2AGAA

De-ubiquitinating function of ataxin-3: insights from the solution structure of the josephin domain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
190
structure length
190
Chain Sequence
b'GPLGSMESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIRVQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Machado-Joseph disease protein 1
publication title Deubiquitinating function of ataxin-3: insights from the solution structure of the Josephin domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 40
structure length 190
sequence length 190
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02099 Josephin Josephin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2agaA02
3.90.70.40 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2agaA01
4JYAO 3R66A 4JI0O 4JI6O 5LL6Y 5BR8O 4LF5O 2F4VO 4JI1O 3J81N 4DUZO 1R6TA 4DR3O 4JI5O 1HNWO 1XMQO 4B3MO 1HR0O 2ZKOA 1YZBA 1A32A 1N34O 4B3SO 4NXMO 4DV6O 4DR7O 2UXDO 4DV2O 4NXNO 3J7AU 1XNQO 1D2DA 2Z0AA 4LF7O 3T1HO 5LMUO 5BY1A 5IWAO 4B3RO 4DV1O 1R1BA 2VQEO 1IBLO 1AB3A 1J5EO 1IBMO 1XNRO 2JRIA 1N36O 4YY3O 4DV3O 1DK1A 1FJGO 4X62O 5BXZA 2N74A 4DV0O 1FKAO 4LF6O 4DV5O 2UUBO 5IT9N 1X59A 4DR2O 1XMOO 1I94O 4K0KO 4GKJO 4DV4O 4JI3O 4YHHO 4JI8O 4DR1O 3T1YO 2HHHO 3M8AA 4X66O 4DR5O 3O65A 5H5NA 2UUCO 1HNXO 4X65O 1N32O 4KHPO 4DV7O 1N33O 1IBKO 2ZM6O 4JI2O 4X64O 1KUQA 5A2QN 4OPAA 4DR6O 3JAMN 2DOSA 4JI4O 3F5TA 4GKKO 2E5LO 4JV5O 1AILA 1F7YA 2UU9O 4LF8O 4OPHA 3SDLA 3OTOO 2UXBO 1XEQA 2LW7A 2UXCO 2FKXA 2DJVA 5FLXN 2VQFO 4DR4O 4LFAO 5LMNO 4A5UB 1G1XB 4DUYO 4OX9O 4LFCO 4JI7O 4LF4O 4B3TO 4AQYO 2UUAO 1FYJA 2AGAA 1NS1A 3J80N 4LFBO 3RT3C 4LF9O 1HNZO
chains in the Genus database with same CATH superfamily
2HG5C 2R9AA 4PELA 3JAKA 2LP7A 4BS5A 2B1NA 4CDEB 4QGPA 4LF5O 4DUZO 1KFXL 3U8EA 3CP1A 2LQTA 1BGYH 2ZKOA 2YEVB 1N34O 2OULA 4JI2B 4DR7O 4TT3G 1EZVH 4FLTA 3L75H 2QKAA 3FB5C 3ZMSA 4MVOA 2Q7HA 4DV1O 1AYUA 1JFFB 3HWNA 3L71H 1K5QA 3RBZA 3SPCA 3VQWA 1BQ0A 1NQCA 1MSDA 4DV0O 3N2KA 1FKAO 1TVKB 4CDDB 2BTWB 1OJHA 2FYEA 1PBHA 4LNUB 2MW2B 4GKJO 4RAIA 1KC8W 2FO5A 2HJDA 1VQPV 3OQCA 4E2LA 3E8BA 1TUEB 1EN5A 4JYBA 4X1IB 4ZI7B 4BOQA 1RPRA 4O4HB 5CMUA 2JEUA 4C7UA 2RCVA 4ASUG 4FFKA 3T2MA 1KQSU 1BS3A 1H8EG 2BE3A 2XAGA 4UCUA 2IJIA 4MI7A 4UCTA 4P6GA 1WN7A 1QR9A 4JV5O 2IJHA 1O9HA 2UU9O 3ERVA 5LHIA 2QWQB 4B3RB 4HBNA 2BOCC 3HHIA 2FL4A 1ZWIC 4X1KA 1X9YA 4RF0A 3S3QA 3S3RA 1G1XB 4PA3A 3KG2A 4OX9O 1ATKA 4MTGA 4LF6B 1MEGA 4YIPA 2CGNA 4O4JA 2Z3YA 1Y74A 4JTAB 2HLDG 2ZE5A 3OR7C 4X1YB 2DC6A 2WLLA 2HFEC 4FLVA 1K9MW 4DV4B 2FT2A 5FPRA 4UVBA 1Y4MA 5FNVA 1JQPA 1H2GA 2X6AA 3MJ5A 4TUYA 5KHGA 1PPOA 2EULA 4PI0A 1SZXA 1S5LZ 1ICFA 4DR5B 5CA1A 5JZEA 2P6JA 2ILMA 4X65B 3W30A 4KHPB 3H01A 1TU6A 2FQ9A 3I06A 1AU2A 4YJ3A 4DV6O 1R73A 2Z84A 1RM1B 4DV2O 4D6TH 5CVNB 5EGWA 3JAKB 1RSOA 1N4CA 3B09A 2AHYA 2ATKC 4RUFA 3KCYA 5D5PA 3ZRWB 5JCOA 4I5SA 3F5VA 1XDCA 4IGGA 3SPHA 4QE7A 2OT5A 1NI8A 5FPWA 2BOBC 2ZDIC 3E89A 2OIEA 2PGGA 4KUMA 3LSQA 5B1OA 3W7WA 4IT5A 4FJCC 2ARHA 4J41A 1QDQA 3PBHA 2O6XA 4W4LA 1QU7A 5LHGA 2YIAA 4F4LA 3ASNB 4ZOLB 4QRGA 3CCRV 1F23A 2J7QA 4WFEA 5LBQA 2IU3A 4QNHB 1BL8A 5TISZ 2QA4V 4M0WA 1JJ2U 1VARA 2NN4A 1RM1C 1PVJA 2HWKA 3PT2A 4BOZA 5E79Z 1PP9H 1K4CC 1SQQH 3G80A 3JD1A 5H5NA 3S3XA 1BZKA 5EC1C 5JH7A 1AU3A 2QM7A 4CH4A 2ZM6O 3IAYA 2E02A 4RF1A 2ITCC 4I9WA 3KZIZ 3ZX6A 1VQ9V 2XU5A 4TQFA 4FPPA 1M56B 1ZL8A 1NR1A 4IYIA 3CXHF 2K9PA 3CRMA 1BHAA 3JSNA 1WA8A 4N23A 4P9PA 1Q7YW 1JR9A 2ADQB 2YS8A 3CRRA 3MHSA 3ZHRA 1BT8A 5JJEB 2OP3A 2NQAA 3RVWA 1T5EA 2JVDA 4TWKA 4K0KB 2XTAA 2Z5UA 3RN4A 1AJQA 4X1KB 2XASA 2V4DA 4PHZA 4JI6O 4BR6A 3HKCB 1GK9A 1QLNA 3CCUV 4ZTBA 3A0HZ 2HHHB 1N0NA 3LFYA 2VS0A 1DF4A 2LW1A 4AXMA 1Y74B 3QTCA 4D8EA 2CTWA 4DR3O 1NU1H 1M56C 3MDSA 4H37A 4AHCA 2EBOA 5ITZA 4NXMO 3I3TA 5K16A 5FNVB 2Q7EA 4NXNO 1WLEA 2AZ0A 3MHHA 1DGSA 1XNQO 4QPJA 2PTMA 2QR4A 3ETDA 3C0RA 3RYHA 3L73H 2E5LB 5CA1B 3T1HO 2VHFA 1K3BB 3ABUA 3K59A 4OEMA 2ZE6A 3PDFA 1IBLO 1OCOB 4YJ3B 1H2NA 4OGQB 3SGIA 1RSOB 4CH5A 1XQ8A 5E1AC 5KUKA 4MVSA 4LFAB 5C8YA 3CB2A 3IEJA 4LFCB 2GFOA 4CZWA 1GMGA 2WBFX 1AJPA 2Y69B 4F6RB 4I55B 4P6EA 1GCBA 2K1EA 5LGNA 2M7WA 1I94O 3AG2B 3LNNA 4JI3O 1Z5VA 2CH7B 2PY5A 1DKIA 2IH3C 2WLMA 1IBMB 2LFSA 1TUBA 4J42A 3BWKA 3SYOA 1SF9A 1U9VA 1U97A 2ZQMA 1U96A 4JYYA 2XT9A 4FLUA 1IBKO 3ZN1A 1YIJV 4ZBMA 3NR7A 1OCOC 1KKCA 2PUSA 1S76D 1KU9A 1MIRA 1PPNA 4DR6O 1FXVA 4FIPA 2P7TC 3BB7A 4GYCB 5JCOC 1R3LC 1BQIA 5JH7B 3K04A 4G54A 4O4LB 1ITOA 2Y69C 1BE3H 2F23A 2GUZB 3VOUA 3BPFA 1N36B 2P67A 3IFUA 3AG2C 2Q73A 1PPJH 3STZC 4W5BA 2DWDC 3F5WC 1ZL8B 4K3AA 3CRAA 3F7VC 4BSQA 4FM1A 1WA8B 4JF3A 3S3WA 1S4VA 3ZJZA 4JYAO 5L3FA 2DQ0A 3ABMB 3BCNA 4CC5A 4UB6Z 3WB2A 2XUMA 1R6NA 2DCCA 5LMNB 2E3CA 2CTRA 1EWMA 1MG1A 1XMQO 4B3MO 3ZEDA 3SYQA 2Q4PA 2EILB 1M93A 4WFHA 4X64B 4D8IA 2YIDA 2V7QG 2R9MA 1KYOF 4LH6A 1GO3F 5LMUO 3OUSA 3CPWU 4X9QA 3FB6C 1VQ6V 3JARB 3BA9A 3Q4HA 4RUEA 3HR0A 2WLIA 3FD9A 3QO8A 4YY3O 4Q6GA 3LNMB 4JI7B 1NVPD 1PPDA 2YIBA 4WFGA 3ABMC 1VQ5V 3QG5A 1MZEA 4HNAB 1YCIA 3EHBB 4O4IA 2EINB 3D3QA 2WLKA 1WP8A 1MMMA 2JIZG 5A9GA 5B3SB 4U7OA 4PP2E 3K58A 3CH2X 4I9QA 2EILC 5IE9A 4UUJC 4DR1O 5EBWC 2RMKB 3JASA 7PCKA 1BCCH 2DYSB 4X66O 5IYDO 2UUCO 1YVBA 2WA3A 3PHXA 1N32O 2Q67A 1QQCA 4B3SB 2DJFB 2GBOA 2VWJA 2F1MA 2B1MA 4MVQA 4BQVA 2R70A 2JJ1G 1TUBB 3MHHC 2AYNA 2LGQA 4TV8A 2F66C 3LUTB 1BY8A 1AR1B 4O2BA 2C2AA 2EJ7A 4GT1A 2Y0PA 2EIKB 1WPBA 2EINC 1NPZA 2IU0A 4DUYO 4DV3B 5B3SC 6PADA 5AG2A 1LNQA 2QKSA 3M99A 4MVMA 1VF5B 1FXKB 3WB1A 2DYSC 4R7CA 3ICXA 1XUQA 3B21A 4BOPA 2IBIA 1RPOA 4JI0O 4U3FH 1SS3A 4CH6A 1R6KA 1NB3A 3TJTA 5LL6Y 4RO2A 3K57A 5CBGA 3P3NA 2G38A 4ZHQA 3OM3B 1HNXB 3SJBC 2BU3A 1PL4A 1CP9A 1L0LH 1KP2A 4GLXA 1SRYA 2ZCEA 3OTFA 2W0XA 4DRXA 3TXSA 3E83A 5CVOB 2ZXWB 4B08A 3GB7C 3NHEA 2EIKC 2PF4E 1P7GA 2E74B 1WB7A 3JALA 3OFNG 3OF8A 4IIJA 4TV9A 1GKFA 4I50A 1FXKC 1V54B 3CRCA 4CS4A 5IY5B 3SJQC 1OCZB 3K3WA 4MW8A 1JJOA 5H6QA 1PPPA 4BOUA 1HNZB 2ZD9A 4P30A 1NR7A 2WLIB 1GTOA 1M1KW 3L74H 2JGDA 3JYCA 4YYQA 4LWSA 4QRXA 3O65A 2F4VB 4WA6A 2ZXWC 2CGOA 2GDSA 2A79B 2WSSG 1FFXA 1BGOA 3N2GA 1YJNV 2ITDC 2EIJB 3A8TA 2HVKC 1GN6A 4G27B 4FZ0A 1NL6A 1NQTA 1V54C 5JQGA 3CCJV 3F7YC 2F95B 5IY5C 1F4NA 2VQEB 1OCZC 1G6UA 1NTKH 1AI4A 2YSUB 5E6JA 1IXMA 2AVWA 3D36A 3QNEA 1PL0A 4PI3A 2MK3A 4PA6A 4TV8B 1GM7A 4E4EA 1GRJA 3H1KH 4O2BB 4WFFA 3STLC 2DCDA 4WBNB 5LOVA 1KP3A 4UCVA 3RVVA 3BFRA 2RN9A 5B66Z 3P3PA 3P5VA 2EIJC 3E22A 3RWRD 5JVDA 3M99B 4DO2A 3BVOA 4DR4B 4JTDB 2W6JG 1SNKA 4Q8HA 3G6EV 5EZQA 2CAZC 1D5NA 5GONA 4O2AB 1EWPA 2PI4A 3JAWB 1D2DA 2P4VA 2YJ2A 3MTVA 1IURA 1HDJA 4ZHQB 2YJCA 2OTJV 1MA1A 3CH3X 1S3JA 3OTOB 1QVGU 5GW7A 4J9YB 4MM3B 3E8GA 2ETNA 3C3TA 1S72V 1QXPA 1J5EO 2CIOA 1XREA 2OCHA 3ZUAA 3G67A 3CCSV 3PN1A 4JZGA 3CEIA 4DRXB 3N3GA 5EZYA 2HH5A 2H3OA 4FK5C 4LF4B 2QSAA 5LA6A 4MZOA 4EB6A 5KHIA 2ZT9B 3JALB 2UUAB 1CB5A 3DF0A 4A5UA 2RQ6A 4FFBA 1JMKC 2YI9A 3KWBX 2VWKA 1EN4A 3PRMA 1H38A 3TXQA 3TMPA 1XI1A 3JD0A 1HR0B 4GCZA 2YXYA 2YUAA 1BSMA 4JI2O 1NH2B 1Q6UA 2CDYA 2JGDB 4EFEA 4MW3A 3RW0A 5KX5A 3SDLA 3RFRA 1MHWA 1FFXB 2AHZA 1ZLZA 4W4UA 1F51A 4J7KA 3QO7A 4XDKA 3RNVA 2VRZA 2FKXA 3KCXA 5IDJA 5JA7A 1M5IA 1AI7A 2DWEC 2R9RB 4U3JB 1IZ3A 2E75B 2ZNJA 3K08A 2JDIG 4HAMA 3UKMA 3CMAV 1YTFD 2DZYA 2QM8A 5JQGB 3WXGA 2V1DA 4OVZB 3CHXA 2AGAA 5J2TA 2AU1A 2DN9A 3PHUA 3ZMTA 2GHUA 3SYPA 1MABG 2YC0A 2KSDA 3U11A 1QNMA 4ICGA 1R6TA 2FRQA 1IDSA 2DYRB 1YEWA 3H8CA 3OVXA 1GN3A 1AP6A 5LHHA 1JQ0A 3E22B 5L3BA 8PCHA 1GAXA 1ZAUA 1EZJA 4H33A 1CPJA 4B3RO 3KSEA 2G8EA 2AIMA 4X88A 5GONB 1ORQC 3L72H 1GECE 4X6HA 4LF6O 4QIWF 1B6QA 3HPLC 1W59A 1P49A 2HD5A 3CD6V 3BOWA 4RY2A 3ZMUA 4LBEC 3JCUZ 1H8HG 4DV4O 2Q69A 1MEMA 2QGNA 4X89A 1BP4A 2DYRC 3E8HA 5H2FZ 5EZYB 1Q81W 3APQA 4I4TA 4DR5O 3QF7A 2ADPA 3LXSA 1E1RG 3HKEA 4X65O 1OV9A 4RKXA 3ML0A 4K35A 4KHPO 3PSEA 1PADA 2R9FA 3G6BA 1CVZA 4UCOA 1Q82W 4BAYA 4R6ZA 3U0ZA 3WXFA 1SA0A 1Z5WA 2Y48A 4GX0A 4L87A 5KHHA 3ZN0A 5IYZA 3JD3A 1Q86W 4FM2A 4BIZA 5IWAB 2NQDB 1SP4B 4X6JA 2CK3G 3MAQA 1JOYA 3BY6A 3N2KB 1XNRB 3P32A 1PNKA 4UVAA 3RYFA 5EC2C 1F2AA 1B3QA 3H7DA 3EFFK 1EFRG 5BMVA 2UUBB 3AG3B 4NB5A 1XMOB 5EIBC 5CB4A 2WWWA 2QM4A 3B2EE 1SETA 3FB7C 3K06A 2HP8A 3ASNC 2YI8A 4KXRA 3VQYA 3IFXA 4NYKA 5CVMA 4X6IA 1L0NH 5FPOA 1N33B 3K24A 3RGBA 3I55V 4YV8A 2KG7A 2W0FC 3ZHUA 3J7AU 2FE8A 3M7MX 4NTWA 3THOA 2DCBA 3CCQV 2P22C 2WLJA 4LF8B 4PADA 4BPVA 1YJ9V 3SJAC 4Q8GA 3UO2A 2OCCB 3AG3C 3OT7A 5CBHA 1F2BA 4O4JB 3HHAA 5LXTA 2E01A 2BDZA 2WLLB 1DK1A 4NXMB 1B04A 3ZS8C 4TUYB 1E1QG 1ROPA 4K0KO 2NR5A 5DM6V 5LYJA 4GZRB 3A2FA 2DE0X 2WPDG 3OMIB 3E86A 4BIUA 1PV0A 2DCAA 5EYPA 2HHHO 3O0UA 1YT7A 1BQZA 2Q8VA 4JI5B 3BC3A 1OCCB 2BSKA 1SQVH 3OGIB 1K33A 4DYLA 4ZIBA 1N8RW 2OIGA 2HXZA 2AXTZ 3BCCH 2XU3A 1PE6A 2OCCC 1I94B 1H2SB 3KX1A 3HKBA 4JI3B 2E5LO 2X6BA 2ZIOA 3HKEB 2NQGA 1XEQA 3BABA 2XU1A 1VF6A 4Z2WA 1SA0B 4LFAO 2DC7A 1HWYA 1YK8A 1TLOA 4LFCO 1FJGB 4X62B 5IYZB 4NTXA 3OISA 2A0LA 4AQYO 2P7UA 5HFLA 4DV5B 3JCZA 1NS1A 3SR2C 5CA0A 1OCCC 3IMAA 5FL7G 3ZMVA 3T1YB 5BMVB 1UFIA 2R72A 2XOKG 1SQXH 2YICA 1XKGA 2Y4UA 1YZBA 1A32A 3FYIB 3OF9A 1W2BU 1YSCA 2HHNA 3A0RA 1XILA 2EZOA 3IUTA 1GM9A 1AJNA 3CSXA 1FD9A 4J11A 4NTYA 1G8MA 4GKKB 2QDOA 4KL1A 4JYAB 2Y4TA 2J7QC 1VQLV 3OVZA 3G4SV 1THEA 2KG7B 3CRQA 2UXCB 3K5NA 1MDWA 3BRCA 5JJJB 2VQFB 1TAEA 5KA5A 4AILC 1N36O 4YVAA 5KAFZ 1JA8A 3QSDA 4B3TB 4K8XA 1CV8A 5IT9N 1Y4HA 3UT5A 3SYAA 1AECA 1MNGA 1E79G 3ZHSA 1WP7A 3FYEB 5J2UA 1R3JC 2XAHA 1QBZA 1Q6IA 5H6RA 4MS2A 4PT5A 3BAAA 4YXWG 4DMYA 3KW9A 4QBBA 1TA8A 1WAZA 2N04A 5ITZB 5BR8B 4X20A 4JI1B 3CE2A 1HNWB 4OW0A 1EM1A 3TNXA 3H9VA 3SPJA 3CC7V 3RYHB 2Q0AA 4X64O 2BDLA 2UXDB 3MHSC 2X7RB 3BPMA 4LF7B 3K9AA 1AILA 4G2KA 1SZTA 3RYIA 2BSKB 5C8YB 4DR1B 1FS0G 2F1GA 3WXEA 4WF9V 5FLXN 1SQPH 4W5CA 3KFQA 4JI7O 1ZUQA 2CTPA 2X0LA 1M9NA 1I0HA 3K9MA 1FYJA 2Q7GA 4LF9O 3MORA 4TOIA 3HKDA 2PI5A 4U7NA 5BZBA 4JI8B 3E2EA 4YYSA 1KKDA 3OAAG 4YYRA 3FX7A 2JS3A 4QH6A 4UVCA 4DV7B 5B5EZ 4B3SO 1K4DC 3CBKA 2DQ3A 3K0GA 4G28B 3ASOB 3IV2A 4YYWA 3BBAA 4PDMA 2B9ZA 1KHQA 5BY1A 3OMNB 3W31A 2R9IA 4B7KA 4NKGB 5KMGA 3IC9A 2QKCA 2JK5C 1Y08A 2KB1A 2QWOB 2E76B 2H8PC 1AI5A 2X6CA 1AVMA 4DV3O 5IJ9A 5BXZA 1YVWA 2IW5A 1VQKV 5CHTA 3MP2A 3K0DA 1DEUA 1W0JG 1K8AW 2HVJC 4DR2O 4FLYA 3B79A 3E35A 1YDXA 1ZSPA 5LGTA 1O0EA 4FIPC 1PIPA 4PP1A 3ASOC 4PDRA 2P4KA 5KHJA 3X2QB 4RQFA 1HNXO 2JQGR 3B40A 5J2UB 4F6EA 4R50A 4MZSA 1OHHG 3PNRA 4LC1A 5A2QN 4IL6Z 1ZTEA 2YEVA 1M90W 3Q4HB 4IUMA 4OPHA 4UV9A 4GUNA 4YYUA 5A24A 2QEXV 3AG4B 4PJ0Z 4K8ZA 1M6DA 2B1GA 3W7UA 3CCLV 1U5IA 2PNSA 2JS5A 3N4CA 4O4IB 5C93A 2P5OA 2UXXA 3ZBHA 5L3DA 1GN4A 5JH3A 1HNZO 4UCRA 1GH6A 3JASB 3MTNA 1TVKA 3X2QC 4YHHB 4XR7A 4PA9A 3R66A 2D2CB 1EBOA 1GN2A 2DMXA 4N4ZA 3E1ZB 1EN6A 2F4VO 4FLZA 3B8MA 3HKDB 3TGUH 1H2MA 1Y66A 1KD1W 3AG4C 3ZCCA 2AUXA 4DK1A 1PM9A 4JI4B 2QE7G 1U9WA 2UXBB 2VQEO 1VQ8V 3QJ3A 4EFBA 4QPKA 4D7SA 2FRAA 3N27A 4FVMA 1WJZA 2KKWA 2DW4A 2YXLA 4DW0A 4UCSA 1W0KG 5KMGB 1D5AA 3DSQA 2ZDIA 1K7DA 4LFBB 4GX1A 5J9PC 1PCIA 4FJCA 3OEHG 4KP4A 4LCUC 4P9OA 2P86A 4LR3A 2UZJA 3TETA 4JZ2A 3CXCU 2P06A 2R6NA 3IOQA 3JATA 4LF5B 1A6RA 3C90A 1WPXA 4DUZB 4JTCB 4UV8A 3UCSC 5EF4A 2FB5A 2H94A 1N34B 1AR5A 1NKDA 4JAVA 4DR7B 2EZPA 2BTQA 1Q90D 2H7JA 1SESA 4PI2A 4MTFA 3OE7G 2G7YA 4IIJB 3ABLB 4TV9B 2GTAA 4I50B 4IP3A 3OTOO 3ZRWA 1V55B 4L8JA 3BPZA 4BW5A 4DV1B 2ATOA 3AI8A 3IC7A 3SJCC 4MSWC 2ODMA 1PKXA 4LF4O 4TQDA 2JGUA 2NLJC 2GV9A 4MTXA 1Y6XA 4DV0B 1NH2D 4D8BA 1O9GA 3B77A 2UUAO 1L1FA 1KMIZ 5F02A 5KUMA 2JJ2G 3ZMZA 3OEEG 4GKJB 1QR8A 3CMEV 4LWSB 4ZOLA 2W6IG 2C0YA 3N2GB 2M6YA 3J81N 3KKYA 3AG1B 3ABLC 5GTHZ 1HR0O 1VSNA 4PV1B 3APOA 3CWBH 4P16A 3GVMA 1V55C 3RVZA 4YJ2A 4HXDB 4DXWA 3L9DA 1U9XA 3FB8C 1AROP 1KFUL 4JV5B 1VQOV 1US6A 1MSWD 3VQVA 4EKWA 2UU9B 4MTOA 3PJSK 2F7DA 1IXBA 1VEWA 3B8NA 2JQFR 4I07A 3NXSA 5B1AB 3P5UA 2JRIA 1WNSA 1URFA 4LP8A 3D3IA 4OX9B 1YTFB 2WAMA 1GMYA 1FXHA 2FUDA 2RNBA 5LOVB 4YYVA 1AI6A 3CS5A 2E00A 5JVDB 3LSSA 2FMLA 3ABKB 2NQIA 4J7ZA 4BS6A 3AG1C 1CJLA 2CUGA 4H0LB 3H1IH 3RVXA 2GTSA 1NBMG 2R9OA 1CPYA 1ENVA 2GSMB 2CTQA 2XAFA 3HKCA 1PNMA 1YALA 3K5MA 3CJHA 4DV6B 3BY4A 4BOSA 2QWRB 3D36C 4FMTA 4DV2B 2DJGB 2OWOA 3EVKA 3W7XA 1EWOA 1I08A 5B1AC 1CTEA 3OD4A 2B1IA 1UJWB 3JATB 1GM8A 4I7ZB 2IM9A 1AP5A 1Z2GA 3ZRXA 1BHBA 1QHTA 4LH7A 1VJVA 2AZ2A 4DMXA 5EIBD 5IYCO 5LA6B 4EB6B 2XU4A 2DJVA 5CA3A 4WFBV 3OW2U 2BTQB 1U9QX 4REZA 4A5UB 3ABKC 4FFBB 1KECA 2G6DA 3OGCC 4FM0A 1XHZA 2A06H 3TK1A 1ME4A 2F43G 1YJWV 2JTCA 4RWUA 3E9SA 4F6RA 4I55A 3SPGA 1JCHA 1LR1A 2CH7A 2VHSA 3FAVA 5B1NA 4CBCA 3P30A 3WG7B 1BMFG 1MS6A 2ZM6B 4JASA 2ZR3A 3V6EA 5KX5B 4WFAV 1M4UA 4CC6A 3K9SA 3AEIA 2DZZA 4HWYA 1P84F 2HR3A 3DXRA 1Q8IA 3WU2Z 5IWAO 2NNUA 1IVSA 1NB5A 2OTLV 1XNRO 2ZIMA 4YJ2B 4OELA 1Q6HA 3H8BA 4GX5A 1ZCMA 3LDDA 1Q6KA 4O4LA 4R8CA 3BEHA 5J2TB 2GUZA 2UUBO 2IJKA 5L3EA 2Y6EA 5EZSA 2ZE7A 3VBBA 4FLWA 1XMOO 1COWG 3DC6A 1P7BA 4PA4A 4JI6B 3WG7C 3ZRSA 3AK3A 4AI8A 4H13B 3PW3A 1V9PA 3KWZA 3ETGA 2IBZH 1FH0A 4DR3B 1VQMV 1F29A 4J9ZB 4EEQA 3D8CA 4UXNA 1N33O 2A3QA 1KUQA 2AYOA 2XHBA 4XUIA 4NXNB 1POPA 4Q20A 1XNQB 2IJJA 4J10A 3L70H 2DOSA 2AUZA 3T1HB 1F7YA 1CS8A 4N79A 4LF8O 1VQNV 2ACTA 2LJ2A 4I04A 1K3EA 1VMGA 3CCVV 3K8UA 5DECA 1YHQV 3ABTA 1Y76A 1VP7A 1IBLB 2LW7A 1AYVA 5JWPA 1B06A 3CJHB 3ZHVA 4QRVA 4OXSA 1SERA 1S5JA 1KHPA 3C3SA 3RYCA 5L3CA 1OZ0A 1EF7A 2HJFC 3JARA 4J7JA 3UM7A 1DF0A 2ZR2A 5IYBO 3A0BZ 2RJZA 5KAIZ 3G71V 9PAPA 3J80N 1DTOA 2QWNB 4I4TB 4CS2A 4HNAA 2PYLA 2WLHA 2XAQA 3BA8A 3FFQA 2EX3A 1NTMH 5EBMC 3TCUA 5LP6A 3JD2A 3LSUA 4JI5O 4CS3A 5D5QA 4AQYB 1IBKB 1DLBA 1IX9A 1NZ6A 3JD4A 4CH3A 4RNAA 2RDCA 2R9NA 3ETEA 4J80A 3ZRVA 3BHPA 4DR6B 2EJRA 1XHXA 4XBFA 1QOLA 3IGAC 3RYFB 1S5HC 3FAVB 2LFRA 5IJ0A 2Q5ZA 1CEZA 5B1BB 4XDLA 1IBMO 4CZZA 4WURA 3HB3B 2R9CA 4KLBA 1OCRB 2OYQA 1FJGO 5CB4B 4X62O 1F2CA 3DXRB 4DV5O 2LO1A 2B5UA 1QCEA 1P4RA 2OZ2A 5EBLC 3AK2A 2L6LA 5EK0A 1JVMA 2L35A 1FXKA 3R65A 3B4SA 3T1YO 2ZNIA 2PZSA 3P5XA 3H1HH 1ZIVA 1L8DA 4UB8Z 1XMQB 4BIOA 4B3MB 2A7WA 4CDFB 4H44B 5KHKA 2DC8A 5B1BC 5K1PA 5HFMA 1SQBH 2PREA 5KO3A 3JAMN 1OCRC 4GKKO 1Q5OA 3CC2V 2YJBA 2Q68A 4ZUXU 5LMUB 3H6SA 2F93B 4B7EA 4BWAA 5LXTB 2AS8A 5GTIZ 3D6SA 1HUCB 2UXCO 4XZXA 2BTOA 2QTSA 3QVNA 3W7TA 2VQFO 5LMNO 1K73W 3VQXA 4YY3B 1XL4A 2WA4A 3EXAA 4B3TO 1ME3A 2YJ9A 5LYJB 1Y76B 3O9OA 5L3GA 1VF7A 1AIMA 5EYPB 4W4KA 3RYCB 3V6CA 2O57A 1RFYA 4I05A 4JPRA 1YXBA 4IHJA 1FFTB 2HKOA 3JSLA 1TL9A 4X66B 5BR8O 4JI1O 2KQXA 2UUCB 1HNWO 3U10A 2Q6AA 1N32B 4JAUA 3T4DA 3OMAB 3HKBB 1THZA 1NVPB 2AW9A 1NTZH 2UXDO 4TSFG 1H2LA 3WB0A 4XDJA 2Y5BA 4I0XA 1K92A 2WLNA 4LF9B 5KLVH 2E03A 1KBHA 5LP6B 1CQDA 3AG7A 4LF7O 1GLOA 3PRPA 3HD3A 1NT2B 4FZ1A 3IHPA 1CSBB 1JX9A 1R1BA 2PBHA 3H89A 2FTKA 3ZHTA 3IJ4A 3K5LA 1UPGA 5KA6A 3USVA 2Q0OC 1WB8A 3GWKC 4JGSA 4GUAA 4DUYB 2ZINA 2HEPA 5CA0B 1QMYA 5IJ0B 1VQ7V 4ZKIA 3CCMV 5K1XA 2PYJA 5J94A 4CDCB 1TGOA 3CBJA 3CX5F 4P2ZA 4JI0B 4WCEV 4JI8O 3N3KA 1YK7A 4ABMA 2YXHA 4QJFB 4WBNA 3ZNHA 4MVRA 1J95A 4HZ3A 3GWOA 3KKUA 4FK5A 4MSXA 2G8JA 2XNDG 1Y67A 4AXLA 3SPIA 4DW1A 5LP6C 1YI2V 1VF6C 1Q43A 4DV7O 4DK0A 3ETQA 1M57B 2XAJA 5PADA 4MVUA 1S0VA 4OPAA 4DR2B 2CB5A 3RVYA 1NJIW 2LGWA 3LDCA 3SYCA 1AU4A 2ARYA 1RP3B 4K7CA 3PHWA 2FTDA 4O2AA 4Z1MG 3JAWA 4NVPA 1AYWA 3QT4A 1H2KA 3T1CA 1FAFA 4FLXA 1DF5A 3OR6C 4KFMA 3FKSG 3UT5B 4RQEA 2P0RA 2Q9LA 2BCCH 2QTOA 4Z1VA 4IYHA 1I5YA 2FYUH 1R3KC 3O1GA 2P90A 3RT3C 4MT8A 1ZX3A 4HYOA 1K97A 3ZHQA 1G4YB 4X20B 1VIBA 1M57C 3H1JH 2YIBD 1I7FA 3UO3A 1K34A 1JPXA 1CXZB 3DTUB 4YIOA 2EIMB 4N8WA 1AU0A 1STFE 4PD4F 3H1LH 1AR4A 1JFFA 1XL6A 4NR1A 3RYIB 3AK1A 3CCEV 3UQ8A 1VQ4V 1KXRA 5CHVA 1I5XA 1LUVA 2GHYA 3MD0A 4IHJB 2Z0AA 4JYCA 3DC5A 2YDEA 3E8FA 3CC4V 1YF2A 2BTWA 2QWPB 4D7TA 4QE9A 1QVFU 3W7SA 1AB3A 4LNUA 2YJ8A 1KB9F 4I0XB 2JEXA 2Y0IA 5DN6G 2N74A 4X1IA 1XBLA 4ZI7A 1NLJA 4O4HA 1SKVA 2CE4A 5CBFA 2DC9A 4R3DA 4PDLA 5CN0A 4U3JA 3OUFA 1X59A 1PXVA 3F75A 4PDVA 5JJNB 2EIMC 3CYOA 4MVZA 4YHHO 1HP8A 4OVZA 1X4TA 1QLEB 1HW7A 2D3OW 4UFZA 1MZFA 1S77D 3M8AA 1IWDA 3C9EA 5DEDA 2IPPB 3DGEA 1XOUA 1UKFA 2QJ1A 4X8AA 2IH1C 3P5WA 1R3IC 5F2VO 4JAAA 1SQFA 1PD3A 2ZE8A 5H9CA 3F5TA 4JI4O 1Q3EA 1F4MA 1PNLA 3LDEA 3TRKA 1SC5B 4GX2A 2UXBO 4X1YA 1YITV 3K5OA 5IJ9B 2A9HA 1J5EB 3GCBA 2PADA 1EWLA 1N0JA 3K03A 4DR4O 4PA7A 3WFVA 4BW9A 5LGUA 3I56V 1FPOA 1K5SA 2UXNA 4N21A 1QLEC 2N05A 3QO5A 3ZIAG 1LUWA 1SQGA 3T4ZA 1MOFA 3I5DA 3K79A 4LFBO
chains in the Genus database with same CATH topology
3B21A 4BOPA 3E9SA 4JYAO 3R66A 4JI0O 4JI6O 3MJ5A 3PHUA 5LL6Y 4ZTBA 5BR8O 4LF5O 5JZEA 2F4VO 4JI1O 4D8EA 3J81N 4DUZO 1R6TA 4DR3O 4JI5O 1HNWO 2BU3A 1XMQO 3W30A 4B3MO 1HR0O 2ZKOA 1YZBA 1A32A 1N34O 4B3SO 4NXMO 4RNAA 4DV6O 4P16A 4DR7O 2Z84A 2UXDO 4DV2O 4NXNO 4D8IA 5EZQA 3J7AU 1XNQO 4HXDB 2FE8A 3BBAA 1D2DA 3MTVA 2Z0AA 3C0RA 4LF7O 3PRPA 3T1HO 5LMUO 5BY1A 2BTWA 3W31A 2J7QC 5IWAO 4MM3B 4B3RO 4DV1O 1R1BA 2VQEO 1IBLO 1AB3A 1J5EO 1IBMO 1XNRO 4WURA 2JRIA 1N36O 4YY3O 4GUAA 4DV3O 1DK1A 1FJGO 4X62O 5BXZA 2N74A 4DV0O 1FKAO 4LF6O 4DV5O 2BTWB 3MP2A 2UUBO 5IT9N 4R3DA 4A5UA 5EZSA 4BOUA 1X59A 4DR2O 1XMOO 1I94O 4K0KO 4GKJO 2J7QA 4DV4O 4JI3O 4YHHO 4OVZA 4PT5A 3OQCA 1DKIA 3PRMA 2UZJA 4JI8O 4M0WA 4DR1O 4BOQA 3ZNHA 3T1YO 1PVJA 2HWKA 2HHHO 3M8AA 3PT2A 4BOZA 4X66O 4DR5O 3O65A 5H5NA 2UUCO 4OW0A 3TMPA 1HNXO 4X65O 3PHXA 1N32O 4KHPO 1UKFA 3PSEA 4DV7O 4RKXA 1N33O 1IBKO 2ZM6O 4JI2O 3BY4A 4X64O 1KUQA 4RF1A 4BOSA 4MI7A 5A2QN 4OPAA 5KO3A 4DR6O 3JAMN 2DOSA 4JI4O 3F5TA 4GKKO 2E5LO 4JV5O 3TRKA 1AILA 1F7YA 3BB7A 2UU9O 4LF8O 3PHWA 4IUMA 4OPHA 4IP3A 3SDLA 3OTOO 2UXBO 1XEQA 2LW7A 2UXCO 3RNVA 4XZXA 2FKXA 5E6JA 2DJVA 4RF0A 5FLXN 2VQFO 4DR4O 4LFAO 5LMNO 3IFUA 4A5UB 1G1XB 4REZA 4DUYO 4OX9O 4LFCO 4JI7O 4LF4O 4B3TO 4AQYO 4D8BA 4OVZB 2UUAO 1FYJA 2AGAA 1NS1A 3J80N 4LFBO 3RT3C 4LF9O 1HNZO 2JTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA O;  3R66 A;  4JI0 O;  4JI6 O;  5LL6 Y;  5BR8 O;  4LF5 O;  2F4V O;  4JI1 O;  3J81 N;  4DUZ O;  1R6T A;  4DR3 O;  4JI5 O;  1HNW O;  1XMQ O;  4B3M O;  1HR0 O;  2ZKO A;  1YZB A;  1A32 A;  1N34 O;  4B3S O;  4NXM O;  4DV6 O;  4DR7 O;  2UXD O;  4DV2 O;  4NXN O;  3J7A U;  1XNQ O;  1D2D A;  2Z0A A;  4LF7 O;  3T1H O;  5LMU O;  5BY1 A;  5IWA O;  4B3R O;  4DV1 O;  1R1B A;  2VQE O;  1IBL O;  1AB3 A;  1J5E O;  1IBM O;  1XNR O;  2JRI A;  1N36 O;  4YY3 O;  4DV3 O;  1DK1 A;  1FJG O;  4X62 O;  5BXZ A;  2N74 A;  4DV0 O;  1FKA O;  4LF6 O;  4DV5 O;  2UUB O;  5IT9 N;  1X59 A;  4DR2 O;  1XMO O;  1I94 O;  4K0K O;  4GKJ O;  4DV4 O;  4JI3 O;  4YHH O;  4JI8 O;  4DR1 O;  3T1Y O;  2HHH O;  3M8A A;  4X66 O;  4DR5 O;  3O65 A;  5H5N A;  2UUC O;  1HNX O;  4X65 O;  1N32 O;  4KHP O;  4DV7 O;  1N33 O;  1IBK O;  2ZM6 O;  4JI2 O;  4X64 O;  1KUQ A;  5A2Q N;  4OPA A;  4DR6 O;  3JAM N;  2DOS A;  4JI4 O;  3F5T A;  4GKK O;  2E5L O;  4JV5 O;  1AIL A;  1F7Y A;  2UU9 O;  4LF8 O;  4OPH A;  3SDL A;  3OTO O;  2UXB O;  1XEQ A;  2LW7 A;  2UXC O;  2FKX A;  2DJV A;  5FLX N;  2VQF O;  4DR4 O;  4LFA O;  5LMN O;  4A5U B;  1G1X B;  4DUY O;  4OX9 O;  4LFC O;  4JI7 O;  4LF4 O;  4B3T O;  4AQY O;  2UUA O;  1FYJ A;  2AGA A;  1NS1 A;  3J80 N;  4LFB O;  3RT3 C;  4LF9 O;  1HNZ O; 
#chains in the Genus database with same CATH topology
 2HG5 C;  2R9A A;  4PEL A;  3JAK A;  2LP7 A;  4BS5 A;  2B1N A;  4CDE B;  4QGP A;  4LF5 O;  4DUZ O;  1KFX L;  3U8E A;  3CP1 A;  2LQT A;  1BGY H;  2ZKO A;  2YEV B;  1N34 O;  2OUL A;  4JI2 B;  4DR7 O;  4TT3 G;  1EZV H;  4FLT A;  3L75 H;  2QKA A;  3FB5 C;  3ZMS A;  4MVO A;  2Q7H A;  4DV1 O;  1AYU A;  1JFF B;  3HWN A;  3L71 H;  1K5Q A;  3RBZ A;  3SPC A;  3VQW A;  1BQ0 A;  1NQC A;  1MSD A;  4DV0 O;  3N2K A;  1FKA O;  1TVK B;  4CDD B;  2BTW B;  1OJH A;  2FYE A;  1PBH A;  4LNU B;  2MW2 B;  4GKJ O;  4RAI A;  1KC8 W;  2FO5 A;  2HJD A;  1VQP V;  3OQC A;  4E2L A;  3E8B A;  1TUE B;  1EN5 A;  4JYB A;  4X1I B;  4ZI7 B;  4BOQ A;  1RPR A;  4O4H B;  5CMU A;  2JEU A;  4C7U A;  2RCV A;  4ASU G;  4FFK A;  3T2M A;  1KQS U;  1BS3 A;  1H8E G;  2BE3 A;  2XAG A;  4UCU A;  2IJI A;  4MI7 A;  4UCT A;  4P6G A;  1WN7 A;  1QR9 A;  4JV5 O;  2IJH A;  1O9H A;  2UU9 O;  3ERV A;  5LHI A;  2QWQ B;  4B3R B;  4HBN A;  2BOC C;  3HHI A;  2FL4 A;  1ZWI C;  4X1K A;  1X9Y A;  4RF0 A;  3S3Q A;  3S3R A;  1G1X B;  4PA3 A;  3KG2 A;  4OX9 O;  1ATK A;  4MTG A;  4LF6 B;  1MEG A;  4YIP A;  2CGN A;  4O4J A;  2Z3Y A;  1Y74 A;  4JTA B;  2HLD G;  2ZE5 A;  3OR7 C;  4X1Y B;  2DC6 A;  2WLL A;  2HFE C;  4FLV A;  1K9M W;  4DV4 B;  2FT2 A;  5FPR A;  4UVB A;  1Y4M A;  5FNV A;  1JQP A;  1H2G A;  2X6A A;  3MJ5 A;  4TUY A;  5KHG A;  1PPO A;  2EUL A;  4PI0 A;  1SZX A;  1S5L Z;  1ICF A;  4DR5 B;  5CA1 A;  5JZE A;  2P6J A;  2ILM A;  4X65 B;  3W30 A;  4KHP B;  3H01 A;  1TU6 A;  2FQ9 A;  3I06 A;  1AU2 A;  4YJ3 A;  4DV6 O;  1R73 A;  2Z84 A;  1RM1 B;  4DV2 O;  4D6T H;  5CVN B;  5EGW A;  3JAK B;  1RSO A;  1N4C A;  3B09 A;  2AHY A;  2ATK C;  4RUF A;  3KCY A;  5D5P A;  3ZRW B;  5JCO A;  4I5S A;  3F5V A;  1XDC A;  4IGG A;  3SPH A;  4QE7 A;  2OT5 A;  1NI8 A;  5FPW A;  2BOB C;  2ZDI C;  3E89 A;  2OIE A;  2PGG A;  4KUM A;  3LSQ A;  5B1O A;  3W7W A;  4IT5 A;  4FJC C;  2ARH A;  4J41 A;  1QDQ A;  3PBH A;  2O6X A;  4W4L A;  1QU7 A;  5LHG A;  2YIA A;  4F4L A;  3ASN B;  4ZOL B;  4QRG A;  3CCR V;  1F23 A;  2J7Q A;  4WFE A;  5LBQ A;  2IU3 A;  4QNH B;  1BL8 A;  5TIS Z;  2QA4 V;  4M0W A;  1JJ2 U;  1VAR A;  2NN4 A;  1RM1 C;  1PVJ A;  2HWK A;  3PT2 A;  4BOZ A;  5E79 Z;  1PP9 H;  1K4C C;  1SQQ H;  3G80 A;  3JD1 A;  5H5N A;  3S3X A;  1BZK A;  5EC1 C;  5JH7 A;  1AU3 A;  2QM7 A;  4CH4 A;  2ZM6 O;  3IAY A;  2E02 A;  4RF1 A;  2ITC C;  4I9W A;  3KZI Z;  3ZX6 A;  1VQ9 V;  2XU5 A;  4TQF A;  4FPP A;  1M56 B;  1ZL8 A;  1NR1 A;  4IYI A;  3CXH F;  2K9P A;  3CRM A;  1BHA A;  3JSN A;  1WA8 A;  4N23 A;  4P9P A;  1Q7Y W;  1JR9 A;  2ADQ B;  2YS8 A;  3CRR A;  3MHS A;  3ZHR A;  1BT8 A;  5JJE B;  2OP3 A;  2NQA A;  3RVW A;  1T5E A;  2JVD A;  4TWK A;  4K0K B;  2XTA A;  2Z5U A;  3RN4 A;  1AJQ A;  4X1K B;  2XAS A;  2V4D A;  4PHZ A;  4JI6 O;  4BR6 A;  3HKC B;  1GK9 A;  1QLN A;  3CCU V;  4ZTB A;  3A0H Z;  2HHH B;  1N0N A;  3LFY A;  2VS0 A;  1DF4 A;  2LW1 A;  4AXM A;  1Y74 B;  3QTC A;  4D8E A;  2CTW A;  4DR3 O;  1NU1 H;  1M56 C;  3MDS A;  4H37 A;  4AHC A;  2EBO A;  5ITZ A;  4NXM O;  3I3T A;  5K16 A;  5FNV B;  2Q7E A;  4NXN O;  1WLE A;  2AZ0 A;  3MHH A;  1DGS A;  1XNQ O;  4QPJ A;  2PTM A;  2QR4 A;  3ETD A;  3C0R A;  3RYH A;  3L73 H;  2E5L B;  5CA1 B;  3T1H O;  2VHF A;  1K3B B;  3ABU A;  3K59 A;  4OEM A;  2ZE6 A;  3PDF A;  1IBL O;  1OCO B;  4YJ3 B;  1H2N A;  4OGQ B;  3SGI A;  1RSO B;  4CH5 A;  1XQ8 A;  5E1A C;  5KUK A;  4MVS A;  4LFA B;  5C8Y A;  3CB2 A;  3IEJ A;  4LFC B;  2GFO A;  4CZW A;  1GMG A;  2WBF X;  1AJP A;  2Y69 B;  4F6R B;  4I55 B;  4P6E A;  1GCB A;  2K1E A;  5LGN A;  2M7W A;  1I94 O;  3AG2 B;  3LNN A;  4JI3 O;  1Z5V A;  2CH7 B;  2PY5 A;  1DKI A;  2IH3 C;  2WLM A;  1IBM B;  2LFS A;  1TUB A;  4J42 A;  3BWK A;  3SYO A;  1SF9 A;  1U9V A;  1U97 A;  2ZQM A;  1U96 A;  4JYY A;  2XT9 A;  4FLU A;  1IBK O;  3ZN1 A;  1YIJ V;  4ZBM A;  3NR7 A;  1OCO C;  1KKC A;  2PUS A;  1S76 D;  1KU9 A;  1MIR A;  1PPN A;  4DR6 O;  1FXV A;  4FIP A;  2P7T C;  3BB7 A;  4GYC B;  5JCO C;  1R3L C;  1BQI A;  5JH7 B;  3K04 A;  4G54 A;  4O4L B;  1ITO A;  2Y69 C;  1BE3 H;  2F23 A;  2GUZ B;  3VOU A;  3BPF A;  1N36 B;  2P67 A;  3IFU A;  3AG2 C;  2Q73 A;  1PPJ H;  3STZ C;  4W5B A;  2DWD C;  3F5W C;  1ZL8 B;  4K3A A;  3CRA A;  3F7V C;  4BSQ A;  4FM1 A;  1WA8 B;  4JF3 A;  3S3W A;  1S4V A;  3ZJZ A;  4JYA O;  5L3F A;  2DQ0 A;  3ABM B;  3BCN A;  4CC5 A;  4UB6 Z;  3WB2 A;  2XUM A;  1R6N A;  2DCC A;  5LMN B;  2E3C A;  2CTR A;  1EWM A;  1MG1 A;  1XMQ O;  4B3M O;  3ZED A;  3SYQ A;  2Q4P A;  2EIL B;  1M93 A;  4WFH A;  4X64 B;  4D8I A;  2YID A;  2V7Q G;  2R9M A;  1KYO F;  4LH6 A;  1GO3 F;  5LMU O;  3OUS A;  3CPW U;  4X9Q A;  3FB6 C;  1VQ6 V;  3JAR B;  3BA9 A;  3Q4H A;  4RUE A;  3HR0 A;  2WLI A;  3FD9 A;  3QO8 A;  4YY3 O;  4Q6G A;  3LNM B;  4JI7 B;  1NVP D;  1PPD A;  2YIB A;  4WFG A;  3ABM C;  1VQ5 V;  3QG5 A;  1MZE A;  4HNA B;  1YCI A;  3EHB B;  4O4I A;  2EIN B;  3D3Q A;  2WLK A;  1WP8 A;  1MMM A;  2JIZ G;  5A9G A;  5B3S B;  4U7O A;  4PP2 E;  3K58 A;  3CH2 X;  4I9Q A;  2EIL C;  5IE9 A;  4UUJ C;  4DR1 O;  5EBW C;  2RMK B;  3JAS A;  7PCK A;  1BCC H;  2DYS B;  4X66 O;  5IYD O;  2UUC O;  1YVB A;  2WA3 A;  3PHX A;  1N32 O;  2Q67 A;  1QQC A;  4B3S B;  2DJF B;  2GBO A;  2VWJ A;  2F1M A;  2B1M A;  4MVQ A;  4BQV A;  2R70 A;  2JJ1 G;  1TUB B;  3MHH C;  2AYN A;  2LGQ A;  4TV8 A;  2F66 C;  3LUT B;  1BY8 A;  1AR1 B;  4O2B A;  2C2A A;  2EJ7 A;  4GT1 A;  2Y0P A;  2EIK B;  1WPB A;  2EIN C;  1NPZ A;  2IU0 A;  4DUY O;  4DV3 B;  5B3S C;  6PAD A;  5AG2 A;  1LNQ A;  2QKS A;  3M99 A;  4MVM A;  1VF5 B;  1FXK B;  3WB1 A;  2DYS C;  4R7C A;  3ICX A;  1XUQ A;  3B21 A;  4BOP A;  2IBI A;  1RPO A;  4JI0 O;  4U3F H;  1SS3 A;  4CH6 A;  1R6K A;  1NB3 A;  3TJT A;  5LL6 Y;  4RO2 A;  3K57 A;  5CBG A;  3P3N A;  2G38 A;  4ZHQ A;  3OM3 B;  1HNX B;  3SJB C;  2BU3 A;  1PL4 A;  1CP9 A;  1L0L H;  1KP2 A;  4GLX A;  1SRY A;  2ZCE A;  3OTF A;  2W0X A;  4DRX A;  3TXS A;  3E83 A;  5CVO B;  2ZXW B;  4B08 A;  3GB7 C;  3NHE A;  2EIK C;  2PF4 E;  1P7G A;  2E74 B;  1WB7 A;  3JAL A;  3OFN G;  3OF8 A;  4IIJ A;  4TV9 A;  1GKF A;  4I50 A;  1FXK C;  1V54 B;  3CRC A;  4CS4 A;  5IY5 B;  3SJQ C;  1OCZ B;  3K3W A;  4MW8 A;  1JJO A;  5H6Q A;  1PPP A;  4BOU A;  1HNZ B;  2ZD9 A;  4P30 A;  1NR7 A;  2WLI B;  1GTO A;  1M1K W;  3L74 H;  2JGD A;  3JYC A;  4YYQ A;  4LWS A;  4QRX A;  3O65 A;  2F4V B;  4WA6 A;  2ZXW C;  2CGO A;  2GDS A;  2A79 B;  2WSS G;  1FFX A;  1BGO A;  3N2G A;  1YJN V;  2ITD C;  2EIJ B;  3A8T A;  2HVK C;  1GN6 A;  4G27 B;  4FZ0 A;  1NL6 A;  1NQT A;  1V54 C;  5JQG A;  3CCJ V;  3F7Y C;  2F95 B;  5IY5 C;  1F4N A;  2VQE B;  1OCZ C;  1G6U A;  1NTK H;  1AI4 A;  2YSU B;  5E6J A;  1IXM A;  2AVW A;  3D36 A;  3QNE A;  1PL0 A;  4PI3 A;  2MK3 A;  4PA6 A;  4TV8 B;  1GM7 A;  4E4E A;  1GRJ A;  3H1K H;  4O2B B;  4WFF A;  3STL C;  2DCD A;  4WBN B;  5LOV A;  1KP3 A;  4UCV A;  3RVV A;  3BFR A;  2RN9 A;  5B66 Z;  3P3P A;  3P5V A;  2EIJ C;  3E22 A;  3RWR D;  5JVD A;  3M99 B;  4DO2 A;  3BVO A;  4DR4 B;  4JTD B;  2W6J G;  1SNK A;  4Q8H A;  3G6E V;  5EZQ A;  2CAZ C;  1D5N A;  5GON A;  4O2A B;  1EWP A;  2PI4 A;  3JAW B;  1D2D A;  2P4V A;  2YJ2 A;  3MTV A;  1IUR A;  1HDJ A;  4ZHQ B;  2YJC A;  2OTJ V;  1MA1 A;  3CH3 X;  1S3J A;  3OTO B;  1QVG U;  5GW7 A;  4J9Y B;  4MM3 B;  3E8G A;  2ETN A;  3C3T A;  1S72 V;  1QXP A;  1J5E O;  2CIO A;  1XRE A;  2OCH A;  3ZUA A;  3G67 A;  3CCS V;  3PN1 A;  4JZG A;  3CEI A;  4DRX B;  3N3G A;  5EZY A;  2HH5 A;  2H3O A;  4FK5 C;  4LF4 B;  2QSA A;  5LA6 A;  4MZO A;  4EB6 A;  5KHI A;  2ZT9 B;  3JAL B;  2UUA B;  1CB5 A;  3DF0 A;  4A5U A;  2RQ6 A;  4FFB A;  1JMK C;  2YI9 A;  3KWB X;  2VWK A;  1EN4 A;  3PRM A;  1H38 A;  3TXQ A;  3TMP A;  1XI1 A;  3JD0 A;  1HR0 B;  4GCZ A;  2YXY A;  2YUA A;  1BSM A;  4JI2 O;  1NH2 B;  1Q6U A;  2CDY A;  2JGD B;  4EFE A;  4MW3 A;  3RW0 A;  5KX5 A;  3SDL A;  3RFR A;  1MHW A;  1FFX B;  2AHZ A;  1ZLZ A;  4W4U A;  1F51 A;  4J7K A;  3QO7 A;  4XDK A;  3RNV A;  2VRZ A;  2FKX A;  3KCX A;  5IDJ A;  5JA7 A;  1M5I A;  1AI7 A;  2DWE C;  2R9R B;  4U3J B;  1IZ3 A;  2E75 B;  2ZNJ A;  3K08 A;  2JDI G;  4HAM A;  3UKM A;  3CMA V;  1YTF D;  2DZY A;  2QM8 A;  5JQG B;  3WXG A;  2V1D A;  4OVZ B;  3CHX A;  2AGA A;  5J2T A;  2AU1 A;  2DN9 A;  3PHU A;  3ZMT A;  2GHU A;  3SYP A;  1MAB G;  2YC0 A;  2KSD A;  3U11 A;  1QNM A;  4ICG A;  1R6T A;  2FRQ A;  1IDS A;  2DYR B;  1YEW A;  3H8C A;  3OVX A;  1GN3 A;  1AP6 A;  5LHH A;  1JQ0 A;  3E22 B;  5L3B A;  8PCH A;  1GAX A;  1ZAU A;  1EZJ A;  4H33 A;  1CPJ A;  4B3R O;  3KSE A;  2G8E A;  2AIM A;  4X88 A;  5GON B;  1ORQ C;  3L72 H;  1GEC E;  4X6H A;  4LF6 O;  4QIW F;  1B6Q A;  3HPL C;  1W59 A;  1P49 A;  2HD5 A;  3CD6 V;  3BOW A;  4RY2 A;  3ZMU A;  4LBE C;  3JCU Z;  1H8H G;  4DV4 O;  2Q69 A;  1MEM A;  2QGN A;  4X89 A;  1BP4 A;  2DYR C;  3E8H A;  5H2F Z;  5EZY B;  1Q81 W;  3APQ A;  4I4T A;  4DR5 O;  3QF7 A;  2ADP A;  3LXS A;  1E1R G;  3HKE A;  4X65 O;  1OV9 A;  4RKX A;  3ML0 A;  4K35 A;  4KHP O;  3PSE A;  1PAD A;  2R9F A;  3G6B A;  1CVZ A;  4UCO A;  1Q82 W;  4BAY A;  4R6Z A;  3U0Z A;  3WXF A;  1SA0 A;  1Z5W A;  2Y48 A;  4GX0 A;  4L87 A;  5KHH A;  3ZN0 A;  5IYZ A;  3JD3 A;  1Q86 W;  4FM2 A;  4BIZ A;  5IWA B;  2NQD B;  1SP4 B;  4X6J A;  2CK3 G;  3MAQ A;  1JOY A;  3BY6 A;  3N2K B;  1XNR B;  3P32 A;  1PNK A;  4UVA A;  3RYF A;  5EC2 C;  1F2A A;  1B3Q A;  3H7D A;  3EFF K;  1EFR G;  5BMV A;  2UUB B;  3AG3 B;  4NB5 A;  1XMO B;  5EIB C;  5CB4 A;  2WWW A;  2QM4 A;  3B2E E;  1SET A;  3FB7 C;  3K06 A;  2HP8 A;  3ASN C;  2YI8 A;  4KXR A;  3VQY A;  3IFX A;  4NYK A;  5CVM A;  4X6I A;  1L0N H;  5FPO A;  1N33 B;  3K24 A;  3RGB A;  3I55 V;  4YV8 A;  2KG7 A;  2W0F C;  3ZHU A;  3J7A U;  2FE8 A;  3M7M X;  4NTW A;  3THO A;  2DCB A;  3CCQ V;  2P22 C;  2WLJ A;  4LF8 B;  4PAD A;  4BPV A;  1YJ9 V;  3SJA C;  4Q8G A;  3UO2 A;  2OCC B;  3AG3 C;  3OT7 A;  5CBH A;  1F2B A;  4O4J B;  3HHA A;  5LXT A;  2E01 A;  2BDZ A;  2WLL B;  1DK1 A;  4NXM B;  1B04 A;  3ZS8 C;  4TUY B;  1E1Q G;  1ROP A;  4K0K O;  2NR5 A;  5DM6 V;  5LYJ A;  4GZR B;  3A2F A;  2DE0 X;  2WPD G;  3OMI B;  3E86 A;  4BIU A;  1PV0 A;  2DCA A;  5EYP A;  2HHH O;  3O0U A;  1YT7 A;  1BQZ A;  2Q8V A;  4JI5 B;  3BC3 A;  1OCC B;  2BSK A;  1SQV H;  3OGI B;  1K33 A;  4DYL A;  4ZIB A;  1N8R W;  2OIG A;  2HXZ A;  2AXT Z;  3BCC H;  2XU3 A;  1PE6 A;  2OCC C;  1I94 B;  1H2S B;  3KX1 A;  3HKB A;  4JI3 B;  2E5L O;  2X6B A;  2ZIO A;  3HKE B;  2NQG A;  1XEQ A;  3BAB A;  2XU1 A;  1VF6 A;  4Z2W A;  1SA0 B;  4LFA O;  2DC7 A;  1HWY A;  1YK8 A;  1TLO A;  4LFC O;  1FJG B;  4X62 B;  5IYZ B;  4NTX A;  3OIS A;  2A0L A;  4AQY O;  2P7U A;  5HFL A;  4DV5 B;  3JCZ A;  1NS1 A;  3SR2 C;  5CA0 A;  1OCC C;  3IMA A;  5FL7 G;  3ZMV A;  3T1Y B;  5BMV B;  1UFI A;  2R72 A;  2XOK G;  1SQX H;  2YIC A;  1XKG A;  2Y4U A;  1YZB A;  1A32 A;  3FYI B;  3OF9 A;  1W2B U;  1YSC A;  2HHN A;  3A0R A;  1XIL A;  2EZO A;  3IUT A;  1GM9 A;  1AJN A;  3CSX A;  1FD9 A;  4J11 A;  4NTY A;  1G8M A;  4GKK B;  2QDO A;  4KL1 A;  4JYA B;  2Y4T A;  2J7Q C;  1VQL V;  3OVZ A;  3G4S V;  1THE A;  2KG7 B;  3CRQ A;  2UXC B;  3K5N A;  1MDW A;  3BRC A;  5JJJ B;  2VQF B;  1TAE A;  5KA5 A;  4AIL C;  1N36 O;  4YVA A;  5KAF Z;  1JA8 A;  3QSD A;  4B3T B;  4K8X A;  1CV8 A;  5IT9 N;  1Y4H A;  3UT5 A;  3SYA A;  1AEC A;  1MNG A;  1E79 G;  3ZHS A;  1WP7 A;  3FYE B;  5J2U A;  1R3J C;  2XAH A;  1QBZ A;  1Q6I A;  5H6R A;  4MS2 A;  4PT5 A;  3BAA A;  4YXW G;  4DMY A;  3KW9 A;  4QBB A;  1TA8 A;  1WAZ A;  2N04 A;  5ITZ B;  5BR8 B;  4X20 A;  4JI1 B;  3CE2 A;  1HNW B;  4OW0 A;  1EM1 A;  3TNX A;  3H9V A;  3SPJ A;  3CC7 V;  3RYH B;  2Q0A A;  4X64 O;  2BDL A;  2UXD B;  3MHS C;  2X7R B;  3BPM A;  4LF7 B;  3K9A A;  1AIL A;  4G2K A;  1SZT A;  3RYI A;  2BSK B;  5C8Y B;  4DR1 B;  1FS0 G;  2F1G A;  3WXE A;  4WF9 V;  5FLX N;  1SQP H;  4W5C A;  3KFQ A;  4JI7 O;  1ZUQ A;  2CTP A;  2X0L A;  1M9N A;  1I0H A;  3K9M A;  1FYJ A;  2Q7G A;  4LF9 O;  3MOR A;  4TOI A;  3HKD A;  2PI5 A;  4U7N A;  5BZB A;  4JI8 B;  3E2E A;  4YYS A;  1KKD A;  3OAA G;  4YYR A;  3FX7 A;  2JS3 A;  4QH6 A;  4UVC A;  4DV7 B;  5B5E Z;  4B3S O;  1K4D C;  3CBK A;  2DQ3 A;  3K0G A;  4G28 B;  3ASO B;  3IV2 A;  4YYW A;  3BBA A;  4PDM A;  2B9Z A;  1KHQ A;  5BY1 A;  3OMN B;  3W31 A;  2R9I A;  4B7K A;  4NKG B;  5KMG A;  3IC9 A;  2QKC A;  2JK5 C;  1Y08 A;  2KB1 A;  2QWO B;  2E76 B;  2H8P C;  1AI5 A;  2X6C A;  1AVM A;  4DV3 O;  5IJ9 A;  5BXZ A;  1YVW A;  2IW5 A;  1VQK V;  5CHT A;  3MP2 A;  3K0D A;  1DEU A;  1W0J G;  1K8A W;  2HVJ C;  4DR2 O;  4FLY A;  3B79 A;  3E35 A;  1YDX A;  1ZSP A;  5LGT A;  1O0E A;  4FIP C;  1PIP A;  4PP1 A;  3ASO C;  4PDR A;  2P4K A;  5KHJ A;  3X2Q B;  4RQF A;  1HNX O;  2JQG R;  3B40 A;  5J2U B;  4F6E A;  4R50 A;  4MZS A;  1OHH G;  3PNR A;  4LC1 A;  5A2Q N;  4IL6 Z;  1ZTE A;  2YEV A;  1M90 W;  3Q4H B;  4IUM A;  4OPH A;  4UV9 A;  4GUN A;  4YYU A;  5A24 A;  2QEX V;  3AG4 B;  4PJ0 Z;  4K8Z A;  1M6D A;  2B1G A;  3W7U A;  3CCL V;  1U5I A;  2PNS A;  2JS5 A;  3N4C A;  4O4I B;  5C93 A;  2P5O A;  2UXX A;  3ZBH A;  5L3D A;  1GN4 A;  5JH3 A;  1HNZ O;  4UCR A;  1GH6 A;  3JAS B;  3MTN A;  1TVK A;  3X2Q C;  4YHH B;  4XR7 A;  4PA9 A;  3R66 A;  2D2C B;  1EBO A;  1GN2 A;  2DMX A;  4N4Z A;  3E1Z B;  1EN6 A;  2F4V O;  4FLZ A;  3B8M A;  3HKD B;  3TGU H;  1H2M A;  1Y66 A;  1KD1 W;  3AG4 C;  3ZCC A;  2AUX A;  4DK1 A;  1PM9 A;  4JI4 B;  2QE7 G;  1U9W A;  2UXB B;  2VQE O;  1VQ8 V;  3QJ3 A;  4EFB A;  4QPK A;  4D7S A;  2FRA A;  3N27 A;  4FVM A;  1WJZ A;  2KKW A;  2DW4 A;  2YXL A;  4DW0 A;  4UCS A;  1W0K G;  5KMG B;  1D5A A;  3DSQ A;  2ZDI A;  1K7D A;  4LFB B;  4GX1 A;  5J9P C;  1PCI A;  4FJC A;  3OEH G;  4KP4 A;  4LCU C;  4P9O A;  2P86 A;  4LR3 A;  2UZJ A;  3TET A;  4JZ2 A;  3CXC U;  2P06 A;  2R6N A;  3IOQ A;  3JAT A;  4LF5 B;  1A6R A;  3C90 A;  1WPX A;  4DUZ B;  4JTC B;  4UV8 A;  3UCS C;  5EF4 A;  2FB5 A;  2H94 A;  1N34 B;  1AR5 A;  1NKD A;  4JAV A;  4DR7 B;  2EZP A;  2BTQ A;  1Q90 D;  2H7J A;  1SES A;  4PI2 A;  4MTF A;  3OE7 G;  2G7Y A;  4IIJ B;  3ABL B;  4TV9 B;  2GTA A;  4I50 B;  4IP3 A;  3OTO O;  3ZRW A;  1V55 B;  4L8J A;  3BPZ A;  4BW5 A;  4DV1 B;  2ATO A;  3AI8 A;  3IC7 A;  3SJC C;  4MSW C;  2ODM A;  1PKX A;  4LF4 O;  4TQD A;  2JGU A;  2NLJ C;  2GV9 A;  4MTX A;  1Y6X A;  4DV0 B;  1NH2 D;  4D8B A;  1O9G A;  3B77 A;  2UUA O;  1L1F A;  1KMI Z;  5F02 A;  5KUM A;  2JJ2 G;  3ZMZ A;  3OEE G;  4GKJ B;  1QR8 A;  3CME V;  4LWS B;  4ZOL A;  2W6I G;  2C0Y A;  3N2G B;  2M6Y A;  3J81 N;  3KKY A;  3AG1 B;  3ABL C;  5GTH Z;  1HR0 O;  1VSN A;  4PV1 B;  3APO A;  3CWB H;  4P16 A;  3GVM A;  1V55 C;  3RVZ A;  4YJ2 A;  4HXD B;  4DXW A;  3L9D A;  1U9X A;  3FB8 C;  1ARO P;  1KFU L;  4JV5 B;  1VQO V;  1US6 A;  1MSW D;  3VQV A;  4EKW A;  2UU9 B;  4MTO A;  3PJS K;  2F7D A;  1IXB A;  1VEW A;  3B8N A;  2JQF R;  4I07 A;  3NXS A;  5B1A B;  3P5U A;  2JRI A;  1WNS A;  1URF A;  4LP8 A;  3D3I A;  4OX9 B;  1YTF B;  2WAM A;  1GMY A;  1FXH A;  2FUD A;  2RNB A;  5LOV B;  4YYV A;  1AI6 A;  3CS5 A;  2E00 A;  5JVD B;  3LSS A;  2FML A;  3ABK B;  2NQI A;  4J7Z A;  4BS6 A;  3AG1 C;  1CJL A;  2CUG A;  4H0L B;  3H1I H;  3RVX A;  2GTS A;  1NBM G;  2R9O A;  1CPY A;  1ENV A;  2GSM B;  2CTQ A;  2XAF A;  3HKC A;  1PNM A;  1YAL A;  3K5M A;  3CJH A;  4DV6 B;  3BY4 A;  4BOS A;  2QWR B;  3D36 C;  4FMT A;  4DV2 B;  2DJG B;  2OWO A;  3EVK A;  3W7X A;  1EWO A;  1I08 A;  5B1A C;  1CTE A;  3OD4 A;  2B1I A;  1UJW B;  3JAT B;  1GM8 A;  4I7Z B;  2IM9 A;  1AP5 A;  1Z2G A;  3ZRX A;  1BHB A;  1QHT A;  4LH7 A;  1VJV A;  2AZ2 A;  4DMX A;  5EIB D;  5IYC O;  5LA6 B;  4EB6 B;  2XU4 A;  2DJV A;  5CA3 A;  4WFB V;  3OW2 U;  2BTQ B;  1U9Q X;  4REZ A;  4A5U B;  3ABK C;  4FFB B;  1KEC A;  2G6D A;  3OGC C;  4FM0 A;  1XHZ A;  2A06 H;  3TK1 A;  1ME4 A;  2F43 G;  1YJW V;  2JTC A;  4RWU A;  3E9S A;  4F6R A;  4I55 A;  3SPG A;  1JCH A;  1LR1 A;  2CH7 A;  2VHS A;  3FAV A;  5B1N A;  4CBC A;  3P30 A;  3WG7 B;  1BMF G;  1MS6 A;  2ZM6 B;  4JAS A;  2ZR3 A;  3V6E A;  5KX5 B;  4WFA V;  1M4U A;  4CC6 A;  3K9S A;  3AEI A;  2DZZ A;  4HWY A;  1P84 F;  2HR3 A;  3DXR A;  1Q8I A;  3WU2 Z;  5IWA O;  2NNU A;  1IVS A;  1NB5 A;  2OTL V;  1XNR O;  2ZIM A;  4YJ2 B;  4OEL A;  1Q6H A;  3H8B A;  4GX5 A;  1ZCM A;  3LDD A;  1Q6K A;  4O4L A;  4R8C A;  3BEH A;  5J2T B;  2GUZ A;  2UUB O;  2IJK A;  5L3E A;  2Y6E A;  5EZS A;  2ZE7 A;  3VBB A;  4FLW A;  1XMO O;  1COW G;  3DC6 A;  1P7B A;  4PA4 A;  4JI6 B;  3WG7 C;  3ZRS A;  3AK3 A;  4AI8 A;  4H13 B;  3PW3 A;  1V9P A;  3KWZ A;  3ETG A;  2IBZ H;  1FH0 A;  4DR3 B;  1VQM V;  1F29 A;  4J9Z B;  4EEQ A;  3D8C A;  4UXN A;  1N33 O;  2A3Q A;  1KUQ A;  2AYO A;  2XHB A;  4XUI A;  4NXN B;  1POP A;  4Q20 A;  1XNQ B;  2IJJ A;  4J10 A;  3L70 H;  2DOS A;  2AUZ A;  3T1H B;  1F7Y A;  1CS8 A;  4N79 A;  4LF8 O;  1VQN V;  2ACT A;  2LJ2 A;  4I04 A;  1K3E A;  1VMG A;  3CCV V;  3K8U A;  5DEC A;  1YHQ V;  3ABT A;  1Y76 A;  1VP7 A;  1IBL B;  2LW7 A;  1AYV A;  5JWP A;  1B06 A;  3CJH B;  3ZHV A;  4QRV A;  4OXS A;  1SER A;  1S5J A;  1KHP A;  3C3S A;  3RYC A;  5L3C A;  1OZ0 A;  1EF7 A;  2HJF C;  3JAR A;  4J7J A;  3UM7 A;  1DF0 A;  2ZR2 A;  5IYB O;  3A0B Z;  2RJZ A;  5KAI Z;  3G71 V;  9PAP A;  3J80 N;  1DTO A;  2QWN B;  4I4T B;  4CS2 A;  4HNA A;  2PYL A;  2WLH A;  2XAQ A;  3BA8 A;  3FFQ A;  2EX3 A;  1NTM H;  5EBM C;  3TCU A;  5LP6 A;  3JD2 A;  3LSU A;  4JI5 O;  4CS3 A;  5D5Q A;  4AQY B;  1IBK B;  1DLB A;  1IX9 A;  1NZ6 A;  3JD4 A;  4CH3 A;  4RNA A;  2RDC A;  2R9N A;  3ETE A;  4J80 A;  3ZRV A;  3BHP A;  4DR6 B;  2EJR A;  1XHX A;  4XBF A;  1QOL A;  3IGA C;  3RYF B;  1S5H C;  3FAV B;  2LFR A;  5IJ0 A;  2Q5Z A;  1CEZ A;  5B1B B;  4XDL A;  1IBM O;  4CZZ A;  4WUR A;  3HB3 B;  2R9C A;  4KLB A;  1OCR B;  2OYQ A;  1FJG O;  5CB4 B;  4X62 O;  1F2C A;  3DXR B;  4DV5 O;  2LO1 A;  2B5U A;  1QCE A;  1P4R A;  2OZ2 A;  5EBL C;  3AK2 A;  2L6L A;  5EK0 A;  1JVM A;  2L35 A;  1FXK A;  3R65 A;  3B4S A;  3T1Y O;  2ZNI A;  2PZS A;  3P5X A;  3H1H H;  1ZIV A;  1L8D A;  4UB8 Z;  1XMQ B;  4BIO A;  4B3M B;  2A7W A;  4CDF B;  4H44 B;  5KHK A;  2DC8 A;  5B1B C;  5K1P A;  5HFM A;  1SQB H;  2PRE A;  5KO3 A;  3JAM N;  1OCR C;  4GKK O;  1Q5O A;  3CC2 V;  2YJB A;  2Q68 A;  4ZUX U;  5LMU B;  3H6S A;  2F93 B;  4B7E A;  4BWA A;  5LXT B;  2AS8 A;  5GTI Z;  3D6S A;  1HUC B;  2UXC O;  4XZX A;  2BTO A;  2QTS A;  3QVN A;  3W7T A;  2VQF O;  5LMN O;  1K73 W;  3VQX A;  4YY3 B;  1XL4 A;  2WA4 A;  3EXA A;  4B3T O;  1ME3 A;  2YJ9 A;  5LYJ B;  1Y76 B;  3O9O A;  5L3G A;  1VF7 A;  1AIM A;  5EYP B;  4W4K A;  3RYC B;  3V6C A;  2O57 A;  1RFY A;  4I05 A;  4JPR A;  1YXB A;  4IHJ A;  1FFT B;  2HKO A;  3JSL A;  1TL9 A;  4X66 B;  5BR8 O;  4JI1 O;  2KQX A;  2UUC B;  1HNW O;  3U10 A;  2Q6A A;  1N32 B;  4JAU A;  3T4D A;  3OMA B;  3HKB B;  1THZ A;  1NVP B;  2AW9 A;  1NTZ H;  2UXD O;  4TSF G;  1H2L A;  3WB0 A;  4XDJ A;  2Y5B A;  4I0X A;  1K92 A;  2WLN A;  4LF9 B;  5KLV H;  2E03 A;  1KBH A;  5LP6 B;  1CQD A;  3AG7 A;  4LF7 O;  1GLO A;  3PRP A;  3HD3 A;  1NT2 B;  4FZ1 A;  3IHP A;  1CSB B;  1JX9 A;  1R1B A;  2PBH A;  3H89 A;  2FTK A;  3ZHT A;  3IJ4 A;  3K5L A;  1UPG A;  5KA6 A;  3USV A;  2Q0O C;  1WB8 A;  3GWK C;  4JGS A;  4GUA A;  4DUY B;  2ZIN A;  2HEP A;  5CA0 B;  1QMY A;  5IJ0 B;  1VQ7 V;  4ZKI A;  3CCM V;  5K1X A;  2PYJ A;  5J94 A;  4CDC B;  1TGO A;  3CBJ A;  3CX5 F;  4P2Z A;  4JI0 B;  4WCE V;  4JI8 O;  3N3K A;  1YK7 A;  4ABM A;  2YXH A;  4QJF B;  4WBN A;  3ZNH A;  4MVR A;  1J95 A;  4HZ3 A;  3GWO A;  3KKU A;  4FK5 A;  4MSX A;  2G8J A;  2XND G;  1Y67 A;  4AXL A;  3SPI A;  4DW1 A;  5LP6 C;  1YI2 V;  1VF6 C;  1Q43 A;  4DV7 O;  4DK0 A;  3ETQ A;  1M57 B;  2XAJ A;  5PAD A;  4MVU A;  1S0V A;  4OPA A;  4DR2 B;  2CB5 A;  3RVY A;  1NJI W;  2LGW A;  3LDC A;  3SYC A;  1AU4 A;  2ARY A;  1RP3 B;  4K7C A;  3PHW A;  2FTD A;  4O2A A;  4Z1M G;  3JAW A;  4NVP A;  1AYW A;  3QT4 A;  1H2K A;  3T1C A;  1FAF A;  4FLX A;  1DF5 A;  3OR6 C;  4KFM A;  3FKS G;  3UT5 B;  4RQE A;  2P0R A;  2Q9L A;  2BCC H;  2QTO A;  4Z1V A;  4IYH A;  1I5Y A;  2FYU H;  1R3K C;  3O1G A;  2P90 A;  3RT3 C;  4MT8 A;  1ZX3 A;  4HYO A;  1K97 A;  3ZHQ A;  1G4Y B;  4X20 B;  1VIB A;  1M57 C;  3H1J H;  2YIB D;  1I7F A;  3UO3 A;  1K34 A;  1JPX A;  1CXZ B;  3DTU B;  4YIO A;  2EIM B;  4N8W A;  1AU0 A;  1STF E;  4PD4 F;  3H1L H;  1AR4 A;  1JFF A;  1XL6 A;  4NR1 A;  3RYI B;  3AK1 A;  3CCE V;  3UQ8 A;  1VQ4 V;  1KXR A;  5CHV A;  1I5X A;  1LUV A;  2GHY A;  3MD0 A;  4IHJ B;  2Z0A A;  4JYC A;  3DC5 A;  2YDE A;  3E8F A;  3CC4 V;  1YF2 A;  2BTW A;  2QWP B;  4D7T A;  4QE9 A;  1QVF U;  3W7S A;  1AB3 A;  4LNU A;  2YJ8 A;  1KB9 F;  4I0X B;  2JEX A;  2Y0I A;  5DN6 G;  2N74 A;  4X1I A;  1XBL A;  4ZI7 A;  1NLJ A;  4O4H A;  1SKV A;  2CE4 A;  5CBF A;  2DC9 A;  4R3D A;  4PDL A;  5CN0 A;  4U3J A;  3OUF A;  1X59 A;  1PXV A;  3F75 A;  4PDV A;  5JJN B;  2EIM C;  3CYO A;  4MVZ A;  4YHH O;  1HP8 A;  4OVZ A;  1X4T A;  1QLE B;  1HW7 A;  2D3O W;  4UFZ A;  1MZF A;  1S77 D;  3M8A A;  1IWD A;  3C9E A;  5DED A;  2IPP B;  3DGE A;  1XOU A;  1UKF A;  2QJ1 A;  4X8A A;  2IH1 C;  3P5W A;  1R3I C;  5F2V O;  4JAA A;  1SQF A;  1PD3 A;  2ZE8 A;  5H9C A;  3F5T A;  4JI4 O;  1Q3E A;  1F4M A;  1PNL A;  3LDE A;  3TRK A;  1SC5 B;  4GX2 A;  2UXB O;  4X1Y A;  1YIT V;  3K5O A;  5IJ9 B;  2A9H A;  1J5E B;  3GCB A;  2PAD A;  1EWL A;  1N0J A;  3K03 A;  4DR4 O;  4PA7 A;  3WFV A;  4BW9 A;  5LGU A;  3I56 V;  1FPO A;  1K5S A;  2UXN A;  4N21 A;  1QLE C;  2N05 A;  3QO5 A;  3ZIA G;  1LUW A;  1SQG A;  3T4Z A;  1MOF A;  3I5D A;  3K79 A;  4LFB O; 
#chains in the Genus database with same CATH homology
 3B21 A;  4BOP A;  3E9S A;  4JYA O;  3R66 A;  4JI0 O;  4JI6 O;  3MJ5 A;  3PHU A;  5LL6 Y;  4ZTB A;  5BR8 O;  4LF5 O;  5JZE A;  2F4V O;  4JI1 O;  4D8E A;  3J81 N;  4DUZ O;  1R6T A;  4DR3 O;  4JI5 O;  1HNW O;  2BU3 A;  1XMQ O;  3W30 A;  4B3M O;  1HR0 O;  2ZKO A;  1YZB A;  1A32 A;  1N34 O;  4B3S O;  4NXM O;  4RNA A;  4DV6 O;  4P16 A;  4DR7 O;  2Z84 A;  2UXD O;  4DV2 O;  4NXN O;  4D8I A;  5EZQ A;  3J7A U;  1XNQ O;  4HXD B;  2FE8 A;  3BBA A;  1D2D A;  3MTV A;  2Z0A A;  3C0R A;  4LF7 O;  3PRP A;  3T1H O;  5LMU O;  5BY1 A;  2BTW A;  3W31 A;  2J7Q C;  5IWA O;  4MM3 B;  4B3R O;  4DV1 O;  1R1B A;  2VQE O;  1IBL O;  1AB3 A;  1J5E O;  1IBM O;  1XNR O;  4WUR A;  2JRI A;  1N36 O;  4YY3 O;  4GUA A;  4DV3 O;  1DK1 A;  1FJG O;  4X62 O;  5BXZ A;  2N74 A;  4DV0 O;  1FKA O;  4LF6 O;  4DV5 O;  2BTW B;  3MP2 A;  2UUB O;  5IT9 N;  4R3D A;  4A5U A;  5EZS A;  4BOU A;  1X59 A;  4DR2 O;  1XMO O;  1I94 O;  4K0K O;  4GKJ O;  2J7Q A;  4DV4 O;  4JI3 O;  4YHH O;  4OVZ A;  4PT5 A;  3OQC A;  1DKI A;  3PRM A;  2UZJ A;  4JI8 O;  4M0W A;  4DR1 O;  4BOQ A;  3ZNH A;  3T1Y O;  1PVJ A;  2HWK A;  2HHH O;  3M8A A;  3PT2 A;  4BOZ A;  4X66 O;  4DR5 O;  3O65 A;  5H5N A;  2UUC O;  4OW0 A;  3TMP A;  1HNX O;  4X65 O;  3PHX A;  1N32 O;  4KHP O;  1UKF A;  3PSE A;  4DV7 O;  4RKX A;  1N33 O;  1IBK O;  2ZM6 O;  4JI2 O;  3BY4 A;  4X64 O;  1KUQ A;  4RF1 A;  4BOS A;  4MI7 A;  5A2Q N;  4OPA A;  5KO3 A;  4DR6 O;  3JAM N;  2DOS A;  4JI4 O;  3F5T A;  4GKK O;  2E5L O;  4JV5 O;  3TRK A;  1AIL A;  1F7Y A;  3BB7 A;  2UU9 O;  4LF8 O;  3PHW A;  4IUM A;  4OPH A;  4IP3 A;  3SDL A;  3OTO O;  2UXB O;  1XEQ A;  2LW7 A;  2UXC O;  3RNV A;  4XZX A;  2FKX A;  5E6J A;  2DJV A;  4RF0 A;  5FLX N;  2VQF O;  4DR4 O;  4LFA O;  5LMN O;  3IFU A;  4A5U B;  1G1X B;  4REZ A;  4DUY O;  4OX9 O;  4LFC O;  4JI7 O;  4LF4 O;  4B3T O;  4AQY O;  4D8B A;  4OVZ B;  2UUA O;  1FYJ A;  2AGA A;  1NS1 A;  3J80 N;  4LFB O;  3RT3 C;  4LF9 O;  1HNZ O;  2JTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...