2AGAA

De-ubiquitinating function of ataxin-3: insights from the solution structure of the josephin domain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
190
structure length
190
Chain Sequence
b'GPLGSMESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIRVQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Machado-Joseph disease protein 1
molecule tags Transcription
source organism Homo sapiens
publication title Deubiquitinating function of ataxin-3: insights from the solution structure of the Josephin domain.
pubmed doi rcsb
total genus 40
structure length 190
sequence length 190
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02099 Josephin Josephin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2agaA02
3.90.70.40 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2agaA01
3M8AA 4AQYO 2AGAA 4DV7O 2UUAO 4X65O 4DR4O 4JI6O 1A32A 4DR2O 1HNXO 1N34O 2LW7A 4B3SO 4LF5O 4X66O 3JAMN 4X64O 1HNWO 2FKXA 1IBLO 1XNQO 4KHPO 1AB3A 1YZBA 4DV3O 1AILA 5IT9N 2UXCO 4JI7O 4LFCO 4JI2O 3J81N 2UUBO 4YHHO 4DV4O 5A2QN 4DV1O 2DOSA 5H5NA 4JYAO 1J5EO 4B3TO 4DR7O 4LF9O 5BY1A 2UXBO 4DR5O 4DUYO 2UUCO 2ZKOA 4GKJO 3OTOO 4JI8O 4YY3O 4NXMO 4DV5O 1XNRO 1IBMO 5FLXN 3J80N 4NXNO 2VQEO 3RT3C 1XMOO 1XMQO 1X59A 4JI1O 1DK1A 1F7YA 4JI5O 4GKKO 1N33O 1R6TA 3R66A 2Z0AA 4A5UB 4LF8O 4OPAA 4DR1O 2HHHO 3O65A 4DV2O 4X62O 1D2DA 1I94O 4DV0O 1G1XB 1KUQA 5LL6Y 1FJGO 4DR3O 2N74A 1N36O 1FKAO 2UU9O 3SDLA 5BR8O 4K0KO 4OX9O 4DR6O 1NS1A 2E5LO 2UXDO 3T1HO 5LMNO 1HR0O 1HNZO 1IBKO 4LF6O 4JV5O 1N32O 4LF4O 2JRIA 4B3MO 4JI4O 2DJVA 4DUZO 4DV6O 4B3RO 3F5TA 4LF7O 3J7AU 1R1BA 5BXZA 5IWAO 2VQFO 4JI0O 3T1YO 1FYJA 2ZM6O 4OPHA 2F4VO 4JI3O 4LFAO 4LFBO 5LMUO 1XEQA
chains in the Genus database with same CATH superfamily
1VF6A 4G2KA 3K24A 4I7ZB 4X65O 1N0JA 4DV6B 3BEHA 1QHTA 5GTIZ 5KUMA 1U9QX 2YJ2A 1FXVA 5AG2A 5CMUA 2PTMA 2GTAA 1F51A 1SA0B 5B1BC 4I05A 4JV5B 4DV7B 1FFTB 1QBZA 3ERVA 3PHXA 1TGOA 2CTQA 2DCAA 1VQKV 1XBLA 4UUJC 3TXQA 4YHHO 2RQ6A 1FS0G 4CZZA 4DV1O 1EN6A 2HJFC 3H9VA 1Q5OA 2R9FA 3CCMV 2CTRA 4FJCC 3HKCB 2Q5ZA 2BTWB 2ZQMA 4D8BA 2OP3A 4ZBMA 2X7RB 1IBMO 4MZSA 1PV0A 1YIJV 2F1MA 1YVWA 1H2SB 3RT3C 3T4DA 1VQ8V 1R3LC 2VQFB 1F7YA 1IZ3A 3CHXA 3A8TA 4PD4F 4HAMA 1NTZH 3KKUA 4WA6A 5KHGA 4X65B 1KYOF 5L3GA 1BQZA 3IC9A 2DYRC 2PI4A 1DEUA 1SA0A 2ACTA 2QWNB 3F7YC 3D3IA 3QO7A 3HB3B 4RY2A 4BIZA 5CA3A 4LC1A 2QM7A 1AU2A 1MG1A 4FFKA 4ASUG 3WB1A 4NVPA 4WFHA 3SYPA 2ZE7A 2QGNA 2YC0A 3D36A 1SESA 4YY3B 2XAHA 2AUXA 1VF5B 4LWSB 3RYCA 4AILC 2JS3A 3O9OA 4QE9A 4UV9A 1FD9A 5FPOA 3STLC 3ML0A 3LDDA 4KLBA 2WLJA 5EBWC 5KA6A 3FB5C 1QXPA 2O6XA 3OAAG 2YJ9A 1BZKA 2LJ2A 5KHHA 2VWKA 2BU3A 1R1BA 4DUYB 4R6ZA 1ITOA 5FL7G 4QJFB 1SQFA 2FTKA 3RFRA 4REZA 4JGSA 3EXAA 3N2GB 1AI5A 4TV8B 5D5QA 3OM3B 3OF8A 1Y74A 5LMUB 2UZJA 6PADA 1BCCH 5DN6G 1YDXA 1ORQC 4X66O 2R9RB 4PA9A 2DYSB 2Y0IA 4RKXA 5B1AC 3W7SA 3RYHA 1RSOA 1RSOB 2XAFA 3L74H 2B1IA 2B1NA 1QLEB 1EWPA 2RN9A 4DR4B 1BSMA 1XOUA 5IT9N 2PI5A 2PUSA 4AQYB 2P86A 2CGNA 4JI2B 5TISZ 1JQPA 1JJOA 2HLDG 3NR7A 2WPDG 1XUQA 4FM0A 5CA1B 4K3AA 3B2EE 2OIGA 2XT9A 2ZXWB 3OTOO 3D3QA 4QIWF 2QSAA 4P16A 1FXKC 3BRCA 5GTHZ 1S5LZ 1MZFA 4O4LB 1XMOO 4O4LA 3C0RA 1PBHA 4I9WA 1Z5WA 2BDZA 1ZWIC 1MSWD 5LOVB 1VQNV 4X64B 1JFFA 4LF5B 4RO2A 1HDJA 1PNKA 1WLEA 1MS6A 4X9QA 1XHZA 4JF3A 1QOLA 2XU1A 1OCCB 2AHZA 3JAKB 1YHQV 1KP3A 4DR6O 1CPYA 3ZJZA 2W0XA 2Y4TA 2ZIOA 2D2CB 4AXLA 2P4VA 2QKSA 4IGGA 4DRXB 4DR1B 4JZ2A 4BW5A 1GN6A 4UV8A 1KBHA 4ZOLB 5EBMC 2JK5C 3HKBA 2QKAA 3AK3A 4LF7O 1DLBA 4H0LB 4UCOA 5IJ0B 1F2AA 1PPJH 2Q69A 2W6IG 5KHKA 4OPHA 3M7MX 3V6CA 4LFAO 5GONB 1YJ9V 1MHWA 2ZE5A 1OZ0A 1SZTA 1XMOB 1MDWA 3ZN0A 2VRZA 1NVPB 1KHQA 2BSKA 4O4HB 1HNXO 1NU1H 1SZXA 3Q4HA 3N2KA 5JCOA 4RF0A 4B3SO 3SPHA 4PADA 1S5JA 2IJIA 1E1RG 3WXGA 4P30A 3RWRD 4PA6A 4AI8A 2QKCA 3JAMN 2DYRB 1E1QG 1VQ7V 4B3SB 1JMKC 1K7DA 1FFXA 4FK5A 3D36C 2FKXA 4BOQA 2IBZH 4LWSA 3ABUA 1L1FA 3W7TA 1ZL8A 4LH6A 1AP6A 4MTXA 4WFEA 2P67A 4TSFG 1SQGA 3PN1A 3U10A 1MEGA 2HXZA 2HJDA 4F6RB 4X62B 5JVDB 1YALA 5CB4B 3DC6A 1QVGU 2XAJA 4LBEC 2WLHA 4X1YB 1TUEB 1YJWV 5LYJA 2J7QC 3CCUV 4MZOA 2A0LA 1G4YB 4KFMA 1R6TA 3K9MA 2BOCC 3G4SV 3S3XA 1D2DA 1PPPA 9PAPA 3JD3A 1I94O 2NNUA 4N4ZA 5KLVH 5CBFA 1CB5A 5K1PA 2Q67A 1XL6A 1Q3EA 2QE7G 3BPZA 3JYCA 4IYIA 1K5SA 2KSDA 4OX9O 5DECA 4QGPA 4Q8GA 3JARA 4IIJB 2PADA 3MTVA 4J9ZB 2XASA 2FYUH 4OW0A 3CSXA 1R3KC 3T1YB 3F5TA 2C2AA 2JS5A 2QWOB 2X0LA 3A0HZ 4GX1A 4PDRA 3K06A 4X1IB 2H8PC 2HG5C 4OEMA 1CJLA 3R65A 4JYAB 2CK3G 4ZHQB 4LFBO 3CRMA 3JD0A 3THOA 2UUBB 3ETEA 1IWDA 4I07A 1BQIA 4CS2A 3H1LH 4DV2B 5L3DA 3PT2A 2LW7A 2JQGR 1NB3A 1UPGA 1EFRG 1KXRA 4OELA 1QVFU 3K58A 2AZ0A 1VMGA 2MW2B 1UFIA 4O2BB 4K8XA 4X64O 3BAAA 2OULA 4XDLA 4O2AB 2B9ZA 2EIJC 5EIBC 2E02A 1PPDA 1BL8A 3T2MA 4QH6A 4N8WA 2P90A 2R9IA 1YI2V 1WA8A 2HVKC 1J5EO 2BSKB 4PA3A 2RJZA 3QVNA 1M4UA 1SP4B 5JWPA 2GUZB 3IFXA 4LCUC 2CAZC 1G8MA 1J5EB 3JD4A 4NXMO 3E35A 3CS5A 1XNRO 4WFGA 2FT2A 1SERA 5EZSA 1ENVA 1JQ0A 4LR3A 4XBFA 2QWQB 2YSUB 1DK1A 2IJJA 1N33O 1H2NA 1FXHA 3IAYA 4IT5A 4HZ3A 5LGUA 1V54C 4H33A 4DV0O 2ZR2A 1S4VA 4J7JA 4DUZB 3QF7A 3ETQA 5B5EZ 4FIPC 3F7VC 4EEQA 4Z1MG 1CS8A 1DF4A 4FM2A 5H9CA 3RNVA 4J10A 4FLTA 5F2VO 1GMGA 4B7KA 1KU9A 1TU6A 5JH3A 2JRIA 5B1NA 1S72V 3FYIB 4I5SA 3H6SA 3ABKB 2ZIMA 3OMAB 5GW7A 2H94A 4H44B 2HEPA 3QO5A 4J7KA 2PYLA 1AI6A 4XDJA 1A6RA 3AI8A 3DXRA 1V55C 3DGEA 2E00A 2ZNIA 3RYHB 2WLNA 3LNNA 3WFVA 3TXSA 5EZQA 2QTSA 3JD2A 4JYYA 1GN2A 1LNQA 5JJJB 1MNGA 3RGBA 5LGTA 5EC2C 3B8NA 3N2GA 1Y08A 5LHGA 4G28B 2R9NA 4PDLA 1XHXA 4TOIA 5B1OA 1QLNA 1O0EA 2X6CA 2OWOA 2GTSA 2LO1A 2D3OW 1S0VA 4DXWA 1AYUA 1YZBA 3CYOA 3W7XA 4JI7O 4JTCB 3AG3C 3ETDA 3PBHA 5E1AC 4PDVA 2Y69B 1EBOA 3WG7B 3RVZA 2FTDA 1MA1A 3FKSG 3EHBB 2DZYA 5LOVA 1PPOA 4YHHB 5FLXN 1EWMA 3E8GA 3IJ4A 1M93A 5K16A 4FLVA 4YIOA 3CPWU 5L3FA 2DC6A 2A79B 5CVMA 3VQXA 2ATOA 1ZIVA 3IGAC 1ZLZA 3G6BA 4DK0A 4XZXA 4JASA 2HHHO 2EINB 4GZRB 3P30A 3P3PA 4RUFA 1MZEA 4UVBA 4F6RA 4BOUA 1ATKA 4O4JA 1N36O 3CRQA 2Q9LA 3UKMA 1IBLB 4RAIA 2ITDC 3SYCA 3RYIA 1VQ4V 4BSQA 2E03A 1IURA 3HKCA 1FH0A 1WP7A 3TK1A 2VS0A 2OIEA 3C90A 4JV5O 5IJ9B 4FK5C 2NLJC 1P4RA 3LXSA 3SPIA 1TA8A 2OCCB 3T1YO 4O4HA 3CBKA 3FYEB 2JJ2G 3F5WC 4PV1B 1FJGB 4JI3O 4GCZA 2QTOA 4FZ0A 4MVOA 5LGNA 2LFSA 4UVAA 1B6QA 2A7WA 5KMGB 2ZINA 3ZHRA 5KUKA 1GO3F 4DW1A 2HHHB 2QEXV 1P7BA 1GK9A 4W5BA 2L35A 4I50A 1B3QA 4LF5O 1ME3A 5CHVA 5E6JA 2NQDB 4Q8HA 4B3RB 5E79Z 4BQVA 4D8IA 4EB6B 5CVNB 3OGCC 4CBCA 2VQEB 1ZTEA 2KQXA 3FB7C 3GWOA 4X1IA 2XU5A 3BCNA 4HNAB 1SS3A 4MM3B 5CHTA 4TUYB 2M7WA 3J81N 3H8CA 2LW1A 4PP2E 2HR3A 1PE6A 4R50A 3ZEDA 4IUMA 1EF7A 1BGOA 2JEUA 4BOZA 2CB5A 3ZHUA 2DJGB 2DYSC 4RWUA 3CJHA 3CRAA 3OEEG 1XL4A 4QE7A 4NXNB 1XMQO 1X59A 4GKKO 1HW7A 3BABA 2XNDG 1THZA 1YEWA 4YJ2B 4OPAA 1K73W 4I9QA 4CS4A 2JGUA 3F5VA 5L3EA 3PHUA 3S3QA 1OV9A 3FB8C 5LP6B 2UU9O 1I5YA 2DMXA 5BR8O 1NLJA 4PELA 1XDCA 3DF0A 4CC5A 2G7YA 5JH7A 3ZUAA 2IBIA 5KX5A 4GYCB 2YI9A 2ZE6A 4FLWA 4MTFA 4WBNB 4BS5A 2R6NA 4KUMA 1IXBA 1O9HA 1G6UA 3ASOB 3ZMUA 1WP8A 3K0GA 2ZT9B 2HVJC 2P06A 1OCRB 1XREA 3JCUZ 3JSLA 5L3BA 3BB7A 4FLZA 4JI3B 5C8YB 3ZRWA 1FFXB 3T1HB 4YYSA 4CZWA 8PCHA 5IYCO 3MHHA 4X20B 3ABKC 1Q8IA 4GX2A 1VP7A 4BWAA 2L6LA 1PVJA 4JAVA 4RQFA 2E01A 3FAVA 3FAVB 1W59A 5KHJA 2AUZA 3BY4A 4B3MB 4FFBA 1YSCA 4PI2A 3IHPA 1K4CC 5L3CA 2EZOA 4N23A 3DSQA 4CH4A 3KW9A 4PDMA 1AB3A 1V54B 1AILA 2FUDA 1QLEC 2UXCO 1K34A 3JAWB 3AG1B 1H8HG 3RYFB 5F02A 3CC7V 4OX9B 4U3FH 1RM1B 2CIOA 2DOSA 1M9NA 2DQ3A 2ZD9A 2EJ7A 2XAGA 2QWPB 3E89A 1N0NA 1VF6C 2BTQB 4I50B 2HHNA 3L9DA 5CVOB 1MOFA 1NPZA 1AU3A 4NXNO 2HH5A 1SQQH 3G80A 2LFRA 2UUAB 3L72H 1M1KW 4JI5O 3OUFA 4PT5A 1K9MW 4J7ZA 2GHYA 4LF8O 4D8EA 2ZNJA 1XI1A 2P5OA 4J80A 2Z84A 2PZSA 4RQEA 4DV2O 1M6DA 2G8EA 3STZC 4J9YB 1KP2A 3KFQA 4O4JB 3MORA 4FLUA 1VQPV 4GX0A 3LSUA 1SKVA 5EK0A 3M99B 4BIUA 5A9GA 3H1JH 3N3KA 4DR7B 3EFFK 4GUAA 3CB2A 1AVMA 1D5AA 2BTQA 3IOQA 3N4CA 5A24A 3P5UA 3WXEA 2AYOA 2EIKB 4MVRA 2XUMA 1QNMA 3OEHG 4F4LA 3JASB 3U8EA 4LF4O 4DV5B 1WNSA 4ZIBA 2WAMA 1PKXA 1F29A 2BE3A 1M56C 5H6RA 1CSBB 1KMIZ 2P22C 4L8JA 2UXXA 4JI7B 1M56B 4DMYA 3RVVA 2XHBA 1GAXA 5EIBD 1Y6XA 5EBLC 3UT5B 4DR3B 4ZHQA 4QRGA 4FFBB 2UUAO 2PNSA 1BGYH 4XR7A 2AW9A 2IPPB 1N33B 3KZIZ 5FNVA 2HFEC 1Q7YW 2M6YA 1I08A 1GECE 5EZYB 1PNMA 4DV0B 3I3TA 3HR0A 3CMAV 4J41A 3VOUA 2UXDB 5GONA 3AG3B 3CC2V 1CV8A 1GKFA 4QPKA 1PPNA 1QDQA 2DC8A 3UM7A 4WFAV 5JJEB 1OCOB 4CH6A 2W0FC 3TJTA 1ZSPA 2AHYA 2Q73A 3QSDA 5LXTA 2ODMA 2CGOA 3PDFA 1LUVA 3P3NA 2Y4UA 4B3TO 5K1XA 3LNMB 1L0NH 5J2UA 3CH3X 4W4LA 2ILMA 2JDIG 4JI8O 4YY3O 1KC8W 1YK8A 4R3DA 4X8AA 1LR1A 4HXDB 3JAKA 3RW0A 1Z2GA 1R6NA 1Y74B 5EYPB 4IHJA 3HHIA 2JEXA 2YI8A 1RM1C 1WB7A 4PA4A 1HWYA 4OGQB 1U9XA 2DE0X 4X62O 4OVZA 1SF9A 1FJGO 2JVDA 3A0RA 3BA9A 3JATB 1TL9A 4QNHB 2IU0A 2YXLA 1EN4A 3NHEA 4OVZB 1PL4A 1Y67A 1NI8A 1CQDA 1CXZB 3B4SA 2Q7HA 1S3JA 3ASOC 4K35A 4MTOA 4BOPA 5PADA 4WF9V 4NTXA 1M57C 3E8FA 4XUIA 1NH2B 3BY6A 2LGQA 4H37A 4JI0B 2DW4A 3L71H 1H2MA 2OCHA 1N34B 4PI3A 1PADA 2EIMC 1GM8A 4R7CA 4DV7O 4ABMA 1KECA 3BVOA 3ABMC 2CH7B 2XU4A 3CX5F 1VQOV 3C3TA 4TV9A 3L73H 5LA6B 2Q6AA 3WB2A 3U0ZA 4JZGA 1Y76B 4UCTA 4B08A 1P7GA 2F4VB 2Y5BA 1CP9A 4FMTA 3ABTA 4DRXA 1AR1B 5EZYA 1IBLO 4MVZA 3BC3A 1MEMA 3KWZA 3RVWA 3KX1A 3OD4A 4JI6B 4DR7O 4J11A 5IJ9A 1QR8A 4PI0A 1U9WA 4HWYA 3ZHSA 4QBBA 4JI8B 4GUNA 4FLYA 5C8YA 2R9OA 2R9CA 3A2FA 2QA4V 3I55V 2ATKC 1PXVA 2YS8A 1BMFG 1PNLA 1WAZA 2ARYA 2IH1C 5FPWA 2QWRB 3OE7G 3FX7A 4IIJA 4JI5B 3OMIB 5KO3A 5IYBO 3ETGA 5KX5B 5JJNB 1NT2B 2K9PA 3AEIA 1SQPH 4R8CA 1G1XB 3WXFA 4MT8A 3CCRV 5B1AB 3GWKC 3V6EA 5JCOC 4UCRA 1LUWA 3TNXA 1POPA 1DGSA 4MVMA 2UXBB 4YYVA 3SDLA 3IFUA 3GVMA 3HKDB 2F93B 2DCBA 4DR5B 1VARA 3U11A 2UXDO 3OFNG 1H38A 1X9YA 2WA4A 1YJNV 3AG2C 2AU1A 4YV8A 3E83A 2BTOA 3JALB 3ABLC 1VQMV 5J2UB 3PJSK 5J9PC 2AVWA 2IU3A 4UVCA 2WBFX 4DV6O 5LYJB 1ROPA 3PSEA 2NR5A 4NKGB 3MHSA 4L87A 1Q6UA 1YK7A 2Y6EA 3CE2A 4O2AA 5CA0A 3JCZA 1F4MA 3ZX6A 4B7EA 4W4KA 5JQGB 4DR4O 1PP9H 2QM8A 4RNAA 1AJNA 5BMVB 4JTAB 3CXCU 3HD3A 2B1MA 2Q7EA 1AYVA 4E4EA 2EINC 2Q7GA 2EILC 2E74B 3OVZA 1K92A 2Q0AA 2EIJB 3DC5A 2VHFA 2P6JA 4D7TA 1AR4A 4NB5A 4ZTBA 1XNQO 3QNEA 4WFFA 3BHPA 5CBHA 5ITZB 1QQCA 2E3CA 2P4KA 1O9GA 2UUBO 3UCSC 1DTOA 4JPRA 4MSXA 1JPXA 1VF7A 2Y69C 3ZHTA 3LSSA 2RCVA 4QPJA 4YJ3A 3TETA 3I56V 4RUEA 3BA8A 4DMXA 3S3RA 3P5VA 2ZM6B 1NH2D 2FE8A 5JA7A 2JGDA 3WG7C 3HKBB 3FB6C 3BOWA 2O57A 2Y0PA 4G54A 1OJHA 4K0KB 1N8RW 4DR1O 4YXWG 3B21A 3W7UA 1WN7A 3HKDA 2E76B 5IYDO 3K08A 1R73A 2N74A 4FVMA 4MS2A 5B3SC 3L75H 2NQAA 1V55B 3BPFA 2JIZG 5CB4A 3JSNA 2F1GA 4DYLA 5IY5C 4HBNA 3D6SA 4X6HA 1AJPA 4LF9B 3RVXA 2E5LB 2IH3C 4LF6O 2R9MA 1COWG 7PCKA 4C7UA 1OHHG 1ZL8B 3G6EV 2YEVA 3K5MA 4WFBV 3X2QC 1KFUL 4PA7A 5BMVA 5IWAO 2HWKA 4JI0O 2G38A 2V7QG 2BDLA 2ZM6O 1PL0A 2Q8VA 2FO5A 3ZRVA 4BR6A 1B06A 4EKWA 2OT5A 2Q4PA 2Z5UA 4ZI7B 3QJ3A 1K8AW 4DK1A 1YXBA 2HP8A 3N2KB 3SJCC 1W2BU 3JALA 1FAFA 4W5CA 2W6JG 5KAIZ 4CC6A 1NR1A 1GRJA 3SYAA 1NTMH 1Q81W 1U96A 5CN0A 1K4DC 1SQXH 1KKDA 4TV9B 5H6QA 2C0YA 3OTOB 1TUBA 4YIPA 3HKEA 3MP2A 1RPRA 4DV4O 2QDOA 3OT7A 4WBNA 4LF9O 4CS3A 4LF4B 1K97A 2UUCO 4UB8Z 5JVDA 2ZKOA 3OUSA 4KP4A 4JYBA 2GBOA 3HPLC 3IEJA 3RBZA 3I06A 3OTFA 1QR9A 1RFYA 5LP6A 1K33A 1QU7A 1ZX3A 2IJKA 4JI1O 4CDCB 2WWWA 1R3JC 4BAYA 3LFYA 2ETNA 2VWJA 3R66A 1VQ9V 3O65A 4KHPB 1IVSA 2HKOA 4LH7A 1Q43A 1KUQA 1BT8A 1JR9A 1B04A 4U7OA 3H7DA 1Q6IA 2NN4A 1M5IA 1US6A 3H1IH 2YUAA 1EM1A 4GKKB 4CDFB 3K5LA 4IP3A 2E5LO 3UQ8A 1BQ0A 1MIRA 5LBQA 4TT3G 3ABLB 2DCDA 2WA3A 1IBKO 1N32O 3E1ZB 3RN4A 2FRAA 4NTWA 2LGWA 3JD1A 4GLXA 1YTFB 1XILA 4HNAA 2A3QA 3E2EA 2ZXWC 3S3WA 3M8AA 1X4TA 3ZHVA 1AP5A 4AQYO 1KD1W 1U9VA 1J95A 1AI7A 1YCIA 3QT4A 2FYEA 3ASNB 3LDCA 4DR2O 4G27B 1N34O 2CUGA 2UXNA 3HKEB 1I5XA 1HUCB 5EGWA 1VQ5V 4YVAA 1JVMA 3OVXA 2BTWA 4X88A 4O2BA 1JFFB 2YIAA 3MHSC 3SJQC 1NTKH 3RYIB 1H2KA 2QR4A 1IBMB 4CH5A 4PHZA 3JATA 4QRXA 1RPOA 4DV3B 2E75B 4U3JB 2IM9A 3ZBHA 5B1BB 1VEWA 4I55B 2UU9B 3N3GA 1OCZC 2YXYA 1VQ6V 1KKCA 3AG1C 1THEA 1GH6A 2F7DA 4TQFA 3ZN1A 4DV5O 1SC5B 3C3SA 2EULA 3LSQA 1S76D 5EYPA 1Q82W 1KFXL 4UFZA 2B5UA 3K03A 2K1EA 3OMNB 4RF1A 2WLLB 2YEVB 1OCOC 4MSWC 3CP1A 1VSNA 4UCSA 1IDSA 3L70H 4P2ZA 3ZMSA 2FQ9A 1K3EA 1SETA 3G71V 4MW8A 3K0DA 3Q4HB 5KMGA 4U3JA 1FKAO 3SJBC 2YXHA 2PBHA 4GKJB 2PGGA 2Z3YA 3SPGA 3MD0A 4N79A 3MAQA 1OCRC 4P9OA 1H2GA 2PF4E 2CE4A 4YJ3B 2EIKC 1RP3B 3B8MA 2CTWA 3TCUA 5KA5A 4JAAA 3PRMA 1V9PA 1Y4HA 4DUZO 2EZPA 3H01A 4B3RO 3UO2A 3OW2U 4YYUA 2XTAA 4P9PA 1S77D 1YVBA 3IMAA 2VQFO 3A0BZ 1JA8A 1TVKA 3CJHB 1W0JG 4X1YA 3SPCA 2GHUA 5LP6C 2FB5A 1SNKA 2AGAA 2WLKA 3OR6C 4YYRA 1A32A 2N04A 2EBOA 4Z1VA 2P7TC 4PJ0Z 1OCZB 3N27A 1JX9A 1K5QA 4BW9A 5IYZA 1PCIA 1AI4A 3VQWA 1FXKB 1BHBA 4DV3O 3M99A 4FPPA 3CBJA 2XAQA 4LFCO 3K3WA 3ZRSA 2X6AA 2YIDA 2XU3A 3BBAA 1EN5A 5D5PA 5CBGA 3CCQV 4I4TA 4MW3A 4X20A 1NJIW 1U97A 3CEIA 3MHHC 5KAFZ 3O1GA 4MVQA 1NL6A 5EF4A 3ZRWB 1UKFA 1YF2A 2PY5A 2FL4A 4J42A 4M0WA 2Y48A 2JGDB 2LQTA 3VQYA 1QMYA 3TGUH 2GSMB 4UCVA 1YT7A 3CCJV 2DQ0A 1EWOA 4NR1A 4Z2WA 2A9HA 2JQFR 1ICFA 4DR3O 2WLLA 3CCLV 3CD6V 3SYOA 2YDEA 3X2QB 1FPOA 2BCCH 4NXMB 1TUBB 3OGIB 2JJ1G 3W7WA 3KCYA 3I5DA 2ADQB 3TRKA 1AU0A 2Q0OC 4ZUXU 4IL6Z 5HFMA 5IY5B 3APOA 4KXRA 4DW0A 3B40A 5BZBA 1HNXB 2DJVA 2V4DA 2YIBA 4MI7A 3H1HH 1P84F 1S5HC 1DKIA 4I0XB 4ZI7A 2P7UA 3C9EA 4UB6Z 1FYJA 2KKWA 3ZCCA 1KB9F 2H3OA 3UT5A 1JOYA 4ICGA 3K5OA 4CH3A 1WB8A 1CTEA 3RYCB 1R3IC 2PREA 4ZKIA 3QTCA 2DC9A 2R70A 1WPBA 1M57B 3K9AA 1F4NA 2AYNA 1GN4A 4HYOA 4JI1B 2F66C 2R9AA 5JZEA 4JI4B 4EB6A 4Q20A 4BIOA 4LNUB 4DV1B 1TVKB 2F95B 4KHPO 1T5EA 3KG2A 2GDSA 4LFCB 1U5IA 2ZR3A 4KL1A 1Q86W 4UXNA 1I0HA 4LF8B 5IE9A 2CH7A 5DM6V 4LF7B 3OR7C 2A06H 5H5NA 4F6EA 2AZ2A 4JYAO 1SQBH 4LP8A 4X1KA 4DR5O 2Q68A 2DWEC 1NR7A 4DUYO 2ZDIA 3E9SA 2ITCC 3P5WA 4YJ2A 1WA8B 4JYCA 2WLMA 1CEZA 4MVUA 1WJZA 1MABG 3QG5A 1Q6KA 1PM9A 4A5UB 2NQGA 4PP1A 4GX5A 4QRVA 4GT1A 5J94A 4DR6B 1F2CA 1ZCMA 2NQIA 4WCEV 2OYQA 2G6DA 2OCCC 2GFOA 4I4TB 1GMYA 4AXMA 4BPVA 1HNZB 4N21A 3IUTA 5ITZA 4CDDB 3JASA 3CMEV 1Y4MA 5FPRA 4DO2A 3CRRA 1AU4A 1JCHA 2DCCA 1XNRB 3HHAA 1GTOA 3KCXA 5IDJA 1BY8A 1DF0A 1HNZO 1AYWA 4FLXA 4I55A 4D7SA 2F23A 1STFE 5LA6A 3OISA 4P6GA 3AG4C 1UJWB 3PW3A 3E8BA 1WPXA 1VQLV 2B1GA 1IBKB 1N32B 3E8HA 2ADPA 1KQSU 5B3SB 2N05A 2FMLA 4LF6B 2YICA 3JARB 4X1KB 1HP8A 5LMUO 3IV2A 4P6EA 1VJVA 1R6KA 3GB7C 3CWBH 1IXMA 2ZE8A 3E22B 2VHSA 4E2LA 2AIMA 1NQTA 5HFLA 3QO8A 5J2TB 3P5XA 5J2TA 3IC7A 4EFBA 1K3BB 3CRCA 5LXTB 1GCBA 2EJRA 4WURA 1MMMA 1DF5A 3O0UA 1QCEA 2WLIB 3SYQA 2P0RA 4MVSA 2KG7B 4X89A 3SR2C 2G8JA 1AJQA 1EWLA 4FZ1A 1AIMA 2QM4A 2AS8A 1NB5A 1F23A 3PNRA 5LMNB 2OTJV 3K57A 3RYFA 4TV8A 3MDSA 2IJHA 2LP7A 1Q90D 2DWDC 3ZHQA 4X6IA 2BOBC 3SJAC 2UXBO 2EILB 4CDEB 4AHCA 1NKDA 1E79G 4GKJO 3T1CA 3DXRB 4FJCA 3G67A 2DC7A 4FIPA 3TMPA 4LFAB 4Q6GA 1XNQB 4K8ZA 2YIBD 3J80N 2X6BA 1AECA 2VQEO 2UXCB 4B3TB 3K04A 3H8BA 3P32A 1GLOA 3CCEV 5IWAB 3CCVV 1W0KG 3LUTB 4K7CA 1BS3A 3DTUB 2Z0AA 5JQGA 2RMKB 4MTGA 1BE3H 4EFEA 5CA1A 5C93A 2DJFB 1SQVH 4DR2B 2ARHA 5LL6Y 2CDYA 3APQA 3KWBX 4A5UA 1ZAUA 1HNWB 2OTLV 2H7JA 3USVA 3NXSA 4BS6A 3AG2B 4U7NA 3ZRXA 1OCCC 2RNBA 3FFQA 3ZMTA 4OXSA 3WB0A 3HWNA 1M90W 4K0KO 1PIPA 3CH2X 3B79A 3ASNC 1MSDA 1Y76A 3T1HO 5LMNO 2YJ8A 3OQCA 1EZVH 4I04A 4LFBB 5B66Z 2RDCA 1NVPD 3MTNA 3D8CA 4O4IA 3RVYA 3CC4V 1XQ8A 3VBBA 3K8UA 2ZDIC 3W31A 3J7AU 3K59A 2GUZA 1F2BA 1Q6HA 3ZMVA 3H89A 2UUCB 3PRPA 1N36B 5BR8B 2KG7A 4JI6O 1EZJA 1H8EG 5LHHA 2XOKG 4X6JA 1GM9A 1I94B 4JAUA 1Z5VA 5DEDA 3SGIA 1FXKA 3JAWA 4IYHA 4X66B 1AROP 1IX9A 3K79A 3E22A 3CXHF 5H2FZ 3K5NA 1TLOA 2FRQA 1JJ2U 2QJ1A 4JTDB 1HNWO 3VQVA 3F75A 4BOSA 5LHIA 1XKGA 1P49A 1PD3A 4W4UA 3E86A 4I0XA 4YYQA 3KKYA 1GN3A 3KSEA 3OF9A 1URFA 1L8DA 4JI2O 2AXTZ 2DN9A 3PHWA 2GV9A 4TUYA 3WU2Z 5A2QN 1I7FA 3AK1A 1H2LA 5BY1A 3BPMA 5JH7B 2PYJA 3EVKA 2KB1A 3BWKA 3SPJA 2MK3A 1SRYA 2R72A 5IJ0A 3LDEA 1NZ6A 4IHJB 2YJBA 2EIMB 3B77A 4O4IB 2F43G 4DV4B 1AR5A 1TAEA 4ZOLA 3CCSV 4YYWA 1D5NA 4NTYA 2YJCA 4LNUA 3ICXA 1CVZA 1CPJA 1ZUQA 2WSSG 3ABMB 1VIBA 4H13B 5CA0B 2IW5A 3ZS8C 1Y66A 3H1KH 3W30A 2WLIA 2V1DA 3ZMZA 1ME4A 2DZZA 3ZNHA 1GM7A 3BCCH 1HR0B 2EX3A 3K9SA 3ZIAG 5EC1C 4NYKA 1YTFD 1KHPA 4XDKA 1L0LH 1NS1A 3T4ZA 3AK2A 5KHIA 3AG4B 3MJ5A 1HR0O 3BFRA 1YITV 3GCBA 4B3MO 4JI4O 1N4CA 1XMQB 2CTPA 1NBMG 4TQDA 4FM1A 2J7QA 2JTCA 4TWKA 3AG7A 2OZ2A 3UO3A 5BXZA 3FD9A 5FNVB 2ZCEA 1BHAA 5IYZB 2F4VO 4D6TH 1BP4A 4UCUA 1NQCA 3B09A 2HD5A 1XEQA
chains in the Genus database with same CATH topology
3M8AA 3PRPA 4AQYO 4REZA 2AGAA 5EZQA 4DV7O 2UUAO 4X65O 4DR4O 1PVJA 4JI6O 4RNAA 1A32A 4DR2O 1HNXO 1N34O 3PT2A 2LW7A 2UZJA 4RF0A 4B3SO 4WURA 3BY4A 4LF5O 4X66O 3JAMN 2BTWA 5E6JA 4X64O 1HNWO 4RKXA 4BOSA 4D8IA 5JZEA 2FKXA 1IBLO 4BOQA 4ZTBA 1XNQO 4KHPO 1AB3A 1YZBA 4DV3O 1AILA 4MM3B 3PHXA 5IT9N 2UXCO 4JI7O 4LFCO 4JI2O 3MP2A 3PHWA 3J81N 2UUBO 4YHHO 4DV4O 3BBAA 5A2QN 4DV1O 2DOSA 5H5NA 4JYAO 1J5EO 4B3TO 4DR7O 4LF9O 5BY1A 4IUMA 2UXBO 4DR5O 4DUYO 2UUCO 4BOZA 2ZKOA 4GKJO 3E9SA 2BTWB 4D8BA 3OTOO 4JI8O 4YY3O 4NXMO 4DV5O 1XNRO 2FE8A 3TMPA 4R3DA 1UKFA 4P16A 1IBMO 5FLXN 4HXDB 5EZSA 3J80N 4NXNO 2VQEO 3RT3C 4RF1A 1XMOO 2J7QC 4M0WA 1XMQO 1X59A 4JI1O 1DK1A 1F7YA 4JI5O 3C0RA 4GKKO 1N33O 4PT5A 1R6TA 3R66A 2Z0AA 4A5UB 4LF8O 4D8EA 4OPAA 5KO3A 4XZXA 4DR1O 2Z84A 2HHHO 3O65A 3B21A 4DV2O 4X62O 1D2DA 1I94O 4DV0O 4OVZA 1G1XB 1KUQA 5LL6Y 1FJGO 3W30A 4A5UA 4BOUA 4DR3O 2N74A 3PHUA 3ZNHA 1N36O 1FKAO 2UU9O 3SDLA 3IFUA 4OVZB 5BR8O 4K0KO 4GUAA 4OX9O 4DR6O 3RNVA 4IP3A 1NS1A 2E5LO 3TRKA 2UXDO 3T1HO 5LMNO 3MJ5A 3OQCA 1HR0O 1HNZO 4BOPA 3MTVA 1IBKO 4LF6O 4JV5O 1N32O 4LF4O 2JRIA 4OW0A 4B3MO 4JI4O 2DJVA 3PRMA 2J7QA 2JTCA 4DUZO 4MI7A 4DV6O 3PSEA 3W31A 4B3RO 3F5TA 4LF7O 1DKIA 3J7AU 2BU3A 1R1BA 5BXZA 5IWAO 2VQFO 4JI0O 3T1YO 2HWKA 3BB7A 1FYJA 2ZM6O 4OPHA 2F4VO 4JI3O 4LFAO 4LFBO 5LMUO 1XEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M8A A;  4AQY O;  2AGA A;  4DV7 O;  2UUA O;  4X65 O;  4DR4 O;  4JI6 O;  1A32 A;  4DR2 O;  1HNX O;  1N34 O;  2LW7 A;  4B3S O;  4LF5 O;  4X66 O;  3JAM N;  4X64 O;  1HNW O;  2FKX A;  1IBL O;  1XNQ O;  4KHP O;  1AB3 A;  1YZB A;  4DV3 O;  1AIL A;  5IT9 N;  2UXC O;  4JI7 O;  4LFC O;  4JI2 O;  3J81 N;  2UUB O;  4YHH O;  4DV4 O;  5A2Q N;  4DV1 O;  2DOS A;  5H5N A;  4JYA O;  1J5E O;  4B3T O;  4DR7 O;  4LF9 O;  5BY1 A;  2UXB O;  4DR5 O;  4DUY O;  2UUC O;  2ZKO A;  4GKJ O;  3OTO O;  4JI8 O;  4YY3 O;  4NXM O;  4DV5 O;  1XNR O;  1IBM O;  5FLX N;  3J80 N;  4NXN O;  2VQE O;  3RT3 C;  1XMO O;  1XMQ O;  1X59 A;  4JI1 O;  1DK1 A;  1F7Y A;  4JI5 O;  4GKK O;  1N33 O;  1R6T A;  3R66 A;  2Z0A A;  4A5U B;  4LF8 O;  4OPA A;  4DR1 O;  2HHH O;  3O65 A;  4DV2 O;  4X62 O;  1D2D A;  1I94 O;  4DV0 O;  1G1X B;  1KUQ A;  5LL6 Y;  1FJG O;  4DR3 O;  2N74 A;  1N36 O;  1FKA O;  2UU9 O;  3SDL A;  5BR8 O;  4K0K O;  4OX9 O;  4DR6 O;  1NS1 A;  2E5L O;  2UXD O;  3T1H O;  5LMN O;  1HR0 O;  1HNZ O;  1IBK O;  4LF6 O;  4JV5 O;  1N32 O;  4LF4 O;  2JRI A;  4B3M O;  4JI4 O;  2DJV A;  4DUZ O;  4DV6 O;  4B3R O;  3F5T A;  4LF7 O;  3J7A U;  1R1B A;  5BXZ A;  5IWA O;  2VQF O;  4JI0 O;  3T1Y O;  1FYJ A;  2ZM6 O;  4OPH A;  2F4V O;  4JI3 O;  4LFA O;  4LFB O;  5LMU O;  1XEQ A; 
#chains in the Genus database with same CATH topology
 1VF6 A;  4G2K A;  3K24 A;  4I7Z B;  4X65 O;  1N0J A;  4DV6 B;  3BEH A;  1QHT A;  5GTI Z;  5KUM A;  1U9Q X;  2YJ2 A;  1FXV A;  5AG2 A;  5CMU A;  2PTM A;  2GTA A;  1F51 A;  1SA0 B;  5B1B C;  4I05 A;  4JV5 B;  4DV7 B;  1FFT B;  1QBZ A;  3ERV A;  3PHX A;  1TGO A;  2CTQ A;  2DCA A;  1VQK V;  1XBL A;  4UUJ C;  3TXQ A;  4YHH O;  2RQ6 A;  1FS0 G;  4CZZ A;  4DV1 O;  1EN6 A;  2HJF C;  3H9V A;  1Q5O A;  2R9F A;  3CCM V;  2CTR A;  4FJC C;  3HKC B;  2Q5Z A;  2BTW B;  2ZQM A;  4D8B A;  2OP3 A;  4ZBM A;  2X7R B;  1IBM O;  4MZS A;  1PV0 A;  1YIJ V;  2F1M A;  1YVW A;  1H2S B;  3RT3 C;  3T4D A;  1VQ8 V;  1R3L C;  2VQF B;  1F7Y A;  1IZ3 A;  3CHX A;  3A8T A;  4PD4 F;  4HAM A;  1NTZ H;  3KKU A;  4WA6 A;  5KHG A;  4X65 B;  1KYO F;  5L3G A;  1BQZ A;  3IC9 A;  2DYR C;  2PI4 A;  1DEU A;  1SA0 A;  2ACT A;  2QWN B;  3F7Y C;  3D3I A;  3QO7 A;  3HB3 B;  4RY2 A;  4BIZ A;  5CA3 A;  4LC1 A;  2QM7 A;  1AU2 A;  1MG1 A;  4FFK A;  4ASU G;  3WB1 A;  4NVP A;  4WFH A;  3SYP A;  2ZE7 A;  2QGN A;  2YC0 A;  3D36 A;  1SES A;  4YY3 B;  2XAH A;  2AUX A;  1VF5 B;  4LWS B;  3RYC A;  4AIL C;  2JS3 A;  3O9O A;  4QE9 A;  4UV9 A;  1FD9 A;  5FPO A;  3STL C;  3ML0 A;  3LDD A;  4KLB A;  2WLJ A;  5EBW C;  5KA6 A;  3FB5 C;  1QXP A;  2O6X A;  3OAA G;  2YJ9 A;  1BZK A;  2LJ2 A;  5KHH A;  2VWK A;  2BU3 A;  1R1B A;  4DUY B;  4R6Z A;  1ITO A;  5FL7 G;  4QJF B;  1SQF A;  2FTK A;  3RFR A;  4REZ A;  4JGS A;  3EXA A;  3N2G B;  1AI5 A;  4TV8 B;  5D5Q A;  3OM3 B;  3OF8 A;  1Y74 A;  5LMU B;  2UZJ A;  6PAD A;  1BCC H;  5DN6 G;  1YDX A;  1ORQ C;  4X66 O;  2R9R B;  4PA9 A;  2DYS B;  2Y0I A;  4RKX A;  5B1A C;  3W7S A;  3RYH A;  1RSO A;  1RSO B;  2XAF A;  3L74 H;  2B1I A;  2B1N A;  1QLE B;  1EWP A;  2RN9 A;  4DR4 B;  1BSM A;  1XOU A;  5IT9 N;  2PI5 A;  2PUS A;  4AQY B;  2P86 A;  2CGN A;  4JI2 B;  5TIS Z;  1JQP A;  1JJO A;  2HLD G;  3NR7 A;  2WPD G;  1XUQ A;  4FM0 A;  5CA1 B;  4K3A A;  3B2E E;  2OIG A;  2XT9 A;  2ZXW B;  3OTO O;  3D3Q A;  4QIW F;  2QSA A;  4P16 A;  1FXK C;  3BRC A;  5GTH Z;  1S5L Z;  1MZF A;  4O4L B;  1XMO O;  4O4L A;  3C0R A;  1PBH A;  4I9W A;  1Z5W A;  2BDZ A;  1ZWI C;  1MSW D;  5LOV B;  1VQN V;  4X64 B;  1JFF A;  4LF5 B;  4RO2 A;  1HDJ A;  1PNK A;  1WLE A;  1MS6 A;  4X9Q A;  1XHZ A;  4JF3 A;  1QOL A;  2XU1 A;  1OCC B;  2AHZ A;  3JAK B;  1YHQ V;  1KP3 A;  4DR6 O;  1CPY A;  3ZJZ A;  2W0X A;  2Y4T A;  2ZIO A;  2D2C B;  4AXL A;  2P4V A;  2QKS A;  4IGG A;  4DRX B;  4DR1 B;  4JZ2 A;  4BW5 A;  1GN6 A;  4UV8 A;  1KBH A;  4ZOL B;  5EBM C;  2JK5 C;  3HKB A;  2QKA A;  3AK3 A;  4LF7 O;  1DLB A;  4H0L B;  4UCO A;  5IJ0 B;  1F2A A;  1PPJ H;  2Q69 A;  2W6I G;  5KHK A;  4OPH A;  3M7M X;  3V6C A;  4LFA O;  5GON B;  1YJ9 V;  1MHW A;  2ZE5 A;  1OZ0 A;  1SZT A;  1XMO B;  1MDW A;  3ZN0 A;  2VRZ A;  1NVP B;  1KHQ A;  2BSK A;  4O4H B;  1HNX O;  1NU1 H;  1SZX A;  3Q4H A;  3N2K A;  5JCO A;  4RF0 A;  4B3S O;  3SPH A;  4PAD A;  1S5J A;  2IJI A;  1E1R G;  3WXG A;  4P30 A;  3RWR D;  4PA6 A;  4AI8 A;  2QKC A;  3JAM N;  2DYR B;  1E1Q G;  1VQ7 V;  4B3S B;  1JMK C;  1K7D A;  1FFX A;  4FK5 A;  3D36 C;  2FKX A;  4BOQ A;  2IBZ H;  4LWS A;  3ABU A;  1L1F A;  3W7T A;  1ZL8 A;  4LH6 A;  1AP6 A;  4MTX A;  4WFE A;  2P67 A;  4TSF G;  1SQG A;  3PN1 A;  3U10 A;  1MEG A;  2HXZ A;  2HJD A;  4F6R B;  4X62 B;  5JVD B;  1YAL A;  5CB4 B;  3DC6 A;  1QVG U;  2XAJ A;  4LBE C;  2WLH A;  4X1Y B;  1TUE B;  1YJW V;  5LYJ A;  2J7Q C;  3CCU V;  4MZO A;  2A0L A;  1G4Y B;  4KFM A;  1R6T A;  3K9M A;  2BOC C;  3G4S V;  3S3X A;  1D2D A;  1PPP A;  9PAP A;  3JD3 A;  1I94 O;  2NNU A;  4N4Z A;  5KLV H;  5CBF A;  1CB5 A;  5K1P A;  2Q67 A;  1XL6 A;  1Q3E A;  2QE7 G;  3BPZ A;  3JYC A;  4IYI A;  1K5S A;  2KSD A;  4OX9 O;  5DEC A;  4QGP A;  4Q8G A;  3JAR A;  4IIJ B;  2PAD A;  3MTV A;  4J9Z B;  2XAS A;  2FYU H;  4OW0 A;  3CSX A;  1R3K C;  3T1Y B;  3F5T A;  2C2A A;  2JS5 A;  2QWO B;  2X0L A;  3A0H Z;  4GX1 A;  4PDR A;  3K06 A;  4X1I B;  2H8P C;  2HG5 C;  4OEM A;  1CJL A;  3R65 A;  4JYA B;  2CK3 G;  4ZHQ B;  4LFB O;  3CRM A;  3JD0 A;  3THO A;  2UUB B;  3ETE A;  1IWD A;  4I07 A;  1BQI A;  4CS2 A;  3H1L H;  4DV2 B;  5L3D A;  3PT2 A;  2LW7 A;  2JQG R;  1NB3 A;  1UPG A;  1EFR G;  1KXR A;  4OEL A;  1QVF U;  3K58 A;  2AZ0 A;  1VMG A;  2MW2 B;  1UFI A;  4O2B B;  4K8X A;  4X64 O;  3BAA A;  2OUL A;  4XDL A;  4O2A B;  2B9Z A;  2EIJ C;  5EIB C;  2E02 A;  1PPD A;  1BL8 A;  3T2M A;  4QH6 A;  4N8W A;  2P90 A;  2R9I A;  1YI2 V;  1WA8 A;  2HVK C;  1J5E O;  2BSK B;  4PA3 A;  2RJZ A;  3QVN A;  1M4U A;  1SP4 B;  5JWP A;  2GUZ B;  3IFX A;  4LCU C;  2CAZ C;  1G8M A;  1J5E B;  3JD4 A;  4NXM O;  3E35 A;  3CS5 A;  1XNR O;  4WFG A;  2FT2 A;  1SER A;  5EZS A;  1ENV A;  1JQ0 A;  4LR3 A;  4XBF A;  2QWQ B;  2YSU B;  1DK1 A;  2IJJ A;  1N33 O;  1H2N A;  1FXH A;  3IAY A;  4IT5 A;  4HZ3 A;  5LGU A;  1V54 C;  4H33 A;  4DV0 O;  2ZR2 A;  1S4V A;  4J7J A;  4DUZ B;  3QF7 A;  3ETQ A;  5B5E Z;  4FIP C;  3F7V C;  4EEQ A;  4Z1M G;  1CS8 A;  1DF4 A;  4FM2 A;  5H9C A;  3RNV A;  4J10 A;  4FLT A;  5F2V O;  1GMG A;  4B7K A;  1KU9 A;  1TU6 A;  5JH3 A;  2JRI A;  5B1N A;  1S72 V;  3FYI B;  4I5S A;  3H6S A;  3ABK B;  2ZIM A;  3OMA B;  5GW7 A;  2H94 A;  4H44 B;  2HEP A;  3QO5 A;  4J7K A;  2PYL A;  1AI6 A;  4XDJ A;  1A6R A;  3AI8 A;  3DXR A;  1V55 C;  3DGE A;  2E00 A;  2ZNI A;  3RYH B;  2WLN A;  3LNN A;  3WFV A;  3TXS A;  5EZQ A;  2QTS A;  3JD2 A;  4JYY A;  1GN2 A;  1LNQ A;  5JJJ B;  1MNG A;  3RGB A;  5LGT A;  5EC2 C;  3B8N A;  3N2G A;  1Y08 A;  5LHG A;  4G28 B;  2R9N A;  4PDL A;  1XHX A;  4TOI A;  5B1O A;  1QLN A;  1O0E A;  2X6C A;  2OWO A;  2GTS A;  2LO1 A;  2D3O W;  1S0V A;  4DXW A;  1AYU A;  1YZB A;  3CYO A;  3W7X A;  4JI7 O;  4JTC B;  3AG3 C;  3ETD A;  3PBH A;  5E1A C;  4PDV A;  2Y69 B;  1EBO A;  3WG7 B;  3RVZ A;  2FTD A;  1MA1 A;  3FKS G;  3EHB B;  2DZY A;  5LOV A;  1PPO A;  4YHH B;  5FLX N;  1EWM A;  3E8G A;  3IJ4 A;  1M93 A;  5K16 A;  4FLV A;  4YIO A;  3CPW U;  5L3F A;  2DC6 A;  2A79 B;  5CVM A;  3VQX A;  2ATO A;  1ZIV A;  3IGA C;  1ZLZ A;  3G6B A;  4DK0 A;  4XZX A;  4JAS A;  2HHH O;  2EIN B;  4GZR B;  3P30 A;  3P3P A;  4RUF A;  1MZE A;  4UVB A;  4F6R A;  4BOU A;  1ATK A;  4O4J A;  1N36 O;  3CRQ A;  2Q9L A;  3UKM A;  1IBL B;  4RAI A;  2ITD C;  3SYC A;  3RYI A;  1VQ4 V;  4BSQ A;  2E03 A;  1IUR A;  3HKC A;  1FH0 A;  1WP7 A;  3TK1 A;  2VS0 A;  2OIE A;  3C90 A;  4JV5 O;  5IJ9 B;  4FK5 C;  2NLJ C;  1P4R A;  3LXS A;  3SPI A;  1TA8 A;  2OCC B;  3T1Y O;  4O4H A;  3CBK A;  3FYE B;  2JJ2 G;  3F5W C;  4PV1 B;  1FJG B;  4JI3 O;  4GCZ A;  2QTO A;  4FZ0 A;  4MVO A;  5LGN A;  2LFS A;  4UVA A;  1B6Q A;  2A7W A;  5KMG B;  2ZIN A;  3ZHR A;  5KUK A;  1GO3 F;  4DW1 A;  2HHH B;  2QEX V;  1P7B A;  1GK9 A;  4W5B A;  2L35 A;  4I50 A;  1B3Q A;  4LF5 O;  1ME3 A;  5CHV A;  5E6J A;  2NQD B;  4Q8H A;  4B3R B;  5E79 Z;  4BQV A;  4D8I A;  4EB6 B;  5CVN B;  3OGC C;  4CBC A;  2VQE B;  1ZTE A;  2KQX A;  3FB7 C;  3GWO A;  4X1I A;  2XU5 A;  3BCN A;  4HNA B;  1SS3 A;  4MM3 B;  5CHT A;  4TUY B;  2M7W A;  3J81 N;  3H8C A;  2LW1 A;  4PP2 E;  2HR3 A;  1PE6 A;  4R50 A;  3ZED A;  4IUM A;  1EF7 A;  1BGO A;  2JEU A;  4BOZ A;  2CB5 A;  3ZHU A;  2DJG B;  2DYS C;  4RWU A;  3CJH A;  3CRA A;  3OEE G;  1XL4 A;  4QE7 A;  4NXN B;  1XMQ O;  1X59 A;  4GKK O;  1HW7 A;  3BAB A;  2XND G;  1THZ A;  1YEW A;  4YJ2 B;  4OPA A;  1K73 W;  4I9Q A;  4CS4 A;  2JGU A;  3F5V A;  5L3E A;  3PHU A;  3S3Q A;  1OV9 A;  3FB8 C;  5LP6 B;  2UU9 O;  1I5Y A;  2DMX A;  5BR8 O;  1NLJ A;  4PEL A;  1XDC A;  3DF0 A;  4CC5 A;  2G7Y A;  5JH7 A;  3ZUA A;  2IBI A;  5KX5 A;  4GYC B;  2YI9 A;  2ZE6 A;  4FLW A;  4MTF A;  4WBN B;  4BS5 A;  2R6N A;  4KUM A;  1IXB A;  1O9H A;  1G6U A;  3ASO B;  3ZMU A;  1WP8 A;  3K0G A;  2ZT9 B;  2HVJ C;  2P06 A;  1OCR B;  1XRE A;  3JCU Z;  3JSL A;  5L3B A;  3BB7 A;  4FLZ A;  4JI3 B;  5C8Y B;  3ZRW A;  1FFX B;  3T1H B;  4YYS A;  4CZW A;  8PCH A;  5IYC O;  3MHH A;  4X20 B;  3ABK C;  1Q8I A;  4GX2 A;  1VP7 A;  4BWA A;  2L6L A;  1PVJ A;  4JAV A;  4RQF A;  2E01 A;  3FAV A;  3FAV B;  1W59 A;  5KHJ A;  2AUZ A;  3BY4 A;  4B3M B;  4FFB A;  1YSC A;  4PI2 A;  3IHP A;  1K4C C;  5L3C A;  2EZO A;  4N23 A;  3DSQ A;  4CH4 A;  3KW9 A;  4PDM A;  1AB3 A;  1V54 B;  1AIL A;  2FUD A;  1QLE C;  2UXC O;  1K34 A;  3JAW B;  3AG1 B;  1H8H G;  3RYF B;  5F02 A;  3CC7 V;  4OX9 B;  4U3F H;  1RM1 B;  2CIO A;  2DOS A;  1M9N A;  2DQ3 A;  2ZD9 A;  2EJ7 A;  2XAG A;  2QWP B;  3E89 A;  1N0N A;  1VF6 C;  2BTQ B;  4I50 B;  2HHN A;  3L9D A;  5CVO B;  1MOF A;  1NPZ A;  1AU3 A;  4NXN O;  2HH5 A;  1SQQ H;  3G80 A;  2LFR A;  2UUA B;  3L72 H;  1M1K W;  4JI5 O;  3OUF A;  4PT5 A;  1K9M W;  4J7Z A;  2GHY A;  4LF8 O;  4D8E A;  2ZNJ A;  1XI1 A;  2P5O A;  4J80 A;  2Z84 A;  2PZS A;  4RQE A;  4DV2 O;  1M6D A;  2G8E A;  3STZ C;  4J9Y B;  1KP2 A;  3KFQ A;  4O4J B;  3MOR A;  4FLU A;  1VQP V;  4GX0 A;  3LSU A;  1SKV A;  5EK0 A;  3M99 B;  4BIU A;  5A9G A;  3H1J H;  3N3K A;  4DR7 B;  3EFF K;  4GUA A;  3CB2 A;  1AVM A;  1D5A A;  2BTQ A;  3IOQ A;  3N4C A;  5A24 A;  3P5U A;  3WXE A;  2AYO A;  2EIK B;  4MVR A;  2XUM A;  1QNM A;  3OEH G;  4F4L A;  3JAS B;  3U8E A;  4LF4 O;  4DV5 B;  1WNS A;  4ZIB A;  2WAM A;  1PKX A;  1F29 A;  2BE3 A;  1M56 C;  5H6R A;  1CSB B;  1KMI Z;  2P22 C;  4L8J A;  2UXX A;  4JI7 B;  1M56 B;  4DMY A;  3RVV A;  2XHB A;  1GAX A;  5EIB D;  1Y6X A;  5EBL C;  3UT5 B;  4DR3 B;  4ZHQ A;  4QRG A;  4FFB B;  2UUA O;  2PNS A;  1BGY H;  4XR7 A;  2AW9 A;  2IPP B;  1N33 B;  3KZI Z;  5FNV A;  2HFE C;  1Q7Y W;  2M6Y A;  1I08 A;  1GEC E;  5EZY B;  1PNM A;  4DV0 B;  3I3T A;  3HR0 A;  3CMA V;  4J41 A;  3VOU A;  2UXD B;  5GON A;  3AG3 B;  3CC2 V;  1CV8 A;  1GKF A;  4QPK A;  1PPN A;  1QDQ A;  2DC8 A;  3UM7 A;  4WFA V;  5JJE B;  1OCO B;  4CH6 A;  2W0F C;  3TJT A;  1ZSP A;  2AHY A;  2Q73 A;  3QSD A;  5LXT A;  2ODM A;  2CGO A;  3PDF A;  1LUV A;  3P3N A;  2Y4U A;  4B3T O;  5K1X A;  3LNM B;  1L0N H;  5J2U A;  3CH3 X;  4W4L A;  2ILM A;  2JDI G;  4JI8 O;  4YY3 O;  1KC8 W;  1YK8 A;  4R3D A;  4X8A A;  1LR1 A;  4HXD B;  3JAK A;  3RW0 A;  1Z2G A;  1R6N A;  1Y74 B;  5EYP B;  4IHJ A;  3HHI A;  2JEX A;  2YI8 A;  1RM1 C;  1WB7 A;  4PA4 A;  1HWY A;  4OGQ B;  1U9X A;  2DE0 X;  4X62 O;  4OVZ A;  1SF9 A;  1FJG O;  2JVD A;  3A0R A;  3BA9 A;  3JAT B;  1TL9 A;  4QNH B;  2IU0 A;  2YXL A;  1EN4 A;  3NHE A;  4OVZ B;  1PL4 A;  1Y67 A;  1NI8 A;  1CQD A;  1CXZ B;  3B4S A;  2Q7H A;  1S3J A;  3ASO C;  4K35 A;  4MTO A;  4BOP A;  5PAD A;  4WF9 V;  4NTX A;  1M57 C;  3E8F A;  4XUI A;  1NH2 B;  3BY6 A;  2LGQ A;  4H37 A;  4JI0 B;  2DW4 A;  3L71 H;  1H2M A;  2OCH A;  1N34 B;  4PI3 A;  1PAD A;  2EIM C;  1GM8 A;  4R7C A;  4DV7 O;  4ABM A;  1KEC A;  3BVO A;  3ABM C;  2CH7 B;  2XU4 A;  3CX5 F;  1VQO V;  3C3T A;  4TV9 A;  3L73 H;  5LA6 B;  2Q6A A;  3WB2 A;  3U0Z A;  4JZG A;  1Y76 B;  4UCT A;  4B08 A;  1P7G A;  2F4V B;  2Y5B A;  1CP9 A;  4FMT A;  3ABT A;  4DRX A;  1AR1 B;  5EZY A;  1IBL O;  4MVZ A;  3BC3 A;  1MEM A;  3KWZ A;  3RVW A;  3KX1 A;  3OD4 A;  4JI6 B;  4DR7 O;  4J11 A;  5IJ9 A;  1QR8 A;  4PI0 A;  1U9W A;  4HWY A;  3ZHS A;  4QBB A;  4JI8 B;  4GUN A;  4FLY A;  5C8Y A;  2R9O A;  2R9C A;  3A2F A;  2QA4 V;  3I55 V;  2ATK C;  1PXV A;  2YS8 A;  1BMF G;  1PNL A;  1WAZ A;  2ARY A;  2IH1 C;  5FPW A;  2QWR B;  3OE7 G;  3FX7 A;  4IIJ A;  4JI5 B;  3OMI B;  5KO3 A;  5IYB O;  3ETG A;  5KX5 B;  5JJN B;  1NT2 B;  2K9P A;  3AEI A;  1SQP H;  4R8C A;  1G1X B;  3WXF A;  4MT8 A;  3CCR V;  5B1A B;  3GWK C;  3V6E A;  5JCO C;  4UCR A;  1LUW A;  3TNX A;  1POP A;  1DGS A;  4MVM A;  2UXB B;  4YYV A;  3SDL A;  3IFU A;  3GVM A;  3HKD B;  2F93 B;  2DCB A;  4DR5 B;  1VAR A;  3U11 A;  2UXD O;  3OFN G;  1H38 A;  1X9Y A;  2WA4 A;  1YJN V;  3AG2 C;  2AU1 A;  4YV8 A;  3E83 A;  2BTO A;  3JAL B;  3ABL C;  1VQM V;  5J2U B;  3PJS K;  5J9P C;  2AVW A;  2IU3 A;  4UVC A;  2WBF X;  4DV6 O;  5LYJ B;  1ROP A;  3PSE A;  2NR5 A;  4NKG B;  3MHS A;  4L87 A;  1Q6U A;  1YK7 A;  2Y6E A;  3CE2 A;  4O2A A;  5CA0 A;  3JCZ A;  1F4M A;  3ZX6 A;  4B7E A;  4W4K A;  5JQG B;  4DR4 O;  1PP9 H;  2QM8 A;  4RNA A;  1AJN A;  5BMV B;  4JTA B;  3CXC U;  3HD3 A;  2B1M A;  2Q7E A;  1AYV A;  4E4E A;  2EIN C;  2Q7G A;  2EIL C;  2E74 B;  3OVZ A;  1K92 A;  2Q0A A;  2EIJ B;  3DC5 A;  2VHF A;  2P6J A;  4D7T A;  1AR4 A;  4NB5 A;  4ZTB A;  1XNQ O;  3QNE A;  4WFF A;  3BHP A;  5CBH A;  5ITZ B;  1QQC A;  2E3C A;  2P4K A;  1O9G A;  2UUB O;  3UCS C;  1DTO A;  4JPR A;  4MSX A;  1JPX A;  1VF7 A;  2Y69 C;  3ZHT A;  3LSS A;  2RCV A;  4QPJ A;  4YJ3 A;  3TET A;  3I56 V;  4RUE A;  3BA8 A;  4DMX A;  3S3R A;  3P5V A;  2ZM6 B;  1NH2 D;  2FE8 A;  5JA7 A;  2JGD A;  3WG7 C;  3HKB B;  3FB6 C;  3BOW A;  2O57 A;  2Y0P A;  4G54 A;  1OJH A;  4K0K B;  1N8R W;  4DR1 O;  4YXW G;  3B21 A;  3W7U A;  1WN7 A;  3HKD A;  2E76 B;  5IYD O;  3K08 A;  1R73 A;  2N74 A;  4FVM A;  4MS2 A;  5B3S C;  3L75 H;  2NQA A;  1V55 B;  3BPF A;  2JIZ G;  5CB4 A;  3JSN A;  2F1G A;  4DYL A;  5IY5 C;  4HBN A;  3D6S A;  4X6H A;  1AJP A;  4LF9 B;  3RVX A;  2E5L B;  2IH3 C;  4LF6 O;  2R9M A;  1COW G;  7PCK A;  4C7U A;  1OHH G;  1ZL8 B;  3G6E V;  2YEV A;  3K5M A;  4WFB V;  3X2Q C;  1KFU L;  4PA7 A;  5BMV A;  5IWA O;  2HWK A;  4JI0 O;  2G38 A;  2V7Q G;  2BDL A;  2ZM6 O;  1PL0 A;  2Q8V A;  2FO5 A;  3ZRV A;  4BR6 A;  1B06 A;  4EKW A;  2OT5 A;  2Q4P A;  2Z5U A;  4ZI7 B;  3QJ3 A;  1K8A W;  4DK1 A;  1YXB A;  2HP8 A;  3N2K B;  3SJC C;  1W2B U;  3JAL A;  1FAF A;  4W5C A;  2W6J G;  5KAI Z;  4CC6 A;  1NR1 A;  1GRJ A;  3SYA A;  1NTM H;  1Q81 W;  1U96 A;  5CN0 A;  1K4D C;  1SQX H;  1KKD A;  4TV9 B;  5H6Q A;  2C0Y A;  3OTO B;  1TUB A;  4YIP A;  3HKE A;  3MP2 A;  1RPR A;  4DV4 O;  2QDO A;  3OT7 A;  4WBN A;  4LF9 O;  4CS3 A;  4LF4 B;  1K97 A;  2UUC O;  4UB8 Z;  5JVD A;  2ZKO A;  3OUS A;  4KP4 A;  4JYB A;  2GBO A;  3HPL C;  3IEJ A;  3RBZ A;  3I06 A;  3OTF A;  1QR9 A;  1RFY A;  5LP6 A;  1K33 A;  1QU7 A;  1ZX3 A;  2IJK A;  4JI1 O;  4CDC B;  2WWW A;  1R3J C;  4BAY A;  3LFY A;  2ETN A;  2VWJ A;  3R66 A;  1VQ9 V;  3O65 A;  4KHP B;  1IVS A;  2HKO A;  4LH7 A;  1Q43 A;  1KUQ A;  1BT8 A;  1JR9 A;  1B04 A;  4U7O A;  3H7D A;  1Q6I A;  2NN4 A;  1M5I A;  1US6 A;  3H1I H;  2YUA A;  1EM1 A;  4GKK B;  4CDF B;  3K5L A;  4IP3 A;  2E5L O;  3UQ8 A;  1BQ0 A;  1MIR A;  5LBQ A;  4TT3 G;  3ABL B;  2DCD A;  2WA3 A;  1IBK O;  1N32 O;  3E1Z B;  3RN4 A;  2FRA A;  4NTW A;  2LGW A;  3JD1 A;  4GLX A;  1YTF B;  1XIL A;  4HNA A;  2A3Q A;  3E2E A;  2ZXW C;  3S3W A;  3M8A A;  1X4T A;  3ZHV A;  1AP5 A;  4AQY O;  1KD1 W;  1U9V A;  1J95 A;  1AI7 A;  1YCI A;  3QT4 A;  2FYE A;  3ASN B;  3LDC A;  4DR2 O;  4G27 B;  1N34 O;  2CUG A;  2UXN A;  3HKE B;  1I5X A;  1HUC B;  5EGW A;  1VQ5 V;  4YVA A;  1JVM A;  3OVX A;  2BTW A;  4X88 A;  4O2B A;  1JFF B;  2YIA A;  3MHS C;  3SJQ C;  1NTK H;  3RYI B;  1H2K A;  2QR4 A;  1IBM B;  4CH5 A;  4PHZ A;  3JAT A;  4QRX A;  1RPO A;  4DV3 B;  2E75 B;  4U3J B;  2IM9 A;  3ZBH A;  5B1B B;  1VEW A;  4I55 B;  2UU9 B;  3N3G A;  1OCZ C;  2YXY A;  1VQ6 V;  1KKC A;  3AG1 C;  1THE A;  1GH6 A;  2F7D A;  4TQF A;  3ZN1 A;  4DV5 O;  1SC5 B;  3C3S A;  2EUL A;  3LSQ A;  1S76 D;  5EYP A;  1Q82 W;  1KFX L;  4UFZ A;  2B5U A;  3K03 A;  2K1E A;  3OMN B;  4RF1 A;  2WLL B;  2YEV B;  1OCO C;  4MSW C;  3CP1 A;  1VSN A;  4UCS A;  1IDS A;  3L70 H;  4P2Z A;  3ZMS A;  2FQ9 A;  1K3E A;  1SET A;  3G71 V;  4MW8 A;  3K0D A;  3Q4H B;  5KMG A;  4U3J A;  1FKA O;  3SJB C;  2YXH A;  2PBH A;  4GKJ B;  2PGG A;  2Z3Y A;  3SPG A;  3MD0 A;  4N79 A;  3MAQ A;  1OCR C;  4P9O A;  1H2G A;  2PF4 E;  2CE4 A;  4YJ3 B;  2EIK C;  1RP3 B;  3B8M A;  2CTW A;  3TCU A;  5KA5 A;  4JAA A;  3PRM A;  1V9P A;  1Y4H A;  4DUZ O;  2EZP A;  3H01 A;  4B3R O;  3UO2 A;  3OW2 U;  4YYU A;  2XTA A;  4P9P A;  1S77 D;  1YVB A;  3IMA A;  2VQF O;  3A0B Z;  1JA8 A;  1TVK A;  3CJH B;  1W0J G;  4X1Y A;  3SPC A;  2GHU A;  5LP6 C;  2FB5 A;  1SNK A;  2AGA A;  2WLK A;  3OR6 C;  4YYR A;  1A32 A;  2N04 A;  2EBO A;  4Z1V A;  2P7T C;  4PJ0 Z;  1OCZ B;  3N27 A;  1JX9 A;  1K5Q A;  4BW9 A;  5IYZ A;  1PCI A;  1AI4 A;  3VQW A;  1FXK B;  1BHB A;  4DV3 O;  3M99 A;  4FPP A;  3CBJ A;  2XAQ A;  4LFC O;  3K3W A;  3ZRS A;  2X6A A;  2YID A;  2XU3 A;  3BBA A;  1EN5 A;  5D5P A;  5CBG A;  3CCQ V;  4I4T A;  4MW3 A;  4X20 A;  1NJI W;  1U97 A;  3CEI A;  3MHH C;  5KAF Z;  3O1G A;  4MVQ A;  1NL6 A;  5EF4 A;  3ZRW B;  1UKF A;  1YF2 A;  2PY5 A;  2FL4 A;  4J42 A;  4M0W A;  2Y48 A;  2JGD B;  2LQT A;  3VQY A;  1QMY A;  3TGU H;  2GSM B;  4UCV A;  1YT7 A;  3CCJ V;  2DQ0 A;  1EWO A;  4NR1 A;  4Z2W A;  2A9H A;  2JQF R;  1ICF A;  4DR3 O;  2WLL A;  3CCL V;  3CD6 V;  3SYO A;  2YDE A;  3X2Q B;  1FPO A;  2BCC H;  4NXM B;  1TUB B;  3OGI B;  2JJ1 G;  3W7W A;  3KCY A;  3I5D A;  2ADQ B;  3TRK A;  1AU0 A;  2Q0O C;  4ZUX U;  4IL6 Z;  5HFM A;  5IY5 B;  3APO A;  4KXR A;  4DW0 A;  3B40 A;  5BZB A;  1HNX B;  2DJV A;  2V4D A;  2YIB A;  4MI7 A;  3H1H H;  1P84 F;  1S5H C;  1DKI A;  4I0X B;  4ZI7 A;  2P7U A;  3C9E A;  4UB6 Z;  1FYJ A;  2KKW A;  3ZCC A;  1KB9 F;  2H3O A;  3UT5 A;  1JOY A;  4ICG A;  3K5O A;  4CH3 A;  1WB8 A;  1CTE A;  3RYC B;  1R3I C;  2PRE A;  4ZKI A;  3QTC A;  2DC9 A;  2R70 A;  1WPB A;  1M57 B;  3K9A A;  1F4N A;  2AYN A;  1GN4 A;  4HYO A;  4JI1 B;  2F66 C;  2R9A A;  5JZE A;  4JI4 B;  4EB6 A;  4Q20 A;  4BIO A;  4LNU B;  4DV1 B;  1TVK B;  2F95 B;  4KHP O;  1T5E A;  3KG2 A;  2GDS A;  4LFC B;  1U5I A;  2ZR3 A;  4KL1 A;  1Q86 W;  4UXN A;  1I0H A;  4LF8 B;  5IE9 A;  2CH7 A;  5DM6 V;  4LF7 B;  3OR7 C;  2A06 H;  5H5N A;  4F6E A;  2AZ2 A;  4JYA O;  1SQB H;  4LP8 A;  4X1K A;  4DR5 O;  2Q68 A;  2DWE C;  1NR7 A;  4DUY O;  2ZDI A;  3E9S A;  2ITC C;  3P5W A;  4YJ2 A;  1WA8 B;  4JYC A;  2WLM A;  1CEZ A;  4MVU A;  1WJZ A;  1MAB G;  3QG5 A;  1Q6K A;  1PM9 A;  4A5U B;  2NQG A;  4PP1 A;  4GX5 A;  4QRV A;  4GT1 A;  5J94 A;  4DR6 B;  1F2C A;  1ZCM A;  2NQI A;  4WCE V;  2OYQ A;  2G6D A;  2OCC C;  2GFO A;  4I4T B;  1GMY A;  4AXM A;  4BPV A;  1HNZ B;  4N21 A;  3IUT A;  5ITZ A;  4CDD B;  3JAS A;  3CME V;  1Y4M A;  5FPR A;  4DO2 A;  3CRR A;  1AU4 A;  1JCH A;  2DCC A;  1XNR B;  3HHA A;  1GTO A;  3KCX A;  5IDJ A;  1BY8 A;  1DF0 A;  1HNZ O;  1AYW A;  4FLX A;  4I55 A;  4D7S A;  2F23 A;  1STF E;  5LA6 A;  3OIS A;  4P6G A;  3AG4 C;  1UJW B;  3PW3 A;  3E8B A;  1WPX A;  1VQL V;  2B1G A;  1IBK B;  1N32 B;  3E8H A;  2ADP A;  1KQS U;  5B3S B;  2N05 A;  2FML A;  4LF6 B;  2YIC A;  3JAR B;  4X1K B;  1HP8 A;  5LMU O;  3IV2 A;  4P6E A;  1VJV A;  1R6K A;  3GB7 C;  3CWB H;  1IXM A;  2ZE8 A;  3E22 B;  2VHS A;  4E2L A;  2AIM A;  1NQT A;  5HFL A;  3QO8 A;  5J2T B;  3P5X A;  5J2T A;  3IC7 A;  4EFB A;  1K3B B;  3CRC A;  5LXT B;  1GCB A;  2EJR A;  4WUR A;  1MMM A;  1DF5 A;  3O0U A;  1QCE A;  2WLI B;  3SYQ A;  2P0R A;  4MVS A;  2KG7 B;  4X89 A;  3SR2 C;  2G8J A;  1AJQ A;  1EWL A;  4FZ1 A;  1AIM A;  2QM4 A;  2AS8 A;  1NB5 A;  1F23 A;  3PNR A;  5LMN B;  2OTJ V;  3K57 A;  3RYF A;  4TV8 A;  3MDS A;  2IJH A;  2LP7 A;  1Q90 D;  2DWD C;  3ZHQ A;  4X6I A;  2BOB C;  3SJA C;  2UXB O;  2EIL B;  4CDE B;  4AHC A;  1NKD A;  1E79 G;  4GKJ O;  3T1C A;  3DXR B;  4FJC A;  3G67 A;  2DC7 A;  4FIP A;  3TMP A;  4LFA B;  4Q6G A;  1XNQ B;  4K8Z A;  2YIB D;  3J80 N;  2X6B A;  1AEC A;  2VQE O;  2UXC B;  4B3T B;  3K04 A;  3H8B A;  3P32 A;  1GLO A;  3CCE V;  5IWA B;  3CCV V;  1W0K G;  3LUT B;  4K7C A;  1BS3 A;  3DTU B;  2Z0A A;  5JQG A;  2RMK B;  4MTG A;  1BE3 H;  4EFE A;  5CA1 A;  5C93 A;  2DJF B;  1SQV H;  4DR2 B;  2ARH A;  5LL6 Y;  2CDY A;  3APQ A;  3KWB X;  4A5U A;  1ZAU A;  1HNW B;  2OTL V;  2H7J A;  3USV A;  3NXS A;  4BS6 A;  3AG2 B;  4U7N A;  3ZRX A;  1OCC C;  2RNB A;  3FFQ A;  3ZMT A;  4OXS A;  3WB0 A;  3HWN A;  1M90 W;  4K0K O;  1PIP A;  3CH2 X;  3B79 A;  3ASN C;  1MSD A;  1Y76 A;  3T1H O;  5LMN O;  2YJ8 A;  3OQC A;  1EZV H;  4I04 A;  4LFB B;  5B66 Z;  2RDC A;  1NVP D;  3MTN A;  3D8C A;  4O4I A;  3RVY A;  3CC4 V;  1XQ8 A;  3VBB A;  3K8U A;  2ZDI C;  3W31 A;  3J7A U;  3K59 A;  2GUZ A;  1F2B A;  1Q6H A;  3ZMV A;  3H89 A;  2UUC B;  3PRP A;  1N36 B;  5BR8 B;  2KG7 A;  4JI6 O;  1EZJ A;  1H8E G;  5LHH A;  2XOK G;  4X6J A;  1GM9 A;  1I94 B;  4JAU A;  1Z5V A;  5DED A;  3SGI A;  1FXK A;  3JAW A;  4IYH A;  4X66 B;  1ARO P;  1IX9 A;  3K79 A;  3E22 A;  3CXH F;  5H2F Z;  3K5N A;  1TLO A;  2FRQ A;  1JJ2 U;  2QJ1 A;  4JTD B;  1HNW O;  3VQV A;  3F75 A;  4BOS A;  5LHI A;  1XKG A;  1P49 A;  1PD3 A;  4W4U A;  3E86 A;  4I0X A;  4YYQ A;  3KKY A;  1GN3 A;  3KSE A;  3OF9 A;  1URF A;  1L8D A;  4JI2 O;  2AXT Z;  2DN9 A;  3PHW A;  2GV9 A;  4TUY A;  3WU2 Z;  5A2Q N;  1I7F A;  3AK1 A;  1H2L A;  5BY1 A;  3BPM A;  5JH7 B;  2PYJ A;  3EVK A;  2KB1 A;  3BWK A;  3SPJ A;  2MK3 A;  1SRY A;  2R72 A;  5IJ0 A;  3LDE A;  1NZ6 A;  4IHJ B;  2YJB A;  2EIM B;  3B77 A;  4O4I B;  2F43 G;  4DV4 B;  1AR5 A;  1TAE A;  4ZOL A;  3CCS V;  4YYW A;  1D5N A;  4NTY A;  2YJC A;  4LNU A;  3ICX A;  1CVZ A;  1CPJ A;  1ZUQ A;  2WSS G;  3ABM B;  1VIB A;  4H13 B;  5CA0 B;  2IW5 A;  3ZS8 C;  1Y66 A;  3H1K H;  3W30 A;  2WLI A;  2V1D A;  3ZMZ A;  1ME4 A;  2DZZ A;  3ZNH A;  1GM7 A;  3BCC H;  1HR0 B;  2EX3 A;  3K9S A;  3ZIA G;  5EC1 C;  4NYK A;  1YTF D;  1KHP A;  4XDK A;  1L0L H;  1NS1 A;  3T4Z A;  3AK2 A;  5KHI A;  3AG4 B;  3MJ5 A;  1HR0 O;  3BFR A;  1YIT V;  3GCB A;  4B3M O;  4JI4 O;  1N4C A;  1XMQ B;  2CTP A;  1NBM G;  4TQD A;  4FM1 A;  2J7Q A;  2JTC A;  4TWK A;  3AG7 A;  2OZ2 A;  3UO3 A;  5BXZ A;  3FD9 A;  5FNV B;  2ZCE A;  1BHA A;  5IYZ B;  2F4V O;  4D6T H;  1BP4 A;  4UCU A;  1NQC A;  3B09 A;  2HD5 A;  1XEQ A; 
#chains in the Genus database with same CATH homology
 3M8A A;  3PRP A;  4AQY O;  4REZ A;  2AGA A;  5EZQ A;  4DV7 O;  2UUA O;  4X65 O;  4DR4 O;  1PVJ A;  4JI6 O;  4RNA A;  1A32 A;  4DR2 O;  1HNX O;  1N34 O;  3PT2 A;  2LW7 A;  2UZJ A;  4RF0 A;  4B3S O;  4WUR A;  3BY4 A;  4LF5 O;  4X66 O;  3JAM N;  2BTW A;  5E6J A;  4X64 O;  1HNW O;  4RKX A;  4BOS A;  4D8I A;  5JZE A;  2FKX A;  1IBL O;  4BOQ A;  4ZTB A;  1XNQ O;  4KHP O;  1AB3 A;  1YZB A;  4DV3 O;  1AIL A;  4MM3 B;  3PHX A;  5IT9 N;  2UXC O;  4JI7 O;  4LFC O;  4JI2 O;  3MP2 A;  3PHW A;  3J81 N;  2UUB O;  4YHH O;  4DV4 O;  3BBA A;  5A2Q N;  4DV1 O;  2DOS A;  5H5N A;  4JYA O;  1J5E O;  4B3T O;  4DR7 O;  4LF9 O;  5BY1 A;  4IUM A;  2UXB O;  4DR5 O;  4DUY O;  2UUC O;  4BOZ A;  2ZKO A;  4GKJ O;  3E9S A;  2BTW B;  4D8B A;  3OTO O;  4JI8 O;  4YY3 O;  4NXM O;  4DV5 O;  1XNR O;  2FE8 A;  3TMP A;  4R3D A;  1UKF A;  4P16 A;  1IBM O;  5FLX N;  4HXD B;  5EZS A;  3J80 N;  4NXN O;  2VQE O;  3RT3 C;  4RF1 A;  1XMO O;  2J7Q C;  4M0W A;  1XMQ O;  1X59 A;  4JI1 O;  1DK1 A;  1F7Y A;  4JI5 O;  3C0R A;  4GKK O;  1N33 O;  4PT5 A;  1R6T A;  3R66 A;  2Z0A A;  4A5U B;  4LF8 O;  4D8E A;  4OPA A;  5KO3 A;  4XZX A;  4DR1 O;  2Z84 A;  2HHH O;  3O65 A;  3B21 A;  4DV2 O;  4X62 O;  1D2D A;  1I94 O;  4DV0 O;  4OVZ A;  1G1X B;  1KUQ A;  5LL6 Y;  1FJG O;  3W30 A;  4A5U A;  4BOU A;  4DR3 O;  2N74 A;  3PHU A;  3ZNH A;  1N36 O;  1FKA O;  2UU9 O;  3SDL A;  3IFU A;  4OVZ B;  5BR8 O;  4K0K O;  4GUA A;  4OX9 O;  4DR6 O;  3RNV A;  4IP3 A;  1NS1 A;  2E5L O;  3TRK A;  2UXD O;  3T1H O;  5LMN O;  3MJ5 A;  3OQC A;  1HR0 O;  1HNZ O;  4BOP A;  3MTV A;  1IBK O;  4LF6 O;  4JV5 O;  1N32 O;  4LF4 O;  2JRI A;  4OW0 A;  4B3M O;  4JI4 O;  2DJV A;  3PRM A;  2J7Q A;  2JTC A;  4DUZ O;  4MI7 A;  4DV6 O;  3PSE A;  3W31 A;  4B3R O;  3F5T A;  4LF7 O;  1DKI A;  3J7A U;  2BU3 A;  1R1B A;  5BXZ A;  5IWA O;  2VQF O;  4JI0 O;  3T1Y O;  2HWK A;  3BB7 A;  1FYJ A;  2ZM6 O;  4OPH A;  2F4V O;  4JI3 O;  4LFA O;  4LFB O;  5LMU O;  1XEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...