2AG1A

Crystal structure of benzaldehyde lyase (bal)- semet
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
553
structure length
553
Chain Sequence
MITGGELVVRTLIKAGVEHLFGLHGAHIDTIFQACLDHDVPIIDTRHEAAAGHAAEGYARAGAKLGVALVTAGGGFTNAVTPIANAWLDRTPVLFLTGSGALRDDETNTLQAGIDQVAMAAPITKWAHRVMATEHIPRLVMQAIRAALSAPRGPVLLDLPWDILMNQIDEDSVIIPDLVLSAHGARPDPADLDQALALLRKAERPVIVLGSEASRTARKTALSAFVAATGVPVFADYEGLSMLSGLPDAMRGGLVQNLYSFAKADAAPDLVLMLGARFGLNTGHGSGQLIPHSAQVIQVDPDACELGRLQGIALGIVADVGGTIEALAQATAQDAAWPDRGDWCAKVTDLAQERYASIAAKSSSEHALHPFHASQVIAKHVDAGVTVVADGALTYLWLSEVMSRVKPGGFLCHGYLGSMGVGFGTALGAQVADLEAGRRTILVTGDGSVGYSIGEFDTLVRKQLPLIVIIMNNQSWGATLHFQQLAVGPNRVTGTRLENGSYHGVAAAFGADGYHVDSVESFSAALAQALAHNRPACINVAVALDPIPPEELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords benzaldehyde lyase
publication title Structure and mechanism of the ThDP-dependent benzaldehyde lyase from Pseudomonas fluorescens
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 175
structure length 553
sequence length 553
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.38: Benzoin aldolase.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ag1A03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ag1A01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2ag1A02
3DVAA 1V5FA 4BVHA 1PO7A 3EXIA 3D81A 2BFDB 3UPTA 1OLUB 3LPLA 2BRUC 2EZTA 1PT9A 2WVHA 3FZNA 2PANA 5K3SA 2FWNA 1M2NA 1OLSA 5C4IA 1N0HA 4V1CI 2UZ1A 4K9OA 5EJMA 1PTJC 1POWA 1D4OA 1UPCA 5ESDA 1UMDB 4JT9A 4KXXA 5EJ6A 2QQFA 2DJIA 3L84A 2VJYA 1UMBA 1W88A 3F6BX 3FSJX 2A1UA 2BEWB 2Q5LA 2J9FB 1IK6A 4UTNA 1UMCA 2BFFA 1V1RB 4JUAA 2R8PA 3RIYA 2WVGA 1PNQA 1DJLA 5AHKA 5K2OA 4RMIA 2NYRA 5I51A 3LQ2A 3UK1A 3DVAB 4K9MA 1YTLA 2PGNA 2XT9A 3PKIA 4G1CA 1YHYA 3EXIB 1Q14A 2OD2A 1X7XA 2JGDA 4FVTA 1X7YA 2C3MA 4D5EA 3GLUA 2BP7A 1O96B 3U3DA 5HJEA 1NGSA 5IMSA 3EXHC 1M2GA 1OLSB 1B0PA 2C3YA 5I4IA 4GP9A 5D7NA 4IG9A 2UZ1B 4UU7A 1NM5C 5EJ4A 2JLAA 4KXWA 1U5BA 3AHJA 5HHTA 1UMBB 1W88B 3CLSD 2Q28A 3HWX1 4JUBA 5BWNA 3EXG2 1ITZA 1UMCB 2BFFB 2O1XA 1ICIA 4K9LA 1SZDA 4BV2A 3U31A 2FSVC 3GLRA 1UPAA 1JSCA 2C42A 1OZHA 2JI7A 5EJ8A 1Q1AA 4BV3A 3KOMA 2BEUA 2JI6A 3EXEA 1EFPA 3M49A 5ERYA 3AI7A 2OD9A 1HZZC 2IHTA 4K9QA 1U28C 4JUFA 2H4FA 2C31A 3ZHUA 4Q9DA 2BEVA 3DUFA 2C3UA 1M2HA 4J16C 1X7XB 4BN5A 1X7YB 2QTCA 3OE1A 2BP7B 2AG1A 4BVBA 1PVDA 1QS0A 2AG0A 4GM1A 4RJIA 4HDAA 1MCZA 2QQGA 1U2DC 1T9CA 1YI0A 4UTXA 2H2DA 3LQ4A 2BFBA 2OZLA 4X3PA 2IHUA 4WBXC 2Y0PA 1XLTC 5BWLA 1U5BB 4I5IA 1S5PA 4GG1A 2A1TR 2UZAA 2HJHA 1W85A 4ZP1A 2R5NA 3AHGA 3PDHA 3MOSA 4JSRA 5FEMA 3ZHSA 4FZ3A 4UTZA 3HWWA 2BFCA 2G67A 3E9YA 4V1CA 1T9BA 5DGDA 5EJ5A 1YI1A 4O8ZA 2OO5C 2BEUB 2H2GA 3EXEB 2Q5QA 1M2KA 1YNOA 1YHZA 1GPUA 1X7ZA 2EZUA 1M2JA 3HYLA 2B4YA 1X80A 3IAEA 1PI3A 3F6EX 1RP7A 2BEVB 3DUFB 1V11A 4BUZA 2E6KA 4MZXA 4L3OA 3AHEA 4C7BA 1U31A 5EXDA 1QS0B 3AHCA 4MPPA 3CLTD 2H59A 1O97D 1SZCA 2YICA 3D4BA 3IAFA 1YC5A 2BFBB 1V5GA 1AY0A 2OZLB 3D7KA 5EJAA 1YBHA 3JR3A 4J1TC 5EXEA 3EXG1 4JU8A 2Q5JA 4K9PA 1DTWA 4K9KA 4TWJA 3ZGOA 1W85B 2XT6A 5I5GA 2H2IA 3ZHQA 4F4UA 3RIMA 4F56A 2Q29A 5MGNA 4BVGA 1Q6ZA 4JUCA 4D5GA 2BFCB 4XEUA 3EXHA 4MPRA 4V1CB 1J8FA 3CF4G 4JD5A 4RJKA 4C7XA 3EYAA 1X7WA 5EJ9A 5HYVA 2H2HA 4UUBA 4RMJA 3CLUD 4KXYA 1X80B 4Y6LA 4RMGA 2VBFA 1V1MA 1V11B 2EZ8A 1U2GC 2G28A 3ZHVA 3PKJA 2OD7A 1UM9A 4HD8A 5FYQA 1S7GA 1PYDA 4KXQA 1ZPDA 5DGTA 2QTAA 2JGDB 2IHVA 2NXWA 4Y6OA 4IF6A 2JI9A 1DTWB 4GPEA 2WVAA 3M7IA 3EXFA 2PGOA 4MPJA 5K6RA 2VBIA 4KPUA 3GLSA 2C3PA 4UUAA 4BVFA 2IEAA 2JI8A 2PDAA 5HGXA 3EXHB 3CLRD 4UU8A 5ERXA 2OORC 3AHDA 4KXVA 1OLXA 2H2FA 2BFEA 1X7WB 3DV0A 4TWIA 1L8AA 5BWOA 4FEGA 3AHIA 3AHFA 2FR8C 2VK8A 1POXA 4QELA 3EA4A 1V1MB 3ZHRA 1Q17A 3ZG6A 3M34A 2YIDA 4JUDX 1UM9B 4MQ5A 3OOYA 2FN3A 5EJ7A 3ZGVA 4UTVA 1Y9DA 4K9NA 3EXFB 5MFPA 1OZGA 4L2IA 1T9DA 3ZHTA 2FRDC 1QPBA 3GLTA 2W93A 4X3OA 5MFZA 1YC2A 4KGDA 1WCIA 3LQ1A 5I5EA 2EZ9A 2VK1A 1NI4A 4RMHA 2JLCA 1KEKA 1TKAA 3AHHA 1OLXB 2VK4A 2BFEB 4UTRA 4GM4A 3DV0B 3RIGA 1TKCA 4IAOA 1V5EA 1V16A 4QQ8A 3FLMA 2G25A 3EY9A 4QPZA 2H4JA 2JIBA 1X7ZB 1R9JA 1QGDA 1PNOA 2BFDA 1OZFA 1OLUA 4BN4A 4KXUA 4RJJA 1E3TA 4C78A 2XTAA 4R8MA 4BVEA 2Q5OA 5K6TA 4Y6QA 1Z8NA 1MA3A 3M6LA 4C7VA 4ZZIA 1OVMA 1UMDA 2V3WA 2O1SA 4JU9A 3K35A 1WCIB 1T9AA 1UPBA 4JT8A 1TRKA 2EZ4A 2BEWA 1NI4B 2J9FA 2C3OA 1V1RA 1YD7A 3JWPA 2X7JA 2R8OA 2H4HA 2Q27A 1TKBA 1V16B 5MF6A 1BFDA 4FEEA 4GM0A 4COKA 2VBGA 1EFVA 5DEIA
chains in the Genus database with same CATH superfamily
3DC2A 4YJHA 1BX0A 1BRTA 1KYYA 1OI3A 1JMKC 2G06A 2JDIA 3F96A 3O82A 1PV2A 3U7FB 3A1VA 1KO5A 5L40A 3N5KA 1ZOIA 1U8TA 2GILA 3J7TA 4XGQA 3V1YA 4B9AA 3TQTA 1XHFA 4RIGA 3THWA 2BFDB 4JODA 3UPTA 2WYHA 1CLEA 4AQDA 1SCAA 4L85A 4MUAA 1YR7A 3NTXA 2APJA 2O52A 3DMYA 4FJ2A 2WTXA 4KGXA 2VLBA 4IDPA 4CM6A 2W2KB 1T5TA 4NENA 3WGQA 2C2XA 2HUPA 2P6MA 3BXOA 5FADA 1M2NA 5IDQA 1J9EA 1Y81A 2GHQA 2X3FA 3I9V6 4N3NA 2FR8A 2QZPA 5ALGA 1KS2A 2ZB3A 4LVCA 3U7EB 4V1CI 4D98A 1H2AS 1GPWB 2UZ1A 5EP2A 4B09A 2XYGA 3ECAA 3MEQA 3GNTA 4PZPA 5TQ2A 1SELA 3AKDA 4OJKA 2DTEA 3JYOA 4XUCA 1NIPA 1Y80A 5E8JA 4E7PA 2FB9A 3M4ZA 2YRXA 3OF2A 3V1KA 3CKLA 4GKJB 4Q3BA 3L6CA 3I45A 4OMDA 1CYEA 1W0JD 2I6SA 2PSFA 4HAZA 4LDJA 4YS6A 3F74A 3RABA 2FMTA 3KJIA 5DWDA 3QVMA 1E61A 1FP2A 4HTFA 2DPXA 2QLTA 5EEHA 2LR0A 2NO0A 4UTNA 1XK6A 3H9CA 5C1OA 3QG5A 4RTNA 4YRBA 4R1QA 3H16A 4B35A 2O0MA 5MDHA 3IILA 2ZWVA 3MRSA 4RTOA 1THMA 2O8FB 3U4IA 1CZKA 1DBSA 3JYHA 3OIUA 5FOVA 4EG6A 1CNFA 2CHEA 5BSMA 2HB6A 1H1LA 1JU3A 3ZLVA 5A03A 2ZRBA 4AJJA 4R5HA 4AG3A 3IAS6 2FP4B 4HWRA 1HDEA 3E6AA 4C4RA 5KZMB 1NBOA 4G09A 5T6MA 5LQUA 2XJ4A 2FMUA 1MLDA 4OGWA 3SYRA 1SG0A 2FLVA 2PMKA 2JG3A 1QFYA 2I6FA 3WRVA 1Z0ZA 3EW9A 1U9ZA 3UJPA 4TUYB 3BZBA 4M87A 2OD2A 2UU9B 1W52X 5FIUA 5BNWA 4MKHA 2GEDA 5HPYB 3LQQA 4RD4A 1PT5A 5BMVA 2C7GA 3ESRA 3GCWA 1NYTA 4Z8XA 1NGSA 2OBFA 3FYCA 2FUG1 2RIPA 2WHQA 3WL3A 3ZXXA 5G41A 3T5BA 4L22A 4LGYA 1P4GA 2YFKA 2X2FA 4IZOA 4AJLA 4AN0A 1TU3A 4JVNA 3IJ5A 2WKQA 4XPIB 3Q2IA 3ANNA 4O02B 1EK2A 3GAFA 2BD0A 3QLUA 3VGJA 3WISA 4RIEA 4BEJA 3QSYA 4PCVA 4KKXB 2HHJA 1J0EA 4LY6A 1QHXA 3B3AA 1UDRA 4RV5A 1P81A 4I36A 4BRWA 2B3DA 1ELOA 2R6DA 3L4BA 3T3EA 1FS6A 2XGOA 3DO8A 2QR5A 3GDHA 2DZDA 2V0CA 4UXIA 3DF7A 2AJ8A 3E18A 4XFJA 5DNUA 3QZUA 1GNVA 2Q28A 4TMYA 5A1TA 4ZI3A 2X5NA 4KYVA 5DHQA 4YRJA 1HEUA 1ISPA 1FUIA 1N6PA 3M9LA 3WRYC 4UW9A 1U3CA 5CNIA 1Z7EA 2OGTA 2HNKA 5A4KA 3QFTA 1Q7EA 1QRAA 2WSBA 1EVJA 2F9FA 2HA4A 1JSCA 3E7FA 3GC6A 4JLAA 1KO1A 4CKYA 3ZQ4A 3WMEA 5TX7A 3UFBA 3VH3A 1Y7TA 3EXEA 2ZE5A 5CT8A 1J1IA 1KQOA 3ODPA 4PRZA 3VTKA 2IYAA 2WM9B 4RVFA 3NVKI 3KL2A 3U44A 1PEKE 1P19A 3PQDA 3DDWA 2LCFA 1T2AA 1QBGA 4I55A 2MYPA 4NICA 5ERYA 2HRRA 3CH4B 3ROZA 3RQSA 1DC3A 2P5TB 4K2AA 5FL3A 4BNTA 1J0XO 2ZQ5A 4HDSA 4Q9DA 1AE1A 5BSTA 3OJLA 4X1IA 3K9CA 5HSGA 4S1VA 2G5PA 1C9EA 1PLJA 1OZ0A 2W2MA 3C24A 3LVQE 4PAGA 3AEKA 1HEYA 2H51A 1C7FA 2VEDA 2VPXA 1PVDA 3R09A 1NF2A 2WSLA 4GX1A 4KG7A 4Z9YA 5AW8A 1MO5A 1G2PA 5EY5B 4ZYWA 3LPMA 1KOLA 2VYVA 1YI0A 4OHXA 2MSKA 4LJ6A 1QH8A 5JNVA 3UW1A 1J56A 3DVRX 4J43A 1C4KA 1RC0A 1RLTA 2QRPA 3HKEB 3HY4A 1XV5A 3S29A 2ZR7A 4Z7NB 2FRVA 1DP4A 1GKKA 2HJGA 4YBZA 3NC0C 3ELWA 4KC0A 1N2ZA 3IV6A 4J1SA 1FRFS 1KAGA 3AP3A 3NIGB 2R7MA 3NONA 3NUZA 2HRDA 2HTFA 2ZE8A 2UKDA 4ENPA 1X1SA 3MUFA 4DLRA 4DCUA 5KBYA 3OQIB 1EWYA 3KV1A 1N5IA 4UKDA 2BTQB 2PM8A 3I4FA 4FHFA 3RTAA 4GLOA 2AFIE 1K6MA 4UNPA 4RM3A 4S0XA 4MVYA 3CF2A 3HA5A 5FUYA 3I62A 3GW8A 2ZJ3A 4RU1A 2VHYA 2WAYA 1QGUA 1HT1E 3H3FA 3X1KA 3CC8A 4M1WA 4EO7A 1L5FA 3HH8A 3N8KA 2XA2A 3VVBA 4OAPA 3TQHA 2BV3A 1S3IA 3HA7A 2XUKA 2QTHA 1C9MA 2JK1A 2VN8A 2VHWA 4J0KA 5TARA 3F3SA 1N5KA 1VYUA 2KPOA 2O20A 1MVOA 4ZD6A 4IYJA 4BB9A 1UBFA 5DIZA 3QMWA 3ELBA 5DIFA 4F5EA 3ZOKA 1PW7A 1GSAA 2JIDA 1ZJ6A 4IW3B 3H4MA 3KALA 1GGMA 3LC7O 1RJ9A 2ZYTX 1CUIA 1X80A 4GI2A 4LYJA 4DG8A 3A7EA 4AN1A 4DWOA 2GAIA 2GCOA 4PC2A 2I1WA 4Q0MA 3T5PA 4YJGB 2JGLA 1KDPA 1IATA 2OXCA 3GFVA 1Z45A 2QL7A 2YWDA 2WQ6A 4XZ3A 3T7KA 1HNWB 2RE8A 3GLGB 3ZDDA 1CTQA 4B3TB 3IV7A 3H5TA 3KZNA 2JLVA 2X22A 2CXXA 4I9UA 2VH1A 4XQCA 1A7UA 1H6AA 1U8UA 3R3SA 4WOPA 3OFJA 3C1TA 2VJMB 3G9QA 3SSMA 4ASUA 2GAJA 5KTNA 1C0EA 4GZMA 4FR2A 5TNXA 1SH7A 3K30A 1FU4A 4YUZA 3FOAA 1RYMA 2FW0A 3RV3A 2ZIFA 3IVRA 3MSCA 7ABPA 1PGNA 2L42A 3N8GA 4X8MA 1AA9A 1XRJA 4R2LA 4Q7KA 1TLTA 2DWPA 1NT4A 1A76A 4NBKA 2EWMA 3VKUA 2LTAA 5GY7A 3I9KA 2JFGA 3B60A 1LTQA 3I34X 1TJ4A 2QAIA 4NYMQ 3RG8A 4HH4A 1ZNZA 3H86A 4UNRA 4I46A 5JXJA 3L6EA 4F4UA 1G7SA 1KP9A 4IVPA 1PQPA 1GUYA 1US8B 3JD3A 2MSLA 1TC2A 1E3LA 5B3LA 3A6GA 1ZRNA 4PXAA 5JRJA 1FSGA 5LLDA 1IBLB 3OPYA 4F6LA 3KQSA 4RPCA 3AVUA 4K6CA 1DKQA 3AI1A 3FHLA 1S0UA 3GG2A 1JB9A 3PC8C 1NW7A 2PCLA 2XNKA 2IS1A 3O94A 2IODA 3LT5A 5BUZA 4DA4A 1TF5A 4TVBA 4AJIA 4HF7A 1B8VA 1E58A 2UUAB 2X40A 3A26A 1Z36A 2FRXA 1M7GA 1QHGA 2E4XA 3DZKA 3GRFA 3ZY2A 5A1JA 1AXRA 2FDCA 4EF5A 2A9FA 1YFLA 2J4CA 1UF9A 2P41A 1UKYA 1Z73A 5LMNB 3D54D 2IUYA 1QCDA 4YP5A 1SKBA 3ZHBA 3RCBA 2OCAA 2G5CA 3KC2A 2IEBA 2ODQA 2CE2X 2ODEA 4NBTA 4DMKA 3A4LA 4GU5A 5GAJA 2GNOA 4HCJA 5CLLA 1V1MA 2D7CA 1F8YA 4ARBA 1N77A 1ZSYA 2N75A 5F1YA 3NKVA 4AM8A 3L6BA 4DLLA 1W4CA 2C95A 1M8FA 4PQYA 3FDZA 4ALIA 1AH2A 4YRGA 3I2KA 1Q2XA 4M0PA 3ZWCA 3PDWA 4M2LA 4PYQA 3FNBA 5KC9A 4GHWA 5I9LA 3D0QA 2VRBA 3MAGA 2PE5A 1CVIA 1Q0HA 2WNIA 1FUUA 4KXQA 4EYSA 3DZCA 1BFUA 2JNWA 1CT9A 1KXZA 1XZLA 1PJ4A 2PCJA 4YVFA 3ZQKA 5GWXA 4XQEA 3D0RA 1NWHA 3D4IA 1C8BA 2DLCX 1LVUA 3JQFA 5C5IA 1U28A 4CMEC 1H3EA 2Q3JA 1JHXA 3KELA 4U2DA 3OY2A 1L4UA 4CFZA 2HM7A 3TNFA 4GBED 4Q9KA 3A06A 4GLLA 3ZDCA 4UUAA 4R2JA 2AI1A 2C7OA 2PSSA 3EEYA 3O4FA 5HFJA 4ZT6A 4XTRA 1PF7E 2VP4A 2CCKA 3BRQA 4JX9A 4NESA 3SDZA 4AC9A 1T3GA 4OSOA 3THSA 4KP7A 3DBLB 4CEIB 2R86A 4Y2JA 1J24A 3KYDB 2JFXA 4WINA 3R74A 2ZYIA 2FFHA 2VDVE 1VSTA 1A7KA 3Q6MA 3R4VA 1IJKA 3CWCA 4MJ7A 1CDDA 4RZ2A 4B44A 4GMGA 4P53A 1TEZA 1Y1TA 3Q2KA 4RVOA 4QFMA 3MCZA 4KIWA 3V3TA 4B2LA 4YQFA 1P62B 4PVDA 4BNWA 1U4SA 1RMTA 1QH1A 1WMDA 2IZ5A 4WFJA 3WWPA 3ZN2A 4C43A 2X42A 4YAFA 4E5KA 4FEGA 4EP1A 3W05A 3R76A 3QWBA 1YO6A 1BDJA 4QELA 3TCXB 4H3KB 1ZOOA 5THKA 1V8PA 2H5LA 1P5ZB 1YVUA 4PSCA 1P1RA 1VSVA 1BEZA 3TLGB 3VH4A 2IELA 3WNZA 1R3DA 2CVOA 2VPZA 2YIDA 1LK0A 3NGLA 3D59A 4O4HF 3Q10A 4X1KB 4BCBA 2WIKA 5CLJA 5JUWA 4NU8X 4CKWA 1GARA 2BKAA 2Q5EA 4M8KA 4WKPA 1TZBA 4DGQA 4Y6PA 1MORA 4A2WA 3QXXA 1DO0A 5DBGA 4E1BA 3RRNA 1J7KA 1Z26A 3H2GA 1M72A 4E1AA 3TX2A 3NGXA 2GEJA 2QVZX 1IZ9A 4LC0A 2RHWA 2PH7A 3BEOA 3FYDA 4FT4A 2WKSA 4BUJA 4B3FX 1NXSA 2YFYA 5BVHB 4ARCA 2WNHA 3ZWBA 1KFJB 2O0JA 4QFCA 4CBVA 1W4LA 4I0WB 1U2RA 1W5SA 3R6TA 3KYIB 4MVJH 2P3SA 3LI2A 4KU4A 1ZIYA 3PUZA 2P4UA 4TRJA 5C46F 4JBGA 4QQKA 3SCZA 1ZINA 4QXRA 4MGEA 1CS0A 3FTCA 4Q3NA 2GI4A 5IK2A 1H93A 4LKOA 4QLBA 2GSDA 2XBMA 3QLJA 2B20A 3ITKA 2ZRAA 3WDSA 1DAOA 2BTEA 4BECA 3IULA 3FUWA 1TT5B 5CHEA 1PG5A 5DTQA 1OLXB 2WTMA 3T35A 3LFUA 3TFQA 1SB9A 5L3SA 3BTUA 4BLVA 4FX5A 4GWLA 3ED1A 1T9HA 4JR0A 2O07A 3GYBA 3OOSA 5K7SA 3TX6A 2WU0A 3TEJA 2QMHA 2R0QC 1H2BA 1EK5A 1J1UA 1D5CA 1OXBB 2IYEA 4RKYA 1EM8B 1Z0KA 2G0AA 5C81A 3WGHA 1LBIA 1P77A 1MQ9A 4QPZA 4QYTA 2J1LA 4NK4A 2ZB8A 1VHTA 4BO4A 4GZ3A 1RXEA 2G5GX 2D1TA 2DFLA 1RRKA 5K05A 1QUEA 3AT1A 2AGVA 4XIYA 4EF6A 3UGTA 5KC8A 2XDYA 5DRTA 1E6WA 2GB4A 5JAHA 2VWQA 2X41A 3SQMA 5HGXA 2QD5A 4CDGA 2QIOA 4ZJPA 3N28A 2VYND 1Z8HA 2KMLA 1INLA 1E7MA 3LO5A 4OGKA 4PO1A 5T64A 1E1RA 3LHIA 4B31A 5J58A 3U7GA 1WS6A 1UADA 1Y42X 3N2ZB 4AB1A 5DNYB 5CLIA 2GT1A 4DANA 2AX3A 3C85A 1FTNA 5EQFA 5F77A 3K4QA 4L5BA 1OVMA 3U7QB 2ZTUA 5HM8A 3TF5A 3I6QA 1V26A 3LKZA 2IOFA 2VTDA 2ZB2A 1FXSA 1DRVA 1WEKA 1YZVA 5ULLA 5F73A 4NKRA 4OXXA 1R0KA 3P9RA 3WIEA 5B2ZA 1T3SA 4PC6A 2R6R1 3RAFC 2E4VA 3FIJA 3TLYA 4BFSA 3EVNA 1YQWA 2ZETA 3UPDA 1NI4B 1G5RA 2YV4A 3WV4A 1ZVJA 1IUKA 2C3OA 2HOQA 4D4LA 3KB2A 1A97A 4ZDKA 3VKFA 1D7OA 1ZGZA 5CIQA 4IXTA 3O2JA 1BGVA 3FMVA 1OIWA 4DQ0A 3U4QB 1LC0A 2W0MA 3KUXA 3HABA 4IJUA 1XPUA 3AV0B 3RJMA 1WX1A 5LKRA 3RU7A 1W93A 2J32A 3QVUA 1XWIA 3TRDA 4MMYB 1A0OA 1H42A 3WFIA 1DQNA 1ODSA 2VSQA 1JPUA 4RPJA 1D03A 5KOJB 3WA7A 3I28A 2AH5A 2P9HA 3P32A 4ZODA 3T1OA 4HR7A 4LFBB 1HDYA 2JVJA 1VG9B 5CDTA 3U39A 3IVCA 3LTNC 3NHPA 4BVHA 4LDPA 3HA3A 2Q0XA 3CZAA 3A14A 5CURA 3R4CA 5B4VA 3ZJYA 1ODJA 4Q15A 3ER9A 1KJYA 1NVTA 1WQ1R 2CW5A 2JFVA 1FRVA 2IYYA 4R1UA 5HZMA 1O96A 5D00A 5TEVA 4I1UA 3RS9A 1O8CA 4UCXA 1CQIB 1KEEB 1PDVA 1TK9A 3K0FB 3K53A 2FWNA 5CX1A 4UAGA 3ZVLA 2XAAA 5K6AA 4GRIA 4ZKEA 5C4IA 4PX9A 5ALZA 3I52A 4J6FA 1GZ3A 2RB4A 3IHKA 5FR1A 1JHQA 3DMPA 3IAS1 1QE0A 1RI1A 3IP8A 4DDUA 1RBYA 1CY0A 1UMDB 4QYMA 1YVRA 4V3BA 2EP5A 5BRNA 3UIEA 2W2LA 2H18A 3U6KA 1T6BY 2F1KA 3A36A 3AR2A 1AMNA 3DOEA 1K6EA 1S2GA 2Z5GA 1UBTS 2OUIA 2P6RA 3UAVA 3D5EA 5CH3A 2NSLA 3E61A 5KX5A 4H7PA 4IFBA 5CPFA 5A62A 3ZDFA 4M9CA 4DIDA 5LQRA 3V3KA 4GNRA 1RDFA 1EQUA 1KU6A 2QD2A 2HMYB 2A57A 4S1WA 3B1FA 3VDQA 1KYXA 1UJ6A 2R66A 3WK7A 4EFKA 5A6SA 3F5FA 2YHUA 4HATA 4DMGA 3C15C 4J0QA 3UA4A 1H66A 3RRXA 3ESQA 3BZUA 2WZDA 3K1AA 3ADDA 1DJLA 1GGEA 2XF8A 2FZEA 3EIQA 1Q0PA 2YIVX 3TL2A 4B2IA 3AEUB 4R1LA 2H6EA 5I9SA 2AOTA 2X5OA 3GLIB 3KQLA 2WB2A 3FVQA 3WIDA 1IN8A 3JQQA 2IZ7A 3CX6A 4LQLA 3VPCA 2XUHA 1N2OA 1Q12A 3WYCA 3DKVA 5F9HA 2CXUA 2RGBA 1GDHA 1G8SA 1H2ZA 2FN8A 4YCSA 1W0KA 4FHEA 2E1RA 2EQBA 3WE7A 5EINA 3M2TA 4LXHA 5IWAB 3FYUC 3SVLA 1GNTA 2IXDA 2JHCA 2VIIA 3GEDA 5GZ6A 5HCIA 3LE8A 5IC5A 5FBVB 5HJEA 2FMHA 5HQ3B 5JNUA 5IMSA 4F86A 3JWEA 3ESZA 4HL6A 2C5SA 2H5IA 2YZGA 3DFIA 2VTBA 1MHPA 1X86B 2NZ2A 2YBDA 2PGXA 4LGVA 2OM6A 2ZVQX 2D1SA 3LZ6A 4GKVA 4IG9A 4RABA 4G5HA 4PCAA 5HF6A 8ATCA 1YR3A 1P5RA 4K88A 4MCHA 3TQCA 4EK9A 5EJ4A 1T91A 3GRVA 4JJ6A 4IJWA 4KGVA 5IT5A 1EK6A 1S1MA 3D6NB 1GUAA 4AY5A 2BIFA 3WRXA 2OCLA 4O4JB 3PGXA 4W5JA 1Q7BA 4JZKA 4RADA 5HHTA 3O3MB 3CLSD 3AESB 4RSMA 1Q1NA 2AD1A 2GKSA 3CF0A 4A0QA 3FWHA 3GFQA 4DW8A 2ZT5A 3S3TA 2VUUA 3ZV3A 4NECA 2BI7A 5IKOA 1GUFA 3NIFB 2JH9A 4U02A 4BV2A 3I4CA 4HLCA 1CDEA 3AI3A 2B92A 1Z4PX 4FI3C 4FLEA 2IYOA 5CYPA 4Y0NA 4OFXA 2Z98A 1TGYA 2GFHA 2G8NA 2RHLA 2QLJA 4D9JA 3GP3A 4MR9B 3QG1A 1SOMA 4RLQA 2QXUA 1JKJB 1KXJA 4B6PA 1Z9BA 3EXAA 1NF9A 2KSQA 1ST2A 1GNSA 1LJUA 2PAAA 4CVNA 3EAFA 3OX1A 2OD9A 4QOSA 4GE3A 1EJ2A 1UQTA 2EKPA 4P0TA 5KYGA 3WAJA 4JUFA 1BDHA 1XTJA 2IXGA 1SY7A 3OEYA 3L0YA 4J7CA 1NY5A 1MO4A 2HQBA 5C5CA 3IR5A 1N3YA 3LQKA 1BDMA 1Y63A 2BEVA 4AJPA 1FVXA 4EYKA 1YNSA 2DT5A 1Q95A 3HWRA 1D04A 3KHTA 3K1ZA 1QLWA 1T5IA 2E4AA 4FFMA 2ZZKA 4N54A 4Q82A 1OGJA 5BQXA 4DCNA 1DWPA 1CQZA 4L27A 1JPJA 5TGTA 4EMSA 2JD0A 3IKJA 4BL5A 1IUOA 3ZWYA 1COZA 3C3KA 5IHXA 1U8AA 1JN0A 4EPTA 2BLNA 3AJ8A 1ZWKA 4X3PA 3UO8B 4XGNA 1U0RA 2PQ6A 3J7AC 4ZVTA 1YKGA 4FHDA 4Y7CA 3TLCA 1ZISA 3QI7A 3QYPA 5JMWA 5LQDA 1ZP6A 1JLRA 2HU8A 5A9RA 4FT2A 1P4AA 4EHDA 4YAGA 2VLIA 2R85A 1DOZA 2GZAA 1L3CA 2PK3A 3PDHA 3STXA 5KI6A 1WBDA 3EVGA 6REQA 5LJIA 3L7NA 2VYVD 1IBSA 3P9ZA 1IZ0A 2BRUA 4V02A 5FA5A 4C29A 4CHGA 1B73A 3BL6A 3FM9A 1YZUA 4TYMA 3ZVMA 2B4KA 3Q6IA 3MC1A 4BMCA 3QW4B 4FI3F 4NH0A 3D4PA 2Q45A 3FBWA 3NUGA 1E60A 3O1IC 2HA5A 2QEQA 3QFSA 4FKBA 4V1CA 5JS6A 1P4RA 4M1KA 4RLFA 4HGZA 1RS0A 3R8XA 2JHGA 3P20A 2GFIA 2PS0A 4ENTA 4P5PA 1GSIA 4F2DA 1PTJA 1G5PA 2FFRA 3KQYA 4ZZ2A 3SSAA 4P22A 3U1VA 2HNBA 1K4KA 4GOOD 4D0SA 3JWIA 3HXMA 1IXKA 5E9AA 3BFXA 3AJAA 5EIOA 5TMEA 3VHXA 3ZCQA 1TC1A 3CZ4A 3F2VA 3Q4GA 4J3FA 5L95A 5KSYA 1BW9A 1NP6A 5JW6A 3IE0A 3ZCSA 4X45A 2G1UA 3GT0A 4KIFA 1R0CA 2RC6A 2HIAA 1RPTA 1VB5A 3DUFB 3N39C 3O26A 2OGUA 5F76A 1TJPB 2YRWA 1CRWG 8MHTA 4TQUS 1JLSA 1U7DA 4J0FA 1TA0A 3DMGA 4MICA 5EIHA 4C7OB 1MXHA 1A88A 3SYTA 4YFYA 2IXAA 3D3EA 4HQNA 3TWOA 1BE8A 1VDZA 2I66A 4B6QA 4M8NE 4ER0A 1IY9A 4URWR 4Q7QA 5BUQA 2Z5FA 3AVWA 1W5BA 1JDPA 5H80A 2OHIA 5JH7A 1GTL1 3GEMA 3SHFA 1YC5A 2VOEA 4LHXA 3F6RA 3KZXA 4UBJA 1MJHA 2FR1A 2P9YA 1KI8A 3SF8B 5AOAA 2UAGA 5DT2A 1BD3A 4BVLA 2PSJA 1A2OA 3AY6A 4UXJA 1R0LA 3IUMA 4ZOLA 1W85B 3LCCA 5I5GA 2OESA 3ZDXB 2RARA 4ASUD 4HZUA 5B37A 3G89A 1V71A 1ZXBA 5G02A 1O6FA 4C4AA 2GJ8A 1CD5A 2NV0A 2WI8A 2OILA 1XRNA 4PAMA 5IZCA 1V3VA 2NO6A 2Z8XA 1V5WA 2FPGB 4R2KA 1VIDA 2AIRA 1NVGA 1PX2A 2QUHA 4EELA 4XJTA 1KY5A 4DUPA 1W46A 2LZ0A 1C0PA 4KK4A 1T8YA 1IZZA 3G68A 2G9ZA 3LFHA 3PCTA 2P4QA 2AFHA 1HOTA 4YFVA 2DYKA 2JLUA 2GN2A 3WICA 1MOQA 4RJKA 1IWPB 1Z2EA 3P0FA 4GOMD 4BNUA 3OI7A 4FQ8A 5BPHA 1Y6QA 2GAAA 1T36B 3JVEA 4PE5B 5UKDA 2B99A 1BHSA 3HWSA 4R6WA 5M3BA 3ROXA 2YUIA 2W98A 2FKAA 4D4KA 4UNSA 1ZC4A 2XYQA 5AHWA 1N36B 3QNMA 4PO9A 2GZMA 5FUXA 5EERA 5GP1A 4G0WA 4C6TB 1HLDA 1G6OA 4NBUA 4IRMA 1ZNWA 1ZESA 1XA4A 1MPTA 2F55A 2OD7A 5AESA 1P5HA 4YJ2F 3W1EA 1SXJE 5AXCA 2C4UA 4L9RA 5ELMA 4EBFA 5A5FA 1T29A 4PNHA 5JZVA 3ASZA 3ASYA 4B43A 1T3TA 2AOUB 2PBFA 4MUBA 3KQNA 1YZKA 3B3QA 4YYEA 2IIVA 3STYA 1N6OA 3TIGA 4B6JA 5CA0A 5JPCA 2IHVA 3DQPA 2FOIA 3FTPA 4QYSA 4W1SA 3KSZO 3V4VB 5IYZA 5MN6A 2WQ7A 1IWBB 5L3RA 1FZTA 2WVAA 4UBLA 2I4TA 2QV0A 4PGGA 1DAMA 2JGMA 3CYFA 4P08A 1XRPA 4UEKA 4P81A 3VV2A 4HRVA 3IBYA 4A6EA 2C4TA 2XGSA 3LRPA 5E6RB 5I7AA 3H42B 3ZKAA 1JT2A 2Y9MB 4ZCQA 5AW6A 5BUCA 3IBSA 5JRZA 4JLVA 2I03A 4KXMA 3ZGZA 1KQPA 2X77A 4QJ5A 1EVQA 2W43A 3RASA 4R0VA 5JBQA 1T4CB 4QXMA 2Q6KA 3MINB 5ERXA 1B8UA 1JQAA 2Y0EA 3LLMA 1C1YA 1DIRA 1V35A 2OORC 3ER8A 1DDGA 1E6KA 4PTLA 3ZXSA 1KMHA 1O5OA 1UIRA 5F35A 3ZWVA 4CT5A 3ABSB 1Z5VA 1ZK2A 3DYVA 1N1DA 2H2FA 3IOEA 2UV8A 1DIHA 4O4IA 2X1MA 4GP6A 5D1NA 1A9SA 4AXXA 1L5ZA 1PVVA 4FUTA 1YBVA 3DC7A 1E9BA 2FR8C 5ESWA 5IEBA 3EY4A 5LR6A 5KWVA 4V0MA 3OE7A 2YR0A 2YXDA 2CNDA 3OU7A 1G5TA 3EEFA 4KO3S 4PR3A 2XYHA 3SJZA 3SVTA 3DUWA 4MQLA 2ZJZA 4DYHA 4PICA 4IDGA 5IJ9B 4XX1A 4C76A 4QC2A 1OTXA 3T3GA 3QVOA 1ULTA 2JIZA 2ENUA 2W22A 2V54A 3FFXA 2FN3A 4R51A 1MABB 4S04A 2OO5A 1RCUA 3AU8A 3TGWA 2Y27A 4HGRA 4M8IA 3VDRA 4PZUA 1JIQA 2XUDA 5CTJA 3V48A 3LDGA 4JV5B 5JQGF 3NPMA 4NONA 4LBZA 4LZLA 4P36A 3CVYA 4HDMA 2VSYA 4H31A 4BQQA 1NLMA 1JR2A 1SXGA 3EXFB 1RJGA 4URYR 3IOYA 3T5AA 5BR7A 4Q5IA 5KIAA 1DU4A 1Z5PA 2GDJA 1DIGA 4C2TA 1NT2A 1FMCA 3JVIA 2JBWA 1YVEI 2WMDA 3GLTA 3C6QA 4JI1B 4FMDB 4CLOB 1TO2E 2WTBA 4KDRA 3QKRA 3E5NA 2HFKA 1YS7A 2IBMA 2BHRA 2OSBA 2C5EA 1ZM3A 3EG5A 3NHUA 3C1UA 4W7IA 4EUHA 2XDQB 3GELA 3WVNA 4B83A 2IXTA 4NS4A 5K0JA 1T2VA 4MV1A 1RKBA 2H1FA 1F2UB 1OX6A 4X20B 1UPTA 1DX6A 1LZKA 3ROFA 2I4RA 3PIDA 2C4VA 1N1MA 3KPJA 3UC5A 3NEPX 1ESEA 3FAZA 1P17A 2FR0A 4IOJA 3DV0B 4LK3A 2Q7OE 3SNHA 3OQBA 3UCXA 1WSDA 4BJHB 3CLSC 3L7YA 4GXRA 1E9RA 2J5QA 4QJ4A 3P9KA 1E3WA 5IK2D 1TKCA 1CR0A 1CIPA 1X1RA 4FJ1A 4NZZA 5SICE 5AUPB 1YJXA 5JAIA 4ILKA 3DTNA 3UMRA 2O59A 3QLUC 3HLKA 1UM8A 5COQA 5F5XA 3EY9A 1FFEA 4YRPA 4J4TA 5A9SB 3IAM6 3J81k 2DR0A 1N8NA 4B46A 1W36D 4UZFA 5HE8A 3L4BC 3DL0A 2PD6A 4B3HA 1WQ3A 4EFNA 2PT9A 1HE8B 3BWCA 1HFWA 1EVZA 1GV0A 1OZFA 3IS3A 3N05A 3X2EA 3IYLW 4FS3A 4D41A 2D5CA 4KXUA 3RUHA 3C8HA 3CJQA 4GMXA 5DTEA 1MC8A 3H8VA 1KJIA 2QX6A 3CFYA 4ZPJA 4DIOA 3AR4A 1S2MA 4GPTA 1ABFA 2GJSA 3M6MD 4OIMA 2V55B 3OHSX 1GU1A 1R0XA 1YZ3A 3C3MA 3IEUA 3HADA 4LI3X 1CEYA 2HO4A 2UUCB 9LDBA 1MA3A 1JI0A 5EGSA 1Z88A 1L7EA 4MCJA 4WXRA 1N0UA 3NEYA 2WBLC 4E22A 2IK8A 4ZYLA 5TT1A 3NZEA 3U7IA 1T43A 3VRHA 4D8VA 1HC7A 4WOJA 4W5TA 3B8HA 4FINA 2AVDA 2QMQA 2R00A 2PT6A 1A9QA 5ALRA 2L18A 4DZTA 2Q4RA 1RQXA 1DWQA 1DKOA 1CRPA 2F4NA 5BMVF 5LXTA 4GDMA 2WVJA 3RSFA 2O8BB 1AZTA 1P3Y1 2A33A 3D7MA 3KYBA 3BOSA 3A6PC 5CLGA 3FPGA 4B74A 5EZ5A 4BVKA 4P80A 1F7UA 4EI7A 1KI3A 3IPAA 2ZYHA 3G0CA 4MKGA 3AG6A 1SXJD 3QJYA 4C4OA 5H1YA 2IS4A 3RQIA 1R5NA 2WIFA 5K4GA 4IY1A 1WZCA 1LZLA 1WVIA 2Q2VA 1LLQA 3L7MA 5JRDS 2JK0A 3I4LA 5J4YA 2ZZMA 2R8XA 1UJ5A 3UHAA 3A1NA 1JXOA 1IOWA 1NBME 1WCWA 2ECOA 3NDPA 1A77A 4DSAA 1C1XA 3W5AA 3GEEA 4MRAA 1YE5A 4IMIB 4R3NA 4ABTA 3WLKX 5DM60 4FWBA 4EY4A 5KYNA 1G8FA 3LBAA 4RVHA 4MYRA 1ZJ4A 4WFQA 1J6UA 1NRIA 1GAEO 3E1GA 4MS3A 5SV2A 1MIOA 3VPDA 1U7TA 1FW8A 2QSZA 2VQEB 1Z7YA 2WEKA 4ZQCB 3SE7A 4E3ZA 2P2LA 3DDNA 1FQJA 3FZGA 4IVNA 4J7XA 5CDGA 1HSZA 1JA9A 4G9EA 3LT2A 4D3YA 4MV7A 4P86A 4XH9B 3SFZA 1D7AA 2YHIA 3CW8X 3TW0A 4KNYA 1VHLA 4N82A 3AGPA 1Z3CA 1NXVA 1G63A 3F5MA 1G3IA 3H83A 5J5AA 4DRXA 3EZFA 1G3RA 4K9OA 4I55F 2E2WA 4NPHA 4RIIA 3FE2A 4R7TA 3V1LA 1U0GA 1BQ4A 3TLEA 2ZB7A 4RDHA 4RKFA 2ON6A 5KTSA 3R9XB 1Z6XA 2DJIA 3SYMA 4ETIA 4DLNA 4MQEA 1P0CA 2QORA 2OHJA 1JIUA 1MAWA 4KJZA 3S2ZA 3TJMA 2ZSFA 4FR5A 1UBEA 5HKAA 1L5HA 3LG2A 5GOZA 2DM6A 4Y67A 1ZH8A 2I3BA 3HJUA 5B1DA 3TIFA 5EGNA 3K6JA 4ZHSA 4GO1A 4D6PA 3CX8A 4TTQA 8ADHA 5AVQA 1UXHA 2NTYC 2V45A 4D4MA 3K8QA 1QE5A 1JLLA 2R4QA 1KMNA 4S12A 2Y1LA 2NAPA 2W2VA 2W2LD 3ZE7A 5LC1A 5FNVA 2XUJA 5JSKA 3X1ZA 1KEWA 2YHBA 1WXWA 2DBYA 3VR4A 5AHKA 5BRJA 4TTIA 4RPKA 1Z6AA 2QUZA 4R8KA 5CFRA 2GK6A 1DC4A 4L4YA 2B36A 1GPNA 1DMSA 4MS1A 1IAVA 4MGKR 4JR1A 3OIWA 1KE1A 3H2JA 2FZWA 3QW2A 3PKIA 3VI4B 2VHEA 1V7CA 1W6RA 2ZI9A 2UVDA 2RFLA 4XI9A 2P2GA 2IU6A 2XZLA 1E4VA 4DBLE 1YGYA 2IP4A 1HQCA 1X15A 1FU8A 1XRMA 2KLBA 3G0DA 3DE6X 2OZVA 4W5RA 3FFBA 3MERA 4TSRA 4OYHA 5EJFA 2B5OA 1PJBA 1EXWA 1Y3IA 2PZLA 3K09A 5AKKA 4L02A 4YREA 3RO7A 3HDJA 4LJYA 2FEOA 2J3IA 5JMPA 1LH0A 4GP9A 4DBZA 2DUJA 2OMKA 1JLKA 3N70A 2Z8YM 3S7TA 4OATA 3AUKA 4B32A 2FPIB 2I2CA 3B82A 1W0KD 3MBOA 4NU0A 4Q16A 2R96A 3STVA 4G0PA 2F8TA 1X39A 5AXAA 4WEOA 2Q6OA 3HY3A 1HTTA 3GI1A 5FHQA 3ZE1B 1CQPA 1RZUA 3RE1A 1CJBA 4XYBA 1DCFA 2VUSA 4G89A 5AVJA 1J2TA 3UCFA 4ZIRA 2A1UB 3A9SA 3F8SA 3JSAA 1TD1A 2QUBA 5IU6A 4OUKX 4NX2A 2Z8ZA 2PS9A 2YOGA 3HL4A 4A16A 1PK7A 3LUCA 4DEVA 4DJAA 5M29A 1ZRHA 4JIMA 1Z4KA 1RI2A 4MYCA 4D3DA 2FPPA 3W3AA 1Q57A 3WAGA 1Z4LA 4TTJA 3G6WA 2FPXA 1DMRA 1NPDA 5L4LA 2XZDA 1Q1AA 2UUPA 3QHAA 4R8LA 4ZCRA 1PFVA 5K1ZA 3AKYA 4P2BA 1TQHA 1EDOA 4TKZA 1ECLA 1CUFA 3C3DA 3M9WA 3GRKA 1UKEA 3P2KA 1YFZA 2A0FA 3BTOA 3FTNA 1HNXB 3PFIA 4WI1A 1K5DA 3JQFC 2I91A 1U3FA 1U28C 3PJGA 1AC5A 3IQIX 5REQA 4DUYB 2C31A 4NNOA 3V4OA 1N2CA 1XMPA 3LHKA 1QG4A 3OTQA 2IITA 1YS4A 1GU0A 3U4AA 3EVEA 3WQBA 1J97A 4CM9A 4F38A 5AIBA 1A9XB 1ILWA 1X7XB 3AUAA 3PPYA 4EUFA 1DV1A 4RNCA 3OE1A 3ZDZB 4WJZA 1MW8X 2AMVA 3KP1A 4JFAA 4JA0A 1JEEA 3ICCA 2WRZA 3HB1A 1G6HA 2HUNA 4X63A 4N47A 5IDWA 4H77A 4KH1A 4EKYA 2QP4A 1YHNA 4ABYA 1M5RA 3UJDA 2M6RA 1P91A 3QVJA 3KQUA 2BEKA 2QP9X 1X1CA 2X7HA 2P0AA 2HMSA 3BWVA 3AOEA 5CLFA 3PDJA 2ZBPA 1NR5A 2OZLA 3WYEA 4WBXC 1NMSA 4GPD1 4QGAA 4QXQA 4YN3A 3B7GA 1QO7A 4HDRB 1EGAA 2WSYB 3JZMA 5H3CA 4AG5A 3OJEA 4IQ8A 1S5PA 1VDMA 1YDWA 2ZSDA 1QG0A 3K9LA 1YBAA 3EA0A 4R8VA 2E4UA 3ZV6A 1UJCA 4TQ9A 4YT8A 2N47A 3HSYA 3LPNA 3OJFA 3ZZNA 1BYIA 2PKEA 2ALJA 1T1JA 2V9PA 3I2FA 1RIIA 3IFSA 4H35A 4INOA 3DB2A 1A7JA 4JYCA 4PFQA 2CFTA 1VE1A 3OZBA 5CFLA 3QUBA 4UATA 3F4BA 2DETA 2H1SA 4I4LA 2JFQA 2Q4OA 2A9QA 2VJAA 4CCAA 3RKUA 2PKXA 5DXFA 4DQUA 1E2GA 4RA6A 4N3BA 4Q4CA 1XMQB 1IPHA 5FULA 4WBNB 2B1QA 2FEXA 5CIWA 5DKFA 4C4SA 2R79A 5HBRA 1M2KA 2C96A 4DQVA 1FLNA 4TPKA 1ULZA 2IEIA 1S8FA 4HSEA 2JBAA 4E5NA 1M2JA 3TUIC 3KPVA 3TD9A 4AJ2A 3G8YA 1XVTA 1N2GA 3CUKA 3HYLA 3BMQA 1Y5MA 1HGXA 4K2HA 3TBFA 3OM1A 1E92A 1UBNA 5SY9A 3STHA 4BB6A 1M34A 3IVAA 3WSWA 4B71A 5L45A 2Q2NA 2QTMA 4WZAA 3BKWA 4PYIA 2PU5A 4ZHQB 1MEJA 1OASA 1TQ2A 1FDOA 2DJ5A 3P9YA 4GGMX 5G1PA 5E2IA 4C4PA 3BDIA 2I2WA 2WINI 4AY4A 5KYTA 4H15A 1PKXA 1XVLA 2E3JA 3EG9B 3O3NB 1NLUA 3RFFA 3OCVA 2EJBA 1D4FA 2R9VA 1YF3A 1Z4MA 4UUMA 4DEXA 4LVUA 3OQOA 4YHBA 3E7DA 3IAFA 3U7QA 4PBSA 1EGMB 4BP9A 1KMIY 2PY6A 4QRIA 3ZZ1A 2JFBA 2W2XA 1E1NA 1VLJA 4B3JA 2B8TA 2PLRA 2MSCB 2I22A 1PJAA 3L5OA 2Q5JA 5KTTA 1D0IA 1FX0B 1LPAB 1VSUA 2H4ZA 2P5SA 3ANLA 1IOVA 3B6MA 3GMTA 1MFZA 1OVGA 5J4LA 2XT6A 3DS8A 5JNSA 3E4CA 3O9MA 2XIJA 5IYZB 3MXOA 1Y3CE 4AG6A 4DLUA 4FEYA 3NWJA 1B6RA 4FNAA 4UUNA 4AZ3A 5JJKA 4D74A 2P6UA 3P2IA 4KE7A 1N6RA 4NFSA 4YI5A 4DPLA 1BN6A 2H17A 4JJGA 1P9OA 3IERA 4BEBA 4J4HA 3DPSA 2P62A 3IOMA 3OJCA 4H7HA 1S2NA 2VL7A 3WL5A 1CR4A 1VE9A 2XITA 2HIGA 4MW1A 5C3UA 3VMMA 3CNBA 5BW5A 3M1YA 4NNPA 1MU0A 1WEHA 5TPWA 4JX8A 4B7CA 4D8WA 4HQ0A 3NHSA 1Q77A 3WOVA 5FLEX 3O2QB 5A71A 3I72A 4DMFA 4PO8A 3G1UA 4ZRNA 3EEBA 2H2HA 4DREA 2EFEB 1QWOA 1SEPA 2GF2A 1N6LA 2R65A 2PGAA 4NIMA 1JZQA 4XWOA 5C8ZA 2C7PA 4ND2A 2YKGA 2ZVPX 1HE1C 2L69A 4RDXA 1BU5A 1V11B 4CM4B 1X1TA 3S0JA 1CUGA 2WWGA 1IJFA 4YAEA 3W90A 3W6ZA 3GPCA 4NOKA 4F85A 1G8PA 1TZCA 1A9PA 2LP4Y 3CR7A 2AZDA 4ETNA 3RUAA 5LOVB 1RXUA 1P18A 1E7WA 4X84A 4G1UC 4XD7A 2H29A 3ZV4A 1GILA 1G21A 3N8NA 2KHZA 1NBAA 4RO0A 1XDDA 5IW8A 4EFMA 4MVJI 4HAYA 4QRHA 4REQA 2JI9A 2VXCA 2BM1A 3GYGA 3DHVA 2QBYB 1LF5A 3A58B 3C5WP 3KUKA 1W9MA 1WPXA 1XTZA 1Q0RA 7ADHA 5FQNA 5JMTA 3BF7A 4Z1MA 2NPFA 5LA6F 4EKGA 2JLXA 4D3XA 4YCLA 3U56A 2OQVA 3EZ6A 4J3JA 4MI6A 1UIMA 4HRYA 1KR5A 2QRMA 2IEAA 3IJPA 4Z49A 2HTEA 4E32A 3T61A 1M76A 3HJBA 3N0TA 1IN6A 2B94A 3BXHA 4HDKA 4X6YA 4OXQA 4BMXA 4RIHA 3GLGE 1E3MA 2G63A 1I5OA 2HCFA 2NUTB 2VJBA 4B84A 1SBHA 4HY3A 5EPUA 1IHOA 2QZSA 4FSDA 1G8KA 4RKWA 5FHRA 5K3FB 3RROA 4HGPA 4U6SA 1P80A 2QB5A 3GK3A 3DOIA 4R3UC 1Q6YA 3L6OO 1X70A 5AM2A 4AJKA 2RK6A 5I8ZA 3ZVNA 4RK7A 4ZEWA 5J9FA 1SQFA 3AF5A 2BFEA 2AEMA 3BFPA 3I1IA 5LFAA 2X6QA 2GJ9A 1HKHA 1KVRA 3HDQA 3KKEA 3NNDA 4FFDA 3PNOA 3DXYA 4BNHA 3TZBA 2DTDA 3ZLBA 4Y1FA 4WESB 3SOPA 2O4CA 3LZDA 5K6AC 4CKBA 3BUSA 5E3HA 2FOLA 5LQAA 5FWYB 4HJRA 2HT1A 3H4IA 1RLJA 2FFJA 3U9TA 3IKMB 4HZIA 4CDNA 3S55A 3LWZA 4XRGA 1TU4A 2PJDA 3PCRB 5J2UA 2PJZA 1YE8A 1SC3A 5AVYA 1ZOSA 2CDAA 3BRCA 3M83A 4MQ5A 1YOBA 4OK6A 4Y6RA 3MZ0A 2W6CX 3Q7RA 1U3GA 3S1LA 2Z2KA 3OFKA 3VKWA 4K6FA 4FDAA 1NP3A 1CBUA 4CMGA 4RAQA 3Q9SA 4AW9A 1LLCA 4WOBA 4WJKB 1YU6A 2B4RO 5EUMA 3OE7D 5K3CA 4CCYA 2A7XA 4YAKA 5C35A 3U3RA 4OQDA 3LDFA 3GWGA 3TTXA 3RC7A 2AN4A 2FETA 5E8RA 2VP0A 3JXEA 2D1QA 1PVOA 4LF5B 4K9NA 1JJBA 1VIMA 2RG7A 3UVEA 4JC5A 6AT1A 2JIZD 4UD2A 2BJWA 1T9DA 5AK5A 3RS3A 3T4XA 1V1JA 2IXEA 4LE2A 2YJ6A 2ZIWB 4UMDA 4DIBA 1KZYC 3LRTA 2N46A 4KGDA 4MW5A 3QLEA 4AYWA 2OQRA 3WLHA 2O19A 2OBLA 4HN9A 1JP7A 1M2EA 3OEWA 2D8AA 3WBKA 4NVRA 5AJZA 3C48A 1UK7A 4P83A 3FCAA 3MS2A 4KO8A 2J3JA 3K0AA 2EYUA 4F21A 2L19A 1U0SY 2IHJA 3NDIA 4LA4A 4MCAA 4ANFA 4LMPA 4LQCA 1JQBA 2EWVA 1W2GA 2YN0A 4BFYA 1L5MA 3KKOA 2CFRA 2XVXA 4MNTA 5E1MA 4I3FA 3RBVA 2ZPTX 4KV7A 1FBNA 4I4NA 3ZQUA 1GTMA 4EJSA 1E7YA 5JIBA 4X24A 4CM7A 1B6SA 1XKXA 1E9VA 3CZPA 5KQMA 1L6IA 2MSWA 4FYVA 4KXFB 5KYYA 5A3VA 1JIVA 3ER6A 3VZSA 4MGZR 3R3HA 4N49A 5AR1A 4Q1EA 1IDN1 2XECA 3WB0A 5KYUA 1M1YA 4GMDA 5LP6A 1FQKA 3PDIA 1IQUA 5AVTA 5KX5F 1L4HA 1QGDA 1PNOA 5J43A 4PAQA 3WRXC 5FX2A 2YZMA 1EE1A 2OAEA 1OA1A 1E1CA 2WG1A 1L5RA 2N1MA 1FYWA 1KY2A 4QUAA 4BN4A 2HDWA 1QZZA 3PGKA 4PRLA 5DLPA 3L93A 3QVTA 3W5JA 2FNAA 4FMCB 1PUIA 1VI5A 1QBKC 2FMIA 3KYJB 3NRCA 4E46A 4IFEA 2NYAA 4MITA 1JGTA 2E5LB 1W4AA 4IJKA 1V7ZA 4TMXA 1QZ3A 1G8JA 4QUKA 2B2NA 2Y1OA 4AJEA 3UT5A 4XM2A 1X1BA 2BW0A 2XQGA 5KYWA 5CT4A 4N7BA 4GVLA 2CVZA 1Z5NA 1L1RA 2XZTA 3AEQB 5AK3A 3P2OA 4PAWA 3DEAA 5AK4A 3CKKA 2PS1A 4DDTA 2YYSA 3SC2A 1WUTA 3STUA 3V5NA 3M8KA 4JI2B 2CB9A 1BHQ1 3MB8A 4IYRA 1CQJA 4ZJZA 2AX4A 3SXUB 2K7ZA 4K7JA 1JEJA 4OJMX 5CLQA 2PSEA 1CR2A 3ACBA 5KVCA 1FL9A 1P1HA 2BEWA 2QLNA 3PUJA 1T1GA 4ZARA 3E2MA 1QTIA 3IUBA 4TYQA 4ZVPA 4YLYA 5K3EA 2FPOA 1Z3IX 2YY7A 1YD7A 4U3JB 1FTYA 2Q2WA 3JQEA 4Z4GA 4ZU6X 3I05A 1LQ2A 3C4JA 3JQGA 4KXLA 3V7YA 1CJKC 4Y8VA 5EJEA 3E9ZA 1HWYA 2X8JB 2FSPA 1GZ7A 3PD7A 3LUKA 4HAVA 1X8XA 1VCIA 1VE3A 2GN0A 3GVIA 4FN5A 1FSPA 2H8KA 2X9VA 3AR7A 4OA5A 1KQNA 2ZFUA 1E3IA 4KITB 5MF6A 1YS2X 1Y7LA 1P3DA 3DE7X 1IHUA 4TRRA 1RC8A 2MYTA 3LO8A 2WYWA 2IWRA 2NU9A 4ALMA 1QK3A 1U5AA 2GGSA 5LU8A 3P26A 4I4TA 4NE2A 5CBPA 3RF6A 2ZJYA 4FDTA 1L5WA 4RK4A 5HDBB 4EA7A 1JQ5A 1E5DA 4R9RA 1E1LA 1XZNA 2FG5A 4QUDA 3PNMA 5LMCA 1Z38A 2CSUA 3RSHA 2BRUC 4DR5B 2P4HX 4JWTA 1MQ8B 1HZJA 1GN8A 3FOWA 3FZNA 4M0DA 5G3YA 3CBGA 5LZ7A 1RYYA 1FMFA 1PR9A 2ZB4A 2GO1A 3TDMA 5AIAA 5DNVA 3SVZA 1CNMA 5BN1A 1SVIA 3F3YA 4LJ4A 3TKAA 4F71A 1SC9A 4G1MB 1X74A 1OJ7A 5EYPB 1WUKS 4JQYA 1MZVA 3RHSA 4F6CA 4X93A 1UZLA 1QRDA 3AM3A 3VYUB 4TS3A 1CLUA 3DE4X 1PTJC 5KVAA 2DBZA 2XMDA 4Y9RA 3EMBA 3KSAC 3RHTA 4FNOA 1J9GA 1EGHA 2C2HA 4HOYA 4TYNA 4K0RA 4BQRA 2IOQA 5AUNB 3KJXA 1L8QA 4BE7B 4FCCA 3MD9A 1I13A 3IHLA 4TKLA 4G84A 3L4JA 2HXGA 2BGKA 2BH2A 1W88A 3RTEA 1SUWA 3JD2A 3VYTB 2B8NA 4FCTA 5T57A 4A9AA 5GJVC 3VR1A 3QNWA 9ABPA 1AQ6A 4TM7A 1Z4QA 5DX0A 3X44A 1YL5A 5FL7A 1JR3E 3RAPR 3LA8A 4E21A 3FOCA 3FYHA 1CY4A 1SK9A 2F7SA 1R37A 3IBTA 1Y6FA 4MLZA 4N5NA 4R05A 4NBNA 1TGVA 3ASUA 3M5WA 4HH0A 4M0EA 2SICE 4UE6A 4DLSA 1CJCA 4BVJA 1BCRA 5AKJA 5BQPA 1NR7A 1FJ2A 4QTZA 2PHZA 2QX9A 4W7SA 3VSBA 2IJGX 3TQOA 4QG3A 10MHA 2RSLA 4KAXA 1JNXX 3B7PA 3EVAA 2Q46A 1Y5NA 2QJWA 2QJRA 2QKYA 1MGOA 3ZHYA 2NXNA 2I62A 2VHUA 2YYZA 3AJ9A 4HFMA 3P96A 4Y2PA 1L4EA 3E9NA 3U9LA 3UW3A 3D31A 4I5IA 4WK2B 5ALQA 1AV6A 1KYQA 2GD0A 3LHSA 3ND8A 1Q14A 4ZYVA 1Q11A 1R12A 4F6RA 4IIFA 2D7JA 4PZAA 4X0EA 3VR4D 5C9ZA 5IZCC 4DQDA 4BJ5A 5CB8A 4ONEA 3RFXA 1G2IA 3QU9A 3D2BA 3HVJA 3O8CA 1D8AA 1PWZA 3CZRA 3NDRA 3I8OA 1OREA 4QYIA 4CF4A 1R6DA 5JOQA 4Z4CA 1QZTA 1VLLA 2J9YB 4PSDA 1MIHA 4AP6A 4EY5A 2ES4A 1OHHA 4AUEA 3RH0A 3B3GA 2CNBA 2PXHA 2JLAA 4WXPA 1DRWA 3NO4A 1IU9A 5JSHA 1NQWA 1VFNA 2WUWE 4LBVA 4LRYA 2I7TA 4NCKA 4X61A 4YQZA 5J2TF 1LF0A 2H5EA 2SKEA 4CV2A 1PSDA 4WVFA 4B6OA 5HQTA 5KJ6A 2ILTA 1RAIA 2OL4A 2P75A 3KOWA 2H16A 4PWZA 2NUAB 5HKOA 1QM5A 3CR3C 4C4YA 2WZCA 1ITZA 4V0RA 1VIVA 3MYYA 1SXQA 1Y6ZA 1OU4A 2YDXA 2RHJA 1JQKA 1Z6PA 2GAOA 5AJWA 5HE9A 4BAGA 1JILA 4D43A 3E84A 2ZIZA 4RD1A 4MH0R 4PCUA 4A8HA 4I14A 2D5LA 1GAXA 3GLRA 5EHIA 4IXWA 5FV7A 3RU3A 1BC5A 3V8MA 3ZCRA 2JI7A 4I2VA 4OHWA 2M6LA 4X90A 3SG0A 1NW9B 2XTNA 4RHUA 2ZI6A 4FGJA 4PYOA 1FMLA 4Q37A 5EE5B 2D2FA 5H9VA 4KWHA 2XRZA 3AVOA 2EKLA 4A26A 5AW5A 5CA1B 3E9MA 4O4LA 4ZOLF 4BLQA 1CXZA 5EJGA 3C1AA 1WVMA 2XCUA 4MWTA 5D8DA 1PR6A 4FXOA 3KEQA 4RGQA 5DOZA 3W3AD 3ZHUA 3RTBA 3O8QB 4CFSA 3RUPA 5EI5A 4CG0A 4Y1RA 2G4VA 4RJ2A 5AM0A 3AWIA 1X7YB 2J0VA 3L41A 1XD2A 1JEQA 1U1GA 2ZYUX 3CJTA 3LY7A 2B7LA 4JEUA 1MOPA 3C3CA 5DDIP 1I0IA 2KQUA 2ZANA 5HCUA 5A0TA 2DFPA 2J9RA 4F93B 3GLFA 4BPBA 3FVRA 4JIGA 1PL0A 2OV4A 5KNDH 1X0VA 3HCCA 1TM5E 5KAPA 3V8VA 5FXMA 2YXNA 2PJRA 3RK1A 2XW6A 3WQRA 4CM9D 1G9TA 2J5KA 4BJ1A 5BWLA 2ZUSA 3GLIE 4HWSA 2XR1A 3GOQA 4HV4A 2JCYA 5BV8A 1DBWA 1T6XA 2EKZA 4Y2TA 5KJEA 3T7JA 4B17A 3Q9UA 4IOMA 4PNEA 1CRZA 1EK0A 5LMUB 3I5AA 4MINA 4NCIA 4BNDA 3PHGA 4BY9E 3W9UA 2B1RA 1I2BA 3R3VA 1E77A 4OM8A 4JWKA 2Q6IA 4HTAA 1PFYA 3RT1A 3T3HA 3ME5A 4CQLB 3IP9A 3C41J 2HMUA 3HCBA 4CWAA 3DZGA 2CNWA 3CCFA 1WXXA 3FCSB 1ZL2A 4ZEOA 4PF1A 3Q3IA 3QPAA 2WMOB 2X2PA 4WGFA 3SX2A 4C0JA 2AWOA 1FVOA 4KQJA 4V2IA 3L0DA 3JQ7A 4NAVA 3W5CA 1P4HA 2PZ8A 4MW0A 1NQ5A 2OO5C 3REQB 5CA0F 2EBWA 1ZD9A 5K3DA 3E8XA 2QT1A 4CLXA 2O5VA 5IYZF 1ZIOA 3VPAA 3GUYA 3NWBA 3B52X 3MMNA 3K70D 1JR6A 1QANA 1SHTX 3LVFO 5EIEA 3MIZA 5FOUA 1QO0A 1B74A 2EFJA 2OCDA 1UJ2A 4L76A 3GZTB 3M5DA 1JWLA 4QGBA 5TEWA 3TW6A 4CKCA 3I5YA 5AVSA 1PD0A 1L4GA 2VAMA 5DW3A 1OBOA 3NM5A 1RTTA 3AHEA 4HMPA 2I67A 2PA3A 5IUKC 2XPCA 3O2NA 4ROTA 1P4JA 2AI3A 1OLOA 4EECA 1IQPA 1XROA 3LNCA 1SD1A 5J40A 1XTBA 2L2QA 3FBTA 3LNTA 3DGFC 3IPYA 3V6LA 1AKUA 1DBVO 1SWVA 1N8KA 4O4IF 5HUJA 1T3LA 2BSQA 2P6NA 2BCGY 4L6AA 2VZEA 4PBTA 5GJCA 1IBCA 1YIAA 1DTWA 1KHTA 4AZ0B 1H6DA 4GYJA 3NBKA 2IYZA 2TMKA 4M9ZA 2YNMA 4NYJR 5ADWA 1TYCA 4IQFA 4EUKA 1LK7A 4IKEA 4RY0A 1JVSA 4WQMA 2ENWA 3Q7TA 3ZDEA 2GBGA 4M83A 2NADA 1EUYA 4HLNA 4OEHA 1I3CA 4P7BA 4B0OA 3I1JA 5MGNA 3Q3CA 1XNJA 2IW3A 3L1HA 4JELA 3BMOA 2QT9A 4GX2A 4IKPA 2ZUUA 3FJ1A 4TRMA 3KQVA 5IF3A 4MGHA 1IBRA 1M1YE 5TMBA 1X87A 4UFPA 4MKXA 1DZ3A 4H2DA 5E1DA 5C1IA 4YMGA 3LXXA 4TSKA 4LWPA 3QXGA 4J1NA 5BQFA 5G2OA 2UVPA 1VFPA 4MWCA 4F5YA 1C3VA 3KZMA 1P0FA 2JCVA 1ZHOA 3FTFA 3G17A 4BO0A 1IBMB 4NJMA 5A5GA 1DOHA 3SK0A 4ZV9A 4WZ6A 4CU5A 1XVVA 2B82A 2PUBA 3RJZA 3RUEA 1NUUA 5IH7A 5BSWA 2QYTA 5I9MA 1TDJA 1E8DA 1L7VC 2A4MA 5F1OA 5HIMA 3F1KA 1TOAA 5DOVA 1U04A 1WZIA 1SUAA 3DFFA 5JSUA 4LYAA 4IGKA 1XE3A 3IVXA 3RS2A 1GZUA 1TPYA 3EQ6A 4J75A 2COKA 3GBSA 4OBWA 4TMKA 3RVQA 1SKUA 3OPMA 1T8UA 3W4JA 5E95A 3D3QA 4C89A 2CMDA 4WFIA 5G0VA 1NAIA 2QX8A 1RQ7A 5HJ7A 3F7NA 2PL3A 3D7RA 4DCCA 4URFA 2E18A 2A14A 4R8SA 4KNVA 2E5WA 4IF6A 1E6LA 1HZZA 4ZREA 4EI9A 2Q8PA 2R2GA 4EQ6B 3HYSA 4EG0A 3MT8A 3AMVA 3JASA 5JSFA 3C8ZA 5DI9A 1J2EA 1GQSA 4RC9A 2EG5A 4PC7A 4WCVA 3FPSA 3VPGA 1W73A 3ETGA 4XD7D 3FGNA 3O4HA 2JI8A 3L40A 3VZQA 1N2JA 2PV0A 3MTEA 3W1WA 3ZEIA 1Z16A 1DO2A 1BXKA 1ORDA 1TMKA 5DXAA 2OY0A 4XKJA 3TZKA 3W9SA 4UOEA 4LF7B 2HMWA 2OWDA 2P6OA 4GWGA 2DOKA 5U1PA 4PSAA 2FE4A 2ORVA 3L5KA 1DKLA 2HCBA 1S9HA 5IJAA 3C8MA 4Z1MD 2B30A 2VC2B 3C6XA 2V7TA 3DO5A 5AKZA 1L4YA 4XWGA 3HXKA 3P9CA 1JKMA 4Z9XA 1X7WB 2RBGA 4ZVMA 3W04A 2MINB 3MWDB 2I7XA 4TWIA 3PFNA 5CDHA 1NW6A 3OA2A 2DWCA 1QIDA 5H9WA 5FH9A 2Y1XA 4BAZA 1OX5A 1UFOA 4F3TA 5HW0A 2B4AA 4NZMA 4RVNA 1NXXA 3GL9A 5EIWA 1FSSA 2ZS9A 3F7OA 1JA0A 2GHIA 3E9EA 3INRA 1CVRA 4LGMA 2HF8A 4TV9B 4WXHA 3ZVKA 1CS4C 3F3MA 1XMOB 2JVIA 1VG0B 1KDOA 4BFXA 4LJ8A 4N3AA 2WD7B 4GR5A 4YMWA 5TQ0A 4DDHA 4JJIA 3EBPA 4DM4A 4J0EA 4YXFA 5LXTF 3P2MA 3ZUPA 3H65A 1JAYA 1U0BB 4Y2RA 5DLQC 2BGIA 3FNIA 1WD5A 5FBLB 3WWOA 3QPUA 4NZOA 2FSSA 4D7AA 6Q21A 4J0JA 1YR9A 8GPBA 2AC4A 3IV9A 1CHNA 1FFBA 1NJ6A 1QDLB 3CVJA 3WADA 1IE3A 3UK0A 2DWUA 4XW2A 1GNRA 3K71B 3H9GA 5A04A 1U6IA 5K0FA 1OJLA 1Z2PX 1XLVA 3DTYA 4EGSA 1BQ3A 4KQIA 4O29A 5SZJA 3SZGA 1TZJA 1A5SB 5C8XA 2B1IA 4F72A 5K09A 4NTZA 4DY6A 3CMMA 1RACA 5E2AA 3EVZA 2IDJA 5JS8A 4X1OA 5ICFA 3ZWDA 3OCYA 3IMGA 2A0KA 4Q4DA 3PRYA 4OB7A 1T9GS 1UBMS 1XQ9A 4QASA 4RF3A 3M33A 2Y92A 1IY2A 2F9MA 3UN1A 2RONA 5KKAA 3K94A 1VMKA 3HR7A 3LQYA 3OTGA 4RFSA 3TLXA 1ZCZA 1L7DA 1Q83A 1HL3A 2DUNA 1SBCA 3K09C 3LT0A 4RZ3A 2D13A 2E55A 5DSZA 4DGSA 2QBYA 4MGIR 4Y2GA 2QTFA 3LY8A 3IP6A 4KW7A 4E2WA 3O8NA 1AS2A 2I9PA 1UDWA 3GEPA 3I9LA 1XJCA 3G23A 2ZS7A 2Y0DA 2W37A 4J0IA 4N40A 4QGHA 4DCGA 2ODPA 3BHMA 4UC0A 4YJDA 4JBIA 5CD1A 4GNKA 4JROA 1I2AA 1QNLA 1SZPA 1U9CA 2E0IA 2YWFA 3KEMA 2HJWA 3NHJA 4D44A 4RH3A 4DABA 1LX6A 4FYKA 5HVNA 1I4WA 2OV1A 2VRWA 3NGMA 3WGLA 5L4SA 2G70A 5LZ2A 2CUZA 4LJSA 5JWOA 1OLUA 4H4EA 3WKBA 2XD9A 2DRIA 2GXQA 4FYXA 3EGXB 3OPXA 1EBUA 2COUA 3I01A 1CUVA 1R15A 2RCYA 3EN0A 4WNAA 4ZK2A 1WD7A 3A6FA 2QUJA 3BC1A 3K6SA 2B1GA 1UBJS 3ROQA 3A6LA 5EC8A 3DOUA 1Q1QA 3GBPA 4C0HA 2ZRDA 2XZPA 1C2YA 1D0SA 1ZVMA 1VA5A 4US0R 5FFNA 1U7PA 3KLOA 4DYDA 3MOGA 1E2JA 1GPDG 3L2OB 2HLPA 3RUDA 1COWA 1F06A 3AFGA 4CR8A 1Y89A 3U37A 3W8RA 1QIHA 2F6RA 1WLYA 1OTHA 3E3LA 3COSA 3EWNA 3KKMA 1E9CA 4LZPA 1CG6A 4ZCIA 4U0JA 4EG5A 4DS3A 2IA5A 4LV6A 5BVGA 4YH1A 1E4OA 1A27A 4P3PA 3KBOA 1AHIA 1MX1A 2BFWA 2ID8A 4MV5A 2C5AA 4FOTA 4KGZA 3G7UA 1N5MA 2NMVA 4P84A 1OFUA 4CEIA 4MVJA 3KU1A 1YCGA 3HKDB 3W6PA 2SCUB 4MUXA 1RBZA 4BMPB 2CLLB 4II7A 1I4DD 3JARB 3REOA 4RTLA 4JJZA 2R8OA 4L4SA 3U4HA 5CRIA 1A3CA 4UMFA 4P0PB 4I19A 1LEHA 3NVMB 4WKCA 5FA6A 3U49A 4NATA 4JH0A 2SHKA 4XWYA 1BKSB 3AOEC 5CNKA 4H0CA 3OZCA 1S8NA 1W0CA 5H70A 4DM7A 3V8EA 3H1TA 4Z0HO 2GK4A 1NVVR 1Z28A 3F98A 2CLKB 1AK2A 1FSFA 3OZRA 3TQIA 2KBEA 1RVV1 2IE8A 3DVAA 3ZBPA 5IBPA 2PKQP 2BFPA 1YR8A 2GBLA 2JFPA 3QFRA 5E3IA 1D5WA 2F9LA 4RVGA 4TTSA 1C7RA 1C41A 1Y6RA 3CEHA 1VSQA 4YUWA 5B7GA 2EZTA 3G0BA 4M7WA 4ZQIA 5BP7A 3CG4A 3E5MA 3K70C 1XTTA 1XCMA 4M0KA 4M9SA 3GRZA 1HUQA 5JS2A 1C80A 1G20A 2A3RA 4Z2YA 2B8EA 3PWZA 4KIGA 5KQRA 1DJQA 2OFXA 2K2QB 3H5NA 2JH3A 2YWHA 4NHOA 1PZMA 2HBYA 5BSHA 1XXLA 3G02A 4FB4A 1XZAA 3IDQA 5DW0A 3AGQA 2JD2A 5AI8A 3I1FA 4PWYA 2DBRA 3DAOA 3Q87B 3QOFA 5CCXA 5GIPE 2CT8A 2V5VA 1N57A 5ESRA 2G82A 4IL5A 2L17A 5ESDA 4FTWA 2YW2A 3V55A 4EHFA 2J33A 3GLQA 4HX2A 3WOHA 1V3QE 2QQFA 3WR5A 4IIVA 1L8OA 4HAWA 3WYBA 3JZDA 1KORA 4JLKA 1EB8A 1DXOA 2RBKA 3NT2A 1UP4A 1KDTA 3PI6A 3PIIA 4GAEA 1WULS 3E2IA 3H9JA 3KD2A 3R0JA 4JL5A 4O4HB 5ALMA 4JVSB 4D81A 2P3LA 5KMGB 2ZJ4A 1XWWA 2HK9A 1BZYA 1UMCA 4MUGA 5CB4A 5HIKA 4E1VA 4BKOA 1PU2A 4RD3A 3LOQA 2CL7X 5CEEA 1E9SA 4ZWNA 2FEMA 1BMFA 3TBKA 3NNNA 1WBBA 5IC4A 2JLRA 3OP4A 5EQTA 5BYJA 3UFXB 1JB1A 3QVVA 2ODBA 4MVJG 3OM9A 2GK3A 4PM4A 3H1BA 1WZUA 5DFAA 3VJKA 4HEA6 1JG2A 1E96A 3PYMA 4WZBA 4E4YA 4C9BA 3AW8A 1DWUA 3U09A 1HLPA 1OWPA 1I51A 2YQZA 2O0HA 4LGCA 1QXSA 5JWRA 5FL7D 4R83A 5ISMA 1WW8A 1ZM7A 5GGXA 3SS9X 3RYIB 1B15A 2GS9A 1VHJA 5A0VA 3LW8A 1FNDA 3JQAB 1YQGA 5JSZA 3A37A 1V2HE 1I3KA 4B34A 3PICA 3GLUA 4MI3A 4Q4HB 1EFRA 3IH5A 4ZGGA 4LRWA 1M1UA 1Y4DE 5CFPA 3NYWA 2E7ZA 2QPOA 3Q3HA 1G3QA 2DQYA 2PTGA 2FE1A 3O4VA 4KFCA 3KPUA 1OFUX 4OUDB 5JS1A 4F92B 3D8UA 1QVVA 2PUJA 2G0NA 2JVKA 1H05A 1ULSA 4X6UA 2VT2A 3N1UA 2NUPA 3OOEA 1KIMA 3D3NA 4A0FA 1EHYA 1V0JA 1RFLA 1RJWA 4FFPA 3UXYA 1TCAA 3EAGA 1I1OA 3KTFA 3BWDD 4FNMA 1A71A 1MQAA 4YY3B 3NFRA 1TD9A 4U7FA 1E6UA 5A7GA 4NCXA 3F7TA 1RKXA 4N12A 3ZNPA 1Y37A 3C3EA 4YT2A 1R88A 2C57A 4Y2SA 5K0TA 1ICIA 5F9FA 3K96A 5F7JA 1OHHD 3HMQA 4EYQA 5A2GA 3ZJVA 4JAVC 2WB4A 4D8TA 1W9HA 1DAEA 2OAQ1 4Q9JA 3KFXA 4CW7A 1KJ9A 1DJOA 3ZYCA 1R8SA 2X8WA 1B7GO 1CQXA 1MB2A 1BXRB 4KIUA 5DWQA 5ALXA 3AM5A 2HO5A 3E35A 2CE7A 5HIJA 3T3MB 3OJWA 1EFPA 2JJ1A 2P67A 3DCNA 3X1WA 4D4JA 3NATA 3V32A 1K2WA 3PB3A 1HFJA 1Z74A 2CXTA 2Q2OA 3IESA 4UHHA 3KT6A 4W5HA 1E4EB 4EG8A 1Q7RA 2GLXA 2WAMA 3D3KA 2OHFA 4HFJA 2CNOA 1DT3A 1G1MA 1J0CA 1GGKA 1ZCJA 2D0DA 1YRAA 1MJFA 2IYPA 3FLAA 5KHOC 1PFKA 1UWCA 3S2YA 4L5YA 4RESA 1MJNA 3OIFA 4H27A 2XVZA 1PS9A 4C0KA 3QUCA 1JBKA 1BIFA 1RWPA 3BM5A 5EQDA 4GSKA 4DLZA 3ICEA 4HNRA 1NOKA 4G81A 2BP7B 3GWZA 2J7PA 2ODNA 1L3BA 4IDFA 4J7UA 2AI2A 3HCOA 1Z17A 1QS0A 2GKGA 4FKZA 4QIHA 5AJUA 4XWKA 2RD2A 3G2HA 3VYVA 2VKQA 2O5RA 2ZQYA 2YJGA 4BLWA 2C7BA 1YZYA 5T7BA 2V7UA 3F73A 2W2OA 2IH4A 4X92A 1KMQA 3LXMA 3OFSA 2ZI7A 5D3MB 5FUVA 4DAEA 4YCDA 3PPXA 4J2TA 4JOSA 1QYXA 2PUGA 2IHUA 2BH9A 5PGMA 1CKEA 1EXNA 1WB4A 3AR5A 3PDCA 3BX1A 3JD4A 4GPBA 4K87A 4TLLB 2BI8A 1M8JA 3ZY3A 2PL9A 1DC5A 3OZEA 1U5BB 3ZIAA 4L8FA 3K2IA 3WXBA 8AT1A 4G0OA 5HKLA 4E70A 2UZAA 4ZTUB 2I2BA 3H9EO 1AQLA 3JQRA 1O3YA 3ZYZA 2EARA 1VIAA 3RFCA 2QSJA 4JSRA 5FUWA 3TGPA 1L7XA 1MRSA 1Y4AE 2VSNA 2YHSA 4LRSB 2CJXA 3ISVA 4QJIA 1JR4A 3UH1A 1PAUA 4JYAB 2VTEA 1RADA 4FZ3A 1GXSB 1RHJA 4FM9A 3LK6A 1AKYA 3ECSA 3H2BA 3VI3B 1SA0B 1NOJA 4MV0A 3ZHXA 1ZDMA 5K8CA 4KQ9A 3W2GA 2JFOA 3DBRB 1MMFB 3PFFA 4MA4A 1KIAA 3NCTA 5D01A 4NMHA 3KVYA 2OVBA 4I5FA 1KFCB 3VUFA 2A67A 3TLKA 4M1YA 3PEWA 1SKQA 4M46A 3TN7A 5DB4A 4A92A 1ZAKA 4M6WB 1V9CA 2EF0A 2GM3A 5I7FA 2G88A 2E9SA 3PCXA 2ZBDA 4U6NA 2QX7A 1L5NA 4MLCA 2CNWD 4PHTA 2BGNA 5KSOA 1PI3A 1QVAA 1JAXA 3B6KA 1HA3A 2QVXX 2VTVA 3EOAI 3OOHA 5LL6P 1V7PC 1WSWA 1PFUA 2QRHA 2VDUE 4QPNA 1AGNA 4E94A 4HT3B 3WKCA 3A4YA 4Q7JB 3BAFA 1U0OC 4GVPA 2HJSA 1Z34A 1C4OA 2W2TA 1WDKA 5HF9A 2ZT7A 3TNLA 1H4TA 1H85A 2O7QA 4XTCS 3UMGA 4NBSA 4LHVA 4C03A 2A5FA 3R6LA 3THXB 4IO1A 4GX0A 1KYTA 1VG1A 3JQ8A 2GCIA 1QO0D 4JKIA 2VHXA 3I30X 3CMCO 3OT1B 1LI5A 3BJEA 4BIIA 2ROQA 4NP6A 2X0IA 3OC6A 5JALA 4BZZA 4LY3A 4DLXA 2Y4NA 5J59A 1EUCB 5B7NA 1NU8A 1E1MA 1SRRA 1GTZA 3EXG1 2VPWA 3GY0A 3PI7A 1AN0A 3CLUC 3W6NA 2QUIA 4GZ6A 1OXTA 4A4DA 4EJSC 1AKTA 3GJSA 3SN6A 5ES4B 1GTJ1 2AOXA 5FB3A 3IE1A 1KEVA 2WU1A 2EERA 5J2UF 4J1TA 3ULKA 4FX2A 1T9GR 1XEXB 3RU9A 5LD2B 2CWWA 4BX3A 4Q18A 4KTTE 3H5LA 3OOJA 2CVPA 1E64A 4MQ4A 1G7CA 2G77B 1OIXA 1NVKA 1WXHA 2OOKA 1J8FA 4DOMA 4OMUA 4LQ4A 2XXBA 4IH1A 5GJWC 4IJMA 1P1CA 2ZTMA 3CKMA 3TZLA 1WU8A 3JATB 3RGGA 1GU7A 3PLAE 1XHLA 5ALPA 4KVZA 2BVNA 3EYAA 1B00A 2RH4A 4OYRA 2WTUA 1ORHA 4DZRA 3HVRA 4OLHA 1Y1QA 2CUNA 4IUCS 3G8AA 4P35A 2RMKA 3M4YA 4R1NA 4UM8B 4AIRA 5BW8A 5C8YA 4W1PA 4Q19A 3AF4A 4H3SA 2C9OA 4ZI5A 3GGGA 1WP9A 3RM3A 1GZ6A 2JB9A 1N5OX 4DVJA 4HP8A 1TNDA 2OXTA 3SYNA 2I2FA 1M6WA 3SDBA 2QDXA 2GPWA 4LF4B 2O3SA 4XXHA 5SZKB 5DV9A 3RIXA 3WL8A 3IELA 4TLEA 3EFBA 2LPMA 3OPQA 3HEMA 3UQZA 1ZXXA 2G08A 3NWOA 1X19A 4DCTA 3Q8MA 1F8XA 2R6ZA 1KTIA 1WJGA 1LLFA 2Z6VA 2I6QA 1A9RA 1XYVA 1C9KA 5AM1A 3SBOA 1Z6GA 1OYVA 3A27A 4EA6A 1Z08A 4PG7A 5FI3A 1CZOA 3V1NA 3KOOA 1ZQ9A 1NBIA 2BAGA 3M5CA 3CRMA 2ZDHA 1E18A 2REBA 4GEKA 3KBBA 1XCOA 2Q4EA 1IDOA 1NF8A 1AMUA 1OI2A 1IMOA 3TVYA 2LE0A 4OI1A 2D3WA 3E48A 2X4LA 2ASVA 3CIOA 4FB5A 3GLSA 4G8JA 1O94A 3KKKA 4WVLA 2H1LA 3V46A 2FJ0A 3OCCA 3O83A 5LP6F 3FYUB 1JHAA 2ZW9A 3FF1A 3KTAA 4NE7A 4NOLA 3SE0A 4C7JA 4CIWA 2J0UB 4QQRA 3RDPA 3ZE9A 3GGPA 4P4UA 2B5WA 2PXXA 2REQA 3EVFA 4MCIA 2O2XA 3MS4A 1ZITA 3G79A 3AM4A 3RHFA 3ZLTA 4G1FA 3K0KA 4DLVA 2Y0CA 2CDRA 3OT5A 2HMTA 3OMLA 1ST3A 2JGRA 3EYWA 1BYUA 1TZ2A 1T0PA 3E27A 4OJQA 4N4AA 3D4LA 4E07A 1YZNA 3LSYA 5FO0A 1A4XA 4I3HA 1UL1X 3BCRA 4JJ7A 5K2MA 1YACA 5L6MB 1HX7A 5DYNA 2JFZA 2ZRFA 1G20E 1HV8A 5CT5A 5L3QA 5SYMA 3IHWA 2CLCX 3Q5GA 1UBGA 3G2IA 5DEOA 4I2NA 4R2MA 1FJXA 1WB6A 3LBIA 4IDDA 1E62A 1VCOA 2J5BA 4ZVUA 1Y8QB 2EHJA 3I92A 2WJAA 3ADCA 4JUDX 2JZNA 2E5FA 2XLCA 3D8SA 2GVNA 5IT9A 2H85A 4K6HA 2W8BB 1HDZA 1K3UB 4EA8A 1ZKDA 5SZHB 3ETLA 3GZJA 1VECA 4MX8A 1U2SA 1QFSA 4ZAXA 1GPKA 3EBLA 3UJNA 2VP2A 1H2XA 1IEQA 2K6GA 3BREA 4G0XA 4DC0A 3ZDBA 4OBBA 2FWPA 2AJDA 5K9ZA 2UYHA 2R47A 1XX6A 4HVTA 4B3XA 3PFHA 4KKVA 4GL2A 4S1PA 4NU5A 3ZE0B 4OKIA 5A02A 4EA9A 1OZGA 3NDJA 3IBGA 3JYPA 4KPUB 4LWZA 4EQZA 4YNBA 1TM2A 3UAOA 1OFIA 2B1JA 2Z2ZA 1HURA 2PR2A 3DE2X 3F4KA 3QPVA 1TQDA 4HMQA 4TV8A 1PR5A 2MR6A 2FJUA 3ESCA 5HBGA 1VBNA 5E4TA 2CYCA 2P9TA 4X3OA 5MFZA 1JHMA 5TIIA 3FWPA 2AZTA 5GV8A 2EZ9A 3OBBA 1ZYUA 1S3FA 3ENKA 1AKQA 3PQCA 1SHKA 3FGPA 2A5DA 4KV9A 4YV1A 4I1PA 1PNRA 1J06A 3EA5A 3D6MA 1YWGO 3NVAA 1ZLXA 3BH6A 3H19A 1G55A 1M7HA 1NWCA 1PJSA 1KI1A 4H7EA 2O2SA 2FDRA 2Z5VA 3GQBB 3K0CC 3OEHA 2NO4A 3PKZA 1BXGB 1SKAA 3HVIA 3W7VA 1J20A 3QVLA 3HO8A 3KR2A 2AFIB 3P45A 1ISIA 4Y9UA 3U3MA 2PYDA 2WTEA 5B6PA 4PLYA 3B5JA 4V0LA 3PXGA 4EENA 2F48A 1ECFA 2GK7A 2XXJA 3Q3EA 1XFDA 4GE0A 4TXLA 4URZR 3DXFA 3EMVA 2QD1A 1FP4A 4KR7A 1I24A 2PZKA 1SHLA 3A1TA 4P1ZA 2JGJA 2JIBA 4Q24A 4DSUA 1RYFA 1B6TA 3G59A 2XXAB 5AKEA 5CAEA 4MR8B 3ZI4A 4D80A 1ZM2A 5KJCA 1GQ2A 3WI7A 1L7PA 1VMDA 2JJ2A 2WYVA 1USKA 1EEHA 4C6RA 2HSWA 4LBYA 3QTLA 4EKEA 4JI0B 4OI4A 4P6VF 1QQ6A 3JWHA 4QEKA 1M1NA 2C58A 3ZR4B 2IIPA 4BVEA 4B1FA 4ZVKA 5JAMA 5JC1A 3U60B 1O4VA 2ATEA 4KZPA 4FK8A 1O54A 3DKIA 4BRZA 1R9NA 3LXUX 2BZSA 4TWBA 4FD2A 2QY6A 1KWGA