSZA 3V4VB 1CUVA 2WNHA 1WMEA 4MGKR 2CFCA 4IZHA 4N54A 3BGIA 4TXHA 5ESXA 4YRZA 2VP9A 1L4EA 4HDNB 2G7ZA 2OCIA 3HKDA 1HMPA 3K1YA 1PUXA 1Y1RA 3K53A 3D81A 4C4OA 2QVXX 2ZIGA 3DFFA 3U7QA 1FFXB 1K8XB 2DULA 3IAM1 3KAKA 1EK5A 4L6AA 4RKFA 4UHKA 3RGWS 1DJMA 1CQJB 2JJ1D 1N1DA 2A0KA 2H5EA 3SICE 1XJ0A 1XMXA 4DMMA 3S81A 3BB1A 4W1QA 1UQUA 4BO3A 3LYUA 3P4YA 1R6UA 1ZVJA 4FVTA 4HPJB 1ZX1A 2NZVG 4RY9A 4Q9JA 5DBIA 5FA5A 1NVVR 4YPOA 3A06A 2JVIA 3HYLA 4JLUA 2FZ5A 2RK4A 2YZ2A 4ISCA 4JJFA 4RENA 4U00A 5D3KA 3LH5A 5TPWB 3LTNC 1VG0B 2IF0A 1YV9A 2FMTA 3H4VA 4KXNA 4XCQA 4EMTA 1XCMA 9GPBA 2C2BA 5BWOA 1HETA 4XSGA 2MSKA 3LCUA 2PQ0A 4B3IA 4FKZA 3G7SA 4HD8A 3A1UA 3S2GA 2B36A 1JLKA 1Q84A 1U99A 4CM7A 3AQIA 4WKCA 3GIWA 3NFYA 1WJGA 3PBKA 4OB8A 3ZXXA 5B7NA 1ZUNB 3BHMA 3UHPA 2XE4A 4R2KA 4EVQA 1X8KA 3PDCA 1PEKE 3CUUA 3F74A 1LJUA 3VAAA 1T9GS 2CLCX 5JO0A 1N5MA 3PTZA 2FN4A 4UVIA 2BMEA 2D0DA 2WIAA 1Q20A 1XQ9A 2WUEA 1XQWA 3CS3A 3PFGA 4IILA 4JMPA 5KNDH 2X14A 1S2OA 3R5KA 2L19A 4G1FA 4QD3A 4R1TA 4YI3A 3A6KA 5CDHA 4BV2A 1CUEA 2FN9A 2WU3A 1H8EA 3QFCA 1YJAA 3DDUA 4NAUA 4OJYA 4V1CA 5KNCD 4NE7A 5AUNB 3P2IA 3FSJX 5HZKA 4GPZA 1E3WB 3HU5A 3HLTA 3REQA 1V4BA 4XCXA 1UBLS 2I1QA 4F2PA 4LFBB 1EWYA 3GFRA 1UMCA 3F8TA 1V11A 1GAJA 1MB4A 2W48A 3OQ6A 2R751 4TTAA 3IVGA 1WXFA 3SN6A 3VR5D 2VHJA 3HUEA 4HQRA 4E14A 4F9EA 1Q0TA 2WD7B 3MGKA 5LQUA 5IP5A 1E7QA 2B99A 3ROQA 1H4QA 1RDFA 4Y6RA 2OCKA 5JAPA 1KFBB 1H23A 2IUTA 2ONYA 4MB0A 1Y63A 4RVDA 1WS6A 4UAJA 4WEOA 3R3ZA 4XGNA 2IZ0A 2CD9A 4UBKA 1E0JA 1W4BA 1VMKA 1CZRA 1IN5A 2PRZA 3G82C 3D6JA 3QVKA 2Q6LA 4G26A 4KWIA 4DR7B 3W5SA 4HZUB 3TK1A 1QP8A 4I55A 1WBBA 2QLTA 1NULA 1NJFA 1XWWA 3T3IA 1JKFA 3B6EA 1UJMA 1KYWA 1OFVA 4Z1OA 4YBZA 2IV2X 3WHKA 3H1FA 4NU6A 2Q5HA 4QULA 4G1CA 3THWB 2GRUA 4O0MA 5HKKA 1T5DX 1ZJJA 4AXXA 1YOVA 4L50A 5TEVA 1ZNXA 2Y0EA 1ULHA 1ZGCA 1KH3A 4NMMA 2NOAA 4GOXA 3OQBA 3GP8A 5THXA 2XWBF 1VJRA 4QU5A 2C8LA 3AB7A 5DCUA 1HTWA 2QGNA 3DT9A 3I5MA 4KRYA 1TIPA 4YFVA 1DTEA 2H5IA 3B1KA 2O8DB 3DZIA 2W2PA 4IKOA 3N1UA 3OTOB 3QKWA 2JVKA 3DC7A 3ZNNA 1KI1A 5JFOA 3HUFA 3I52A 5K8CA 4OQNA 4HXGA 4KQWA 3RYFA 1GA1A 4IM7A 4NBSA 1DUVG 1ZEMA 4E5NA 2B5OA 4NC9A 3JARB 1XZFA 2AFHE 3TIVA 2P9TA 4Q39A 1QIKA 2ACEA 4IWNA 4RJIA 5CMLA 2B3TA 1QH1B 2QUAA 4HDKB 4MPPA 5G1OA 1UFQA 4DPLA 4F7DA 1Q3KA 2QKYA 4INPA 2DB3A 1L9KA 2QRHA 3C0KA 1JILA 1YBAA 3BB3A 4Y9RA 4MUFA 4W7SA 3GEIA 4Y98A 3AUUA 4B82A 3DE3X 3WKAA 2HM7A 3RYTC 4ZCMA 2R44A 4YPVA 1MOZA 1FFCA 1XZGA 3CCBA 4M0LA 4ZVOA 1U28C 3V3TA 1J2UA 1ABEA 2I4OA 5CLJA 2F3QA 3DTVB 3DLTA 8MHTA 1MIOA 4C04A 4ZYYA 1RU3A 3D5QA 4B84A 2IZ6A 5ABPA 1Q1QA 3HVKA 5K3SA 4LXIA 2BP7A 2VDUE 1FFWA 1VXOA 1XZBA 5AKIA 3O2JA 5GVRA 1UANA 2BGJA 2XI4A 2WJHA 4IFBA 4RV9A 4TSFA 3UIEA 4PNPA 3AJ9A 5HIKA 5E7IA 2P78A 4R01A 2R60A 1Z9BA 3OE7A 3PI7A 1I7QB 4KN5A 2IYEA 1WDMA 1IFXA 5LQCA 3CEHA 1G3RA 1U9IA 2IX3A 4BQIA 4B85A 3UY4A 4UOQA 4PGHA 4X8HA 1CPYA 2QQFA 3D7KA 1E6KA 2GCIA 1L0BA 1Q1AA 3VZDA 4N6OA 4B43A 4JXXA 2Q50A 5KYYA 1KP9A 1NN1A 2JZNA 2RGNA 1KR2A 2RSLA 3GPCA 1VRCA 3PE3A 4P4NA 2OHXA 4Y2JA 3BZUA 4D9GA 3B9BA 2IPXA 2C7QA 2WAAA 1SIOA 1ZOLA 4QBFA 4XWTA 3D8UA 5B55A 3KJNA 2Y6UA 1XALA 3A6HA 1N5KA 3DFIA 5AI5A 4ZFNA 4DCTA 2PAFA 1KAHA 3G2NA 1OC4A 2QX7A 3G23A 4PZAA 1QG6A 5HFNA 3GLRA 1FLDA 1A76A 4KPUB 4N4AA 1BU8A 2D1TA 3WB0A 4CV3A 3M4ZA 1H0HA 2EF1A 3H86A 3T5PA 1KGDA 5HNKA 2P67A 1RPNA 1ADJA 5FEUA 2ID7A 5H59A 2C3MA 2BWJA 2FPUA 4HVLA 3B8HA 3PF9A 1TLLA 4RPKA 4XX0B 1PDOA 4UEQA 3H5AA 1VJ5A 3D0KA 3X1XA 1EGAA 1W85B 3A9UA 2VP4A 1SBZA 4NX2A 2IZ1A 2W37A 4IIDA 4GX5A 5AVSA 1F06A 2CYCA 4HAVA 1XTTA 3C7DB 5EIXA 4M21A 3AR5A 3JW8A 4AP6A 1I2MA 2VTKA 3LK6A 4CGYA 4HRYA 1I6KA 2HRCA 3FMGA 3HB9A 2VTEA 4HLUA 3WS7A 5LU9A 2PRSA 1WRBA 3TKYA 2ZJ7A 3FBTA 4DLTA 4S2UA 5BQXA 4KVFA 1O96A 5C8XA 2P62A 3BSFA 4XM1A 2P6PA 1OXVA 4MJ3A 2X3YA 3GGOA 3QI7A 4KDRA 3HO8A 3UMFA 1G2QA 1HZJA 1G8SA 1RWNA 3DEIA 4RJ2A 3S1LA 3UK6A 3IDZA 4ZO4A 3DV0A 2XGMA 4P86A 5DI9A 1N3BA 5KAMA 1ZNYA 1T1RA 2L0XA 4KHZA 3H5RA 1ZR4A 4QOGA 4N76A 1VP3A 1X7YA 3GLIB 3PJFA 4KH0A 3LBHA 1ZEJA 3AUJB 1V5EA 4CIDA 3NG1A 4B8WA 2JBHA 4IDFA 1Y98A 1CRLA 4CT5A 5AK3A 1NBOA 4RSRA 1W2HA 1MX3A 1U94A 3CURA 3PEUA 5AOBA 2RHLA 3KKOA 4D6PA 2XHEA 2JH3A 3J7TA 4DHEA 4P2BA 4DUGA 4EI9A 1EFVA