2AGAA

De-ubiquitinating function of ataxin-3: insights from the solution structure of the josephin domain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
190
structure length
190
Chain Sequence
GPLGSMESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIRVQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Machado-Joseph disease protein 1
publication title Deubiquitinating function of ataxin-3: insights from the solution structure of the Josephin domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 40
structure length 190
sequence length 190
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02099 Josephin Josephin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2agaA02
3.90.70.40 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2agaA01
2N74A 4DV7O 1N32O 4KHPO 4OPHA 5IWAO 4AQYO 1I94O 4DUYO 4LF8O 4X64O 2UU9O 4A5UB 4LF6O 1HNWO 4JV5O 4B3TO 5A2QN 4LF4O 4LF9O 1KUQA 1FJGO 4K0KO 1R6TA 2UXDO 2VQFO 4JI4O 1R1BA 4DUZO 4JI1O 3T1YO 5BXZA 4B3MO 1XNQO 4DR2O 5IT9N 3J7AU 1IBLO 4LF7O 1HNZO 4B3SO 4OX9O 4DR5O 4OPAA 4JI3O 1IBMO 3F5TA 4DR4O 4DV3O 2UXCO 1HNXO 2ZM6O 1A32A 1AILA 2AGAA 4LF5O 4JI2O 2LW7A 3J81N 4X66O 4JI7O 3J80N 5H5NA 2VQEO 1N34O 5LMNO 3RT3C 1IBKO 1XMQO 4DR6O 1FKAO 4DV1O 4YY3O 5LMUO 4GKKO 4JYAO 1YZBA 3O65A 2JRIA 1N33O 1F7YA 5BR8O 3M8AA 4LFCO 4X62O 2UUCO 2UUBO 4DV6O 4JI0O 1XMOO 3T1HO 2F4VO 2FKXA 3R66A 2E5LO 4LFAO 1DK1A 4DV5O 2UUAO 4DV0O 4GKJO 4DR3O 4DR1O 5BY1A 1J5EO 4JI8O 4NXNO 1NS1A 1X59A 2Z0AA 4B3RO 2UXBO 5LL6Y 4DR7O 3SDLA 1N36O 4JI6O 5FLXN 1AB3A 1FYJA 4X65O 3OTOO 4DV2O 1G1XB 4NXMO 1D2DA 2ZKOA 3JAMN 4YHHO 1XEQA 2HHHO 2DOSA 4JI5O 1HR0O 4DV4O 2DJVA 1XNRO 4LFBO
chains in the Genus database with same CATH superfamily
3QJ3A 3MHHC 4QIWF 2ZR3A 5IWAO 1M93A 4CDFB 2Y0IA 3WG7B 1CTEA 4JAAA 3F7YC 4QRXA 3CRMA 3L74H 2YEVA 1IXBA 3ZHUA 1Y74A 3HKEB 3W30A 4FLXA 4MVUA 2ITCC 3BY4A 3U10A 1MA1A 3S3XA 1KUQA 2YEVB 2QTOA 1AJNA 1FJGO 2QJ1A 4CBCA 1R6TA 1K4CC 3UKMA 2UXDO 3R65A 5AG2A 4JI4O 1R1BA 4DUZO 1B04A 1SQQH 4CC5A 3HB3B 2YUAA 1PV0A 2IU0A 3DGEA 2ZM6B 1XDCA 1OCOC 3MHSA 1EBOA 1VQ5V 3CMEV 1HNZO 4PA4A 4L8JA 4AXMA 3ABTA 4OX9O 1GTOA 1J5EB 1N4CA 2QWNB 3JCUZ 1PPPA 4K7CA 3IJ4A 1F51A 4B3RB 4CH6A 4D7SA 2UXCO 3O0UA 3MAQA 1QDQA 3GWKC 4I05A 4BIZA 1WB8A 4PJ0Z 5EYPA 2RJZA 4D8IA 2HEPA 4FFBB 1NLJA 5KAFZ 1L0LH 3CBKA 3L71H 5B3SB 3E83A 2QA4V 5JZEA 5EYPB 4IUMA 4X64B 3PT2A 4QBBA 3RGBA 5EZYB 1U5IA 2F1GA 2UUBO 3ZX6A 4MVZA 3P32A 1K8AW 4A5UA 2DC7A 5DECA 3U0ZA 4IP3A 1Q7YW 2UUAO 4U3JA 4DR3O 1SESA 2R9FA 4B3MB 3CH3X 3RVYA 3ICXA 1GCBA 4U3JB 3N2GB 1H38A 1LUVA 3ZN0A 4X89A 3UT5A 1RSOB 4DV2O 4K3AA 1XBLA 1JR9A 3F7VC 3OF9A 1WA8B 4JI5O 2PY5A 3AG1C 3T4ZA 4DR4B 4EKWA 4YIPA 3MD0A 4GYCB 2CAZC 3I3TA 4XDJA 1CP9A 4I5SA 1HNWO 3FB8C 2AVWA 5LOVB 1VF6A 3UO3A 5H2FZ 1Z5WA 4YY3B 1BL8A 1QU7A 4PDLA 2Q4PA 3ETGA 5CA0A 4O2AB 4PDMA 3L75H 2QWOB 3PDFA 1J95A 4J7JA 2OYQA 4QPKA 4BW9A 1K7DA 1TAEA 3ASNC 1PPOA 3J7AU 1NR7A 4OGQB 4DW1A 3K9SA 3E35A 4O4IA 1MABG 4JF3A 1YITV 4KXRA 2QGNA 5C8YA 3RYFB 4O4IB 4CDCB 4MVRA 2WLLA 3DF0A 1GN3A 3WG7C 3C9EA 3SYCA 2NN4A 3LFYA 4IHJA 5CN0A 1ZSPA 2MW2B 4BIOA 4YJ2A 4PP2E 4ZBMA 4UUJC 5GTHZ 5JH3A 2HD5A 1HP8A 2QTSA 3IC9A 4R50A 1DGSA 1Z5VA 2WLIB 2P6JA 3ZN1A 4GUAA 4UV8A 2UUCO 5H6QA 4X20B 3CRAA 3H1KH 2FRQA 1B06A 1DK1A 4EFEA 2HVJC 3STZC 2E00A 1R3KC 4J10A 5BY1A 5B66Z 4LFBB 1AR5A 2HFEC 3ABMB 3M99B 4FLYA 2WWWA 3HKBA 5B1BB 3OISA 3RN4A 2OT5A 3OTOO 1G1XB 4DYLA 1GN6A 1KP2A 1G8MA 4LP8A 4B08A 1K5SA 4ICGA 4P6EA 1PM9A 3N2KB 3OD4A 5B3SC 1QBZA 2IBIA 3BY6A 3SYAA 4WFBV 1JQPA 3BEHA 4GZRB 3TCUA 4JYCA 2GSMB 2W6IG 3ZMTA 3UQ8A 5KHHA 1YXBA 2NQAA 4PHZA 1GM7A 2XU4A 2CH7A 4E2LA 1SQBH 3SJAC 4LF4O 1URFA 5DM6V 4TQDA 5IJ0B 1W0KG 2CH7B 3HR0A 1XL6A 5FNVB 2YJ9A 2K9PA 2R9MA 4JI1O 1N33B 3T1YO 2VWJA 4DK0A 5JJJB 3UM7A 2NQIA 5JCOA 3OVZA 1IZ3A 3ZRXA 3KSEA 4LFAB 4RAIA 2P86A 4I9QA 4RNAA 2X6CA 3RBZA 4ASUG 1AYUA 4LC1A 2IPPB 2RNBA 2CUGA 2XTAA 4UCRA 1OJHA 1QOLA 4OELA 2E3CA 1AILA 2GUZA 3APQA 3KCYA 2WBFX 4HXDB 3IMAA 1FFXA 1QLEB 1YSCA 2WAMA 4FLUA 1N34O 3LXSA 1U97A 3RFRA 3CXHF 2VWKA 5KO3A 3CC4V 3OTFA 2UZJA 4LFCO 1UJWB 3BBAA 4U7OA 1MS6A 3UCSC 4PDRA 2FKXA 3T1HO 1YK8A 1H2SB 3ZRVA 2Z5UA 2YS8A 3PRMA 3DXRB 1AI5A 1Y67A 1H8EG 3JAWA 2EZPA 2VRZA 4QJFB 3CB2A 1DTOA 1AJQA 3CXCU 5CVMA 3A0HZ 3JSNA 2BOBC 3N3GA 2NLJC 3OEEG 3CC2V 1UFIA 4NXMO 2H8PC 1Q5OA 4AILC 4BS6A 3SPHA 1EWMA 4B3TB 1Z2GA 1RPRA 2DOSA 1PE6A 2AUZA 1KQSU 3HKDA 1KHPA 3RYIA 1VQKV 5FPWA 2QKAA 1I0HA 2NQDB 3SPJA 1PP9H 1THZA 1TLOA 3RYIB 1QHTA 1S5JA 1D5AA 1IBKB 1XMQB 5KLVH 4WFHA 1PXVA 3PHXA 1K3EA 2QWRB 3CCJV 2FO5A 4E4EA 1VQ6V 4XDKA 1H2MA 4O4JA 3ABMC 4DV6B 3D6SA 5CHVA 1OHHG 3I5DA 4HBNA 1XMOB 5B1BC 3RYCB 1AR4A 1SQXH 3RYHB 2PADA 4RKXA 2Q69A 1Q86W 5F02A 1LNQA 3KWBX 4BOPA 1M56B 3G71V 3T1CA 2G6DA 1VQNV 1TA8A 3K03A 1K34A 5J2UA 1BCCH 4MTOA 3EFFK 2ACTA 2P7UA 3U8EA 1WLEA 4MSWC 5J2UB 4EEQA 3CCMV 2M6YA 1BGOA 4UVCA 3OT7A 4X66O 2P06A 4XZXA 2R9OA 4U7NA 2GDSA 5CB4A 1SKVA 3IGAC 3W7UA 4D6TH 3KCXA 4BS5A 2R72A 3ETDA 1QMYA 4LF6B 3TRKA 5L3FA 3G67A 2KG7B 3PHUA 4NR1A 2ZNIA 4X1YA 1KD1W 3MTNA 4OVZB 3ZIAG 2F7DA 2R9RB 1H2LA 2XOKG 4ZOLA 4GX0A 1FAFA 3EHBB 1BQIA 2JDIG 3CCRV 4ZTBA 2AHYA 2ZNJA 3BA9A 3SYOA 2BOCC 1ZL8A 3ZMVA 2HHNA 5L3GA 3SYPA 2N04A 1R6NA 2JGDB 5JVDA 1CS8A 2ATKC 5FLXN 2UU9B 1PNKA 4X65O 1AB3A 4TT3G 1N8RW 3AI8A 3B21A 2KSDA 3V6EA 2YXYA 1QLEC 4Z1MG 1THEA 4QRGA 2B1MA 4I4TB 4OPHA 1MEMA 1XUQA 4FZ0A 5K1PA 2XHBA 4H33A 1I08A 1Q8IA 2J7QC 1GLOA 1ROPA 2DZYA 1PVJA 5BMVA 2AHZA 1ICFA 2R9IA 1SQFA 2W6JG 4BPVA 3FAVA 1XQ8A 4FLZA 1K73W 2ZXWB 2LFRA 1W0JG 2B1GA 2CGNA 3BPZA 4EFBA 5CBFA 5LP6B 4DXWA 1NVPD 1BY8A 2AU1A 2X6BA 1IURA 3P5XA 3RVWA 2R9NA 5BXZA 2GTSA 2ZCEA 2D2CB 2DJGB 3ERVA 1OCRB 3LSUA 5EK0A 3E8HA 5FPRA 5J94A 4W4LA 3FB5C 3CCUV 2IJHA 4QRVA 1K97A 2ADPA 4B3SO 3HHAA 2NQGA 3B09A 1E1RG 3IC7A 1OV9A 4Z2WA 3QSDA 4R3DA 1GM8A 2F66C 4CS4A 1VQOV 4JGSA 2H7JA 4JAVA 4GKKB 4DV3O 2ZDIA 4WF9V 1Y76B 3D3QA 2JGUA 4WBNB 1S0VA 5CA1A 2DZZA 1S5HC 1KHQA 2HHHB 3FB6C 1YI2V 1EZJA 1NVPB 2JS5A 1VQ8V 4BR6A 2WLJA 2VS0A 2ILMA 3TJTA 2B5UA 1FXKB 1KP3A 3ZCCA 2R70A 2E5LB 2DQ0A 2KB1A 1SA0A 4Q20A 3VQYA 1NT2B 4UCOA 4P6GA 2FTKA 1E79G 1EN4A 3ZJZA 4GUNA 1EM1A 4PELA 2Y4UA 5C93A 1SA0B 1HUCB 3DSQA 3Q4HB 2BTOA 2F4VO 2BTWA 2CDYA 1SZXA 5LYJB 2LFSA 2UXDB 2JVDA 2Q73A 5EC1C 5K16A 4DMXA 1M56C 4LWSB 4DUZB 1Q6HA 2BTWB 1PPJH 3FYIB 5EBMC 3W31A 4IIJB 4ZKIA 3SDLA 4IYHA 1FFTB 2UXNA 1TUBA 1L8DA 4PDVA 3K8UA 2F1MA 1HNZB 2B1IA 3JAKB 3K0GA 2AIMA 5LBQA 1AIMA 3W7SA 4FLVA 2PYJA 2XU5A 1QVGU 3HHIA 4MZSA 3HD3A 3USVA 4KHPO 1XOUA 4QE7A 3N27A 1ZLZA 3MJ5A 3A8TA 1WB7A 2JQGR 2V7QG 4CZZA 3CMAV 5EIBD 1S5LZ 3P3NA 4NB5A 4K0KO 4JTDB 2WSSG 3JSLA 1WN7A 2LO1A 5IJ9B 2VQFO 1OCCB 1VJVA 1K3BB 3TXSA 3QT4A 3OE7G 2E76B 4UVBA 1ZUQA 3IFXA 4FZ1A 5JQGA 1XNQO 5CBHA 1M4UA 2DWDC 4ZHQB 1EWOA 6PADA 1FH0A 2UUAB 4JAUA 1DEUA 4G2KA 1M5IA 2V4DA 4DRXA 3SGIA 3AK1A 3PRPA 1JX9A 1Q6UA 3WXGA 1RP3B 4DV1B 1BQZA 1VIBA 1BP4A 1Y74B 4MVOA 2P90A 2CB5A 3ZMSA 5IYZA 4JTAB 2AGAA 4O2BA 4DV2B 1SF9A 1NU1H 1CB5A 3ZMZA 5KX5A 3GB7C 3E8GA 3B40A 3ZHRA 4YXWG 2P4VA 4JI0B 3RT3C 2YIBD 5IDJA 2ZXWC 1KYOF 3ZRWA 5LP6C 1GN4A 4JYBA 4GKJB 2F43G 2JQFR 1SQPH 3E2EA 4NXNB 1HNWB 1OCRC 4I50A 4UCVA 3EXAA 1FS0G 2Z84A 3ETEA 3R66A 2H94A 2WLKA 3I56V 3ZUAA 2Q7HA 5IY5B 1NJIW 3ZS8C 2YIBA 4MVMA 2V1DA 2WLHA 2JS3A 3X2QB 4DR7O 4LF8B 2IH1C 5KMGA 3FYEB 4PV1B 1NQCA 2PGGA 1T5EA 1LUWA 3CS5A 1JMKC 4F4LA 2PTMA 3H1JH 4X1KA 1YVWA 3KFQA 3PN1A 4C7UA 4DV7O 3CRCA 1O9HA 1FXKC 3L73H 3ABKB 2ARHA 3BWKA 1CV8A 2PBHA 4A5UB 5KA6A 1NBMG 1VF5B 1WPXA 2M7WA 3OR7C 2IU3A 1AI6A 5KUKA 4CH3A 4L87A 2GHYA 2XU1A 4UXNA 2Z3YA 1Y4HA 3QG5A 2PZSA 5HFLA 1DF5A 2RMKB 3QO7A 1NPZA 3S3WA 2FE8A 2IJKA 4DR5B 1SQGA 5D5QA 3UT5B 1WP8A 1AYWA 2ODMA 2UUCB 4X6IA 3P5VA 1F2BA 3ETQA 1K92A 5KHIA 4LF5B 4LF7O 3AK2A 4FVMA 4UVAA 1N0JA 1NTMH 2BSKA 1GAXA 1GM9A 3D3IA 2YIDA 3CCSV 4X88A 5LA6A 1S76D 1AI4A 3F5TA 1YK7A 2XAHA 1KFUL 1PBHA 3MTVA 4JYAB 2BSKB 4H0LB 4KUMA 2ADQB 2ZM6O 2FT2A 1FD9A 1AP5A 3H89A 3OTOB 5H6RA 5LGTA 2DQ3A 4DMYA 4TSFG 5CA0B 1F4NA 3F5WC 1F2AA 5LMUO 1NB3A 4RWUA 4YYUA 1R3IC 1YT7A 4CDEB 4R7CA 3CE2A 3T4DA 3JASA 1OCCC 2EIJB 2Q68A 2QDOA 1W59A 1K9MW 1P49A 1P7GA 1MOFA 3E86A 2K1EA 4LF4B 3JASB 1AECA 1SRYA 4N79A 1AU0A 5C8YB 4YHHB 3AG2B 3KKUA 2E03A 2WA3A 4NTWA 1L0NH 1CXZB 2WLLB 3LDEA 3LNMB 4OXSA 5F2VO 3T1YB 1XNRB 1V9PA 1MDWA 4KFMA 1DKIA 1X59A 1KU9A 4IHJB 2CTPA 1N36O 4YJ2B 3SJQC 4JI6O 3ABUA 5EIBC 2LGQA 3JD4A 4BOSA 4GX5A 3E89A 2ZIOA 1H2GA 2JTCA 4BSQA 4IT5A 5GONA 3CJHA 1VP7A 5IE9A 3IEJA 3L9DA 2DCAA 1AU3A 1XREA 2QWQB 3H1HH 2XAGA 3JATA 1PL0A 3MHSC 3CJHB 2GFOA 1HWYA 2XT9A 4J7ZA 3B4SA 4HAMA 4LNUA 1GMGA 1N34B 3JD2A 1GMYA 1BHAA 1YVBA 2A9HA 2YICA 1A6RA 2EIKB 1JPXA 3PW3A 1AI7A 1NB5A 4LNUB 3HKBB 4J42A 4FIPA 4JI3B 5IY5C 3P5UA 1IX9A 4LFCB 4YJ3A 3DTUB 2BDZA 2PREA 4BOQA 4H44B 3X2QC 4I07A 4YJ3B 5H9CA 2ZQMA 3MDSA 1BGYH 1BE3H 1FXHA 5E6JA 3T2MA 5LMNB 4FK5A 3G80A 4PA9A 3QF7A 4P9PA 1QXPA 4O4HA 2O57A 2R9CA 1A32A 3ABKC 3SYQA 4RF1A 4JI2O 1UKFA 3KWZA 4NXMB 4I04A 1KKDA 4JI7O 1CSBB 4X62B 5H5NA 4FLWA 5L3BA 2FB5A 1FKAO 1I5YA 1NH2D 2Y69B 3JD3A 1NTKH 2ITDC 4UFZA 4I0XA 5BR8O 1UPGA 2BTQA 3IFUA 4I7ZB 2AW9A 2JEUA 3H7DA 2YXHA 4D8EA 3RVZA 1YJWV 4ZI7A 2LGWA 2G8JA 1R73A 3BRCA 4XDLA 2PI4A 2GUZB 3IAYA 4ZI7B 2H3OA 2CE4A 2DC8A 2CTRA 4DUYB 2UXBO 4BOUA 1FFXB 5KUMA 1KBHA 1FYJA 1VF6C 4WFAV 3OAAG 3H8BA 3WB0A 2CTQA 1NH2B 5IYDO 3E9SA 3H1IH 4LFBO 4UCUA 3ASOC 3BCCH 4FPPA 5GTIZ 4R8CA 2BDLA 4GT1A 1M57B 3P30A 1GRJA 4O4LA 3H01A 2EIJC 3AK3A 4X66B 4JV5O 1COWG 3APOA 1ZTEA 5CVOB 3JAWB 1JA8A 3OGIB 3NHEA 3GWOA 1DF4A 3A2FA 4X9QA 2IJJA 4AHCA 2YJCA 3AG2C 3K58A 4EB6A 1IBMB 1CJLA 3TNXA 2Y0PA 4X1IA 2E02A 2IJIA 1QVFU 3K59A 1F4MA 5EC2C 2PYLA 3BPFA 1Y6XA 3QVNA 4JASA 2G7YA 3BB7A 4PI3A 3FFQA 1ATKA 1BS3A 2AYNA 3K57A 3HKDB 1AVMA 4LR3A 2W0FC 4QGPA 3U11A 3JYCA 3E22A 4DR6B 3SPIA 1HNXO 1P7BA 3V6CA 3C3SA 4X65B 4QH6A 3J81N 4P30A 1U9VA 3K5NA 5KA5A 3IHPA 4B7KA 3S3RA 5A9GA 1ZIVA 1PCIA 3IV2A 1YJ9V 4TV8A 3CYOA 1BZKA 5KHKA 3W7TA 4MW3A 4O4JB 2FYEA 3VOUA 2EIKC 2RCVA 3O65A 3RVVA 1YHQV 5JWPA 2RQ6A 1Q6IA 4PD4F 3A0RA 3CCLV 2ZE6A 4FLTA 3B2EE 3VBBA 4TOIA 4MVQA 1W2BU 4XUIA 3B8NA 1QNMA 1QQCA 2OULA 1MSWD 4PADA 1STFE 2JIZG 3D36A 1AU4A 3RVXA 1N0NA 1H2NA 2A79B 5CB4B 4B3SB 4HNAA 4JZ2A 3CP1A 1XEQA 3K9MA 2VHFA 5EBWC 4HNAB 1I94O 3OUFA 4DV3B 1MZFA 4MI7A 4X1YB 2DN9A 1V55B 2Y69C 5JCOC 4ZOLB 4FM2A 4B3TO 2ZE7A 5E79Z 1Q3EA 4DR2B 3K3WA 1ZL8B 2IH3C 5B1AB 1IBLB 4I55A 3CHXA 1TUEB 1PL4A 3MHHA 3ZMUA 5JVDB 4F6RA 2PI5A 1YALA 1EZVH 4MTXA 1PPNA 1LR1A 1MEGA 1X9YA 2OWOA 1X4TA 5IT9N 1KC8W 3O9OA 1CEZA 3NR7A 2QEXV 2VQEB 1R3LC 3P5WA 2F95B 2E74B 5BMVB 3CD6V 3TXQA 4PI0A 1SS3A 1BHBA 3FAVB 2QR4A 1M57C 5LGNA 5HFMA 1CPYA 2XU3A 1KKCA 2AS8A 3KKYA 4TUYA 2EJ7A 3OMNB 3H1LH 4ZIBA 1S77D 3BOWA 1KMIZ 1Y4MA 2X6AA 5L3CA 1QR9A 1KECA 1F7YA 1QCEA 3LUTB 4FM1A 4JI8B 3JARA 5JH7A 1V54B 2NNUA 3CC7V 3CPWU 5K1XA 3SR2C 1K33A 2JJ2G 4DR1O 3K24A 5JH7B 1XILA 2GV9A 1MHWA 1JJ2U 1ZCMA 2FTDA 3AG4B 2Z0AA 2DYSB 5CA1B 5IWAB 1CVZA 5LXTA 2WLMA 5LXTB 1EN5A 2JJ1G 2YJ2A 3CRRA 1JFFA 1SC5B 4YIOA 3ZBHA 2N74A 1N32O 4WA6A 4AQYO 2Q0OC 1FJGB 1TGOA 2QWPB 1XL4A 2A0LA 4JI4B 2UU9O 2B1NA 3C90A 1NQTA 5KHJA 1CPJA 1RFYA 3STLC 3HKCA 2ZE5A 4DO2A 4LF9O 3WB2A 2P0RA 4FFKA 3W7XA 4QPJA 2L35A 3RWRD 3LSSA 4OX9B 3H8CA 2Q6AA 2OCCB 1TUBB 3TMPA 4MTGA 2FRAA 2UXCB 2FQ9A 2A3QA 3THOA 1JCHA 5IYCO 4W4UA 3OF8A 2YI8A 2XUMA 3OEHG 5J9PC 3E1ZB 3ZNHA 2HVKC 5ITZA 1BT8A 5BZBA 1WPBA 3OM3B 3BPMA 3ZEDA 3BABA 4RQEA 4DR7B 1KXRA 1TU6A 1M6DA 3CRQA 1V55C 5L3DA 1MNGA 1NL6A 1PADA 2X0LA 2ATOA 4TV9A 2UUBB 2HWKA 2BU3A 4LH7A 4GKKO 3FD9A 5B1AC 3RNVA 2CIOA 1ME3A 4HZ3A 3SJCC 5JQGB 5J2TA 5A24A 4YVAA 4DR3B 1XHZA 4W5BA 2N05A 4OW0A 3JD0A 3ML0A 4CC6A 1AP6A 4DRXB 7PCKA 2EILB 4UV9A 2E5LO 3CCVV 2R9AA 4DV5O 3HKEA 4DV0O 4K35A 2PNSA 5EGWA 3F75A 4N21A 4JI5B 2WLNA 5IYZB 4O2BB 3OMIB 4QE9A 5KX5B 2Q5ZA 4W5CA 1U9WA 4BWAA 5L3EA 3LDDA 5LHHA 3JCZA 1KFXL 4LF7B 4MTFA 1SETA 2GTAA 5B5EZ 2A06H 3ZRWB 5E1AC 2Q8VA 2FL4A 1HR0O 2P7TC 2DJVA 4DV4O 4NTYA 2EULA 3KX1A 4I50B 2IM9A 1Y08A 4Q8GA 2LP7A 3ZHQA 4YYRA 1PNLA 4RUEA 1H2KA 1EWLA 2IW5A 1Q82W 1V54C 2Q7EA 3B77A 5LMUB 4FFBA 3K9AA 2ETNA 4X6JA 2XASA 2Q67A 5DN6G 3IUTA 2ZDIC 5CHTA 5KMGB 2D3OW 3AG4C 1S4VA 3W7WA 2DYSC 4J41A 4G27B 2GBOA 4X1KB 5EZYA 2YXLA 3WU2Z 1ORQC 1AR1B 4PA7A 4J80A 3CCQV 1OCZB 1EF7A 1IVSA 2G8EA 1XKGA 3K0DA 2DCBA 3TETA 4W4KA 1N36B 3FX7A 4DK1A 4JI6B 4PP1A 3OUSA 3KZIZ 1VEWA 1YTFD 3OR6C 1VMGA 3N2GA 1HW7A 4UCTA 3ABLC 4CH4A 4AXLA 1RSOA 1AJPA 2BE3A 3BVOA 1VF7A 2DCCA 4DV1O 3KW9A 2CK3G 1KB9F 1WA8A 2OZ2A 4HWYA 1YZBA 3GCBA 2QM7A 2XAQA 2FMLA 2OCCC 1GH6A 2LJ2A 3OMAB 4JI0O 4PI2A 4J7KA 4MZOA 4CH5A 3BA8A 2EBOA 5LA6B 2YDEA 5B1OA 1ZAUA 1JOYA 4GKJO 5LOVA 1I7FA 4Q8HA 1J5EO 3ASOB 4NXNO 1NS1A 1S3JA 1R3JC 3BC3A 1YTFB 2CTWA 4B3RO 3F5VA 1Y66A 4PA3A 5LL6Y 4FJCA 4O2AA 2JK5C 2EIMB 3S3QA 2JEXA 1AU2A 1D2DA 4N8WA 4D8BA 2XAJA 1VQ7V 2GHUA 1RPOA 1GO3F 2HG5C 2AZ2A 4CZWA 3K5OA 4X64O 2BCCH 4LF8O 8PCHA 2W0XA 4G54A 4JI2B 4JI1B 2QKSA 4UB8Z 2OIEA 2YC0A 4JI7B 2YJ8A 1ZWIC 4KL1A 3RYFA 4WFFA 3ZHVA 2LW1A 1JVMA 4ABMA 2EZOA 2EJRA 2EILC 4BQVA 4KP4A 2AUXA 1BSMA 1MIRA 2LQTA 3JD1A 3L72H 3OGCC 4XBFA 5BR8B 2R6NA 3UO2A 3HWNA 1WP7A 4B3MO 1S72V 1VARA 4Q6GA 4YYQA 2WLIA 1SNKA 2P67A 5GONB 4X20A 3K5MA 4WCEV 4DR5O 3A0BZ 3JATB 2FYUH 1G4YB 3WXEA 5EZSA 4DR4O 3ZHTA 2UXBB 5CMUA 2IBZH 1GK9A 4U3FH 1SP4B 2DW4A 4LF5O 2DMXA 4LH6A 3B8MA 2DYRB 4UB6Z 1H8HG 3M99A 1L1FA 2AYOA 4P9OA 3T1HB 4MM3B 3LSQA 1F2CA 4YY3O 3PNRA 4JYAO 3CBJA 4Z1VA 5CVNB 3N2KA 4HYOA 4DW0A 4RF0A 1NZ6A 4NKGB 3M8AA 3SPGA 3PSEA 4JV5B 4YV8A 1JJOA 2OIGA 3BAAA 1EFRG 4RY2A 4TQFA 1NR1A 3SJBC 2F23A 2DC9A 4BAYA 1M1KW 3H9VA 2HJDA 1OCZC 4O4HB 1P84F 5IJ0A 4NTXA 4PA6A 3MORA 3M7MX 3ZHSA 5FNVA 5EBLC 1DF0A 9PAPA 1PNMA 2ZE8A 2DE0X 5EZQA 2HJFC 4JTCB 2C2AA 2RN9A 4YHHO 2PUSA 4H37A 5PADA 1XNRO 1XI1A 4I0XB 1CQDA 2BTQB 4JZGA 1OZ0A 3B79A 3K06A 1HNXB 3WXFA 3RW0A 2O6XA 1BMFG 5LHGA 3DC6A 1B3QA 5LGUA 3PBHA 1D5NA 2YJBA 4BW5A 2Y6EA 5CBGA 2KKWA 1B6QA 1AROP 2ARYA 2HXZA 1GECE 5DEDA 1Q90D 2OTJV 3C3TA 4AI8A 1FPOA 2WPDG 2J7QA 2RDCA 3KG2A 4KLBA 2NR5A 1ME4A 2EIMC 5FPOA 4QNHB 2EINB 3PJSK 2Q0AA 1GN2A 4FJCC 4OPAA 3OFNG 4JI3O 1NI8A 2YIAA 2XAFA 4O4LB 3FB7C 3DXRA 4GX2A 2YSUB 4IL6Z 1PIPA 4K8ZA 2ZT9B 4P2ZA 4BIUA 2P5OA 3EVKA 2HP8A 5LMNO 4EB6B 3AG7A 4REZA 1I94B 4X1IB 3K08A 3MP2A 1QR8A 1F23A 3OVXA 2JRIA 4YYSA 4MT8A 5B1NA 1N33O 2QE7G 4X62O 1U9XA 4IYIA 1IWDA 4JYYA 1SQVH 4MSXA 3I55V 2OTLV 4GX1A 1U96A 4LFAO 2HLDG 3E22B 1K4DC 1MG1A 4WFEA 4J9ZB 4RQFA 1WNSA 4MW8A 2DCDA 2AZ0A 3VQWA 4IGGA 4NYKA 4TV8B 4M0WA 3VQVA 1FXVA 3CSXA 1SERA 2DYRC 1MZEA 2PF4E 5TISZ 3AG3B 3RYCA 2DC6A 3RYHA 1PKXA 4FIPC 2F93B 1QLNA 4DUYO 2C0YA 3N3KA 3K79A 1I5XA 4MVSA 4LCUC 4BOZA 4CS2A 2A7WA 4NVPA 5KAIZ 5A2QN 4YYVA 5JJEB 2MK3A 1Q81W 4FK5C 3LDCA 2ZIMA 3TGUH 1XHXA 1P4RA 3N4CA 4RO2A 2KG7A 1YEWA 4B7EA 3D8CA 5JJNB 3CCEV 3IOQA 2XNDG 3G6BA 4OVZA 4DR1B 1VQ9V 1YIJV 2E01A 1IBMO 1RM1B 4RUFA 3CWBH 5IYBO 3E8BA 2ZINA 4P16A 3OQCA 1Q6KA 3C0RA 2QM8A 1E1QG 4FM0A 4FMTA 4X8AA 2OCHA 2G38A 2KQXA 2CGOA 2Q7GA 3AEIA 4I55B 3LNNA 2EX3A 2JGDA 3QO8A 3QO5A 3WFVA 4F6RB 1IBKO 2F4VB 2P4KA 1XMQO 1N32B 4DR6O 4AQYB 2L6LA 1IXMA 3BFRA 5GW7A 3H6SA 5FL7G 2QKCA 4I4TA 1EWPA 5JA7A 4DV6O 1XMOO 4LF9B 4OEMA 2HH5A 2B9ZA 1AYVA 1VQLV 4J9YB 2EINC 5LHIA 3WB1A 2WA4A 1TVKA 1NTZH 4CS3A 3G6EV 3L70H 1WJZA 5LP6A 4KHPB 1VQPV 3ZRSA 4TUYB 1TVKB 1OCOB 3HPLC 4LBEC 4JPRA 1YF2A 1YJNV 2ZKOA 3JAMN 3CX5F 1DLBA 1IDSA 4GCZA 1NKDA 1VSNA 3TK1A 2P22C 1O9GA 4H13B 3OW2U 2Q9LA 4K0KB 4ZUXU 1HDJA 3JARB 3QTCA 3K5LA 2VQFB 3BCNA 4LF6O 2HR3A 2OP3A 3P3PA 1VQ4V 2DWEC 2HKOA 1ITOA 1Y76A 1XNQB 2AXTZ 4F6EA 3VQXA 2QSAA 4WBNA 2FUDA 4J11A 4WFGA 1YDXA 1US6A 3G4SV 4X6HA 1YCIA 4N23A 4R6ZA 1FXKA 4YYWA 4G28B 5CA3A 3E8FA 2QM4A 2YI9A 4I9WA 4DR2O 1JFFB 2X7RB 5EF4A 1IBLO 1M9NA 1JQ0A 4TWKA 4DV5B 2DJFB 1U9QX 4DV0B 3Q4HA 4CDDB 3ABLB 3AG3C 4GLXA 1MSDA 3PHWA 1R6KA 1EN6A 5LYJA 4LWSA 3HKCB 1WAZA 1MMMA 2LW7A 1M90W 2Y4TA 4IIJA 3J80N 2VQEO 1G6UA 1TL9A 5KHGA 1HR0B 4DV4B 4K8XA 2UXXA 1ZX3A 3AG1B 2Y48A 1O0EA 1PPDA 3JAKA 3CH2X 4N4ZA 1VQMV 1Q43A 3D36C 1BQ0A 3NXSA 3QNEA 5D5PA 3GVMA 3O1GA 1POPA 3FKSG 4WURA 3SPCA 3BHPA 2ZR2A 4D7TA 5ITZB 4UCSA 1F29A 3I06A 1K5QA 1PD3A 1ENVA 2Y5BA 3CEIA 4JI8O 1RM1C 2ZD9A 4MS2A 4DV7B 1GKFA 2E75B 3K04A 3JALA 4TV9B 5IJ9A 4PT5A 3ASNB 4XR7A 1SZTA 2VHSA 3JALB 2HHHO 3DC5A 5J2TB 4ZHQA
chains in the Genus database with same CATH topology
2N74A 2JTCA 4DV7O 1N32O 4KHPO 4OPHA 5IWAO 4AQYO 1I94O 4DUYO 4MI7A 4LF8O 4X64O 3MJ5A 2J7QC 2UU9O 4A5UB 4LF6O 1PVJA 4BOZA 1HNWO 4JV5O 4B3TO 5A2QN 3W30A 3BY4A 4LF4O 4LF9O 1KUQA 3E9SA 1FJGO 4K0KO 1R6TA 3PHXA 2UXDO 2VQFO 4JI4O 2FE8A 1R1BA 4DUZO 4JI1O 3T1YO 5BXZA 4B3MO 3TMPA 4BOQA 1XNQO 2J7QA 4DR2O 5IT9N 3J7AU 3BB7A 1IBLO 4LF7O 4RKXA 1HNZO 4B3SO 4OVZA 4BOPA 3ZNHA 4OX9O 4DR5O 4OPAA 5E6JA 4JI3O 4RNAA 3PRPA 1IBMO 3PHWA 4R3DA 3F5TA 5EZSA 4DR4O 3MTVA 4P16A 4DV3O 2UXCO 3OQCA 1HNXO 2ZM6O 3C0RA 1A32A 1AILA 2AGAA 4LF5O 4RF1A 4JI2O 1UKFA 2LW7A 3J81N 4D8IA 4X66O 4JI7O 4XZXA 3J80N 2HWKA 4HXDB 5H5NA 2VQEO 2BU3A 1N34O 5LMNO 3RT3C 1IBKO 1XMQO 5JZEA 4MM3B 4DR6O 1FKAO 4DV1O 4YY3O 4REZA 5LMUO 4GKKO 4IUMA 4JYAO 3MP2A 3RNVA 3PT2A 5KO3A 1YZBA 3O65A 4BOSA 4RF0A 2JRIA 3TRKA 1N33O 1F7YA 5BR8O 3M8AA 4OW0A 2UZJA 4LFCO 4GUAA 4X62O 3IFUA 3PHUA 3PSEA 2UUCO 2UUBO 4WURA 4DV6O 3BBAA 4OVZB 4JI0O 2Z84A 1XMOO 3T1HO 2F4VO 2FKXA 4A5UA 4D8EA 3R66A 2E5LO 2BTWA 4LFAO 1DK1A 3PRMA 4DV5O 4IP3A 2UUAO 4DV0O 4GKJO 4ZTBA 4DR3O 4DR1O 5BY1A 1J5EO 4JI8O 2BTWB 4NXNO 1NS1A 1DKIA 1X59A 2Z0AA 3W31A 4B3RO 2UXBO 5LL6Y 4DR7O 4BOUA 3SDLA 1N36O 4PT5A 4JI6O 4M0WA 5FLXN 1AB3A 1FYJA 4X65O 3OTOO 4DV2O 1G1XB 4NXMO 5EZQA 1D2DA 2ZKOA 4D8BA 3JAMN 4YHHO 1XEQA 2HHHO 3B21A 2DOSA 4JI5O 1HR0O 4DV4O 2DJVA 1XNRO 4LFBO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N74 A;  4DV7 O;  1N32 O;  4KHP O;  4OPH A;  5IWA O;  4AQY O;  1I94 O;  4DUY O;  4LF8 O;  4X64 O;  2UU9 O;  4A5U B;  4LF6 O;  1HNW O;  4JV5 O;  4B3T O;  5A2Q N;  4LF4 O;  4LF9 O;  1KUQ A;  1FJG O;  4K0K O;  1R6T A;  2UXD O;  2VQF O;  4JI4 O;  1R1B A;  4DUZ O;  4JI1 O;  3T1Y O;  5BXZ A;  4B3M O;  1XNQ O;  4DR2 O;  5IT9 N;  3J7A U;  1IBL O;  4LF7 O;  1HNZ O;  4B3S O;  4OX9 O;  4DR5 O;  4OPA A;  4JI3 O;  1IBM O;  3F5T A;  4DR4 O;  4DV3 O;  2UXC O;  1HNX O;  2ZM6 O;  1A32 A;  1AIL A;  2AGA A;  4LF5 O;  4JI2 O;  2LW7 A;  3J81 N;  4X66 O;  4JI7 O;  3J80 N;  5H5N A;  2VQE O;  1N34 O;  5LMN O;  3RT3 C;  1IBK O;  1XMQ O;  4DR6 O;  1FKA O;  4DV1 O;  4YY3 O;  5LMU O;  4GKK O;  4JYA O;  1YZB A;  3O65 A;  2JRI A;  1N33 O;  1F7Y A;  5BR8 O;  3M8A A;  4LFC O;  4X62 O;  2UUC O;  2UUB O;  4DV6 O;  4JI0 O;  1XMO O;  3T1H O;  2F4V O;  2FKX A;  3R66 A;  2E5L O;  4LFA O;  1DK1 A;  4DV5 O;  2UUA O;  4DV0 O;  4GKJ O;  4DR3 O;  4DR1 O;  5BY1 A;  1J5E O;  4JI8 O;  4NXN O;  1NS1 A;  1X59 A;  2Z0A A;  4B3R O;  2UXB O;  5LL6 Y;  4DR7 O;  3SDL A;  1N36 O;  4JI6 O;  5FLX N;  1AB3 A;  1FYJ A;  4X65 O;  3OTO O;  4DV2 O;  1G1X B;  4NXM O;  1D2D A;  2ZKO A;  3JAM N;  4YHH O;  1XEQ A;  2HHH O;  2DOS A;  4JI5 O;  1HR0 O;  4DV4 O;  2DJV A;  1XNR O;  4LFB O; 
#chains in the Genus database with same CATH topology
 3QJ3 A;  3MHH C;  4QIW F;  2ZR3 A;  5IWA O;  1M93 A;  4CDF B;  2Y0I A;  3WG7 B;  1CTE A;  4JAA A;  3F7Y C;  4QRX A;  3CRM A;  3L74 H;  2YEV A;  1IXB A;  3ZHU A;  1Y74 A;  3HKE B;  3W30 A;  4FLX A;  4MVU A;  2ITC C;  3BY4 A;  3U10 A;  1MA1 A;  3S3X A;  1KUQ A;  2YEV B;  2QTO A;  1AJN A;  1FJG O;  2QJ1 A;  4CBC A;  1R6T A;  1K4C C;  3UKM A;  2UXD O;  3R65 A;  5AG2 A;  4JI4 O;  1R1B A;  4DUZ O;  1B04 A;  1SQQ H;  4CC5 A;  3HB3 B;  2YUA A;  1PV0 A;  2IU0 A;  3DGE A;  2ZM6 B;  1XDC A;  1OCO C;  3MHS A;  1EBO A;  1VQ5 V;  3CME V;  1HNZ O;  4PA4 A;  4L8J A;  4AXM A;  3ABT A;  4OX9 O;  1GTO A;  1J5E B;  1N4C A;  2QWN B;  3JCU Z;  1PPP A;  4K7C A;  3IJ4 A;  1F51 A;  4B3R B;  4CH6 A;  4D7S A;  2UXC O;  3O0U A;  3MAQ A;  1QDQ A;  3GWK C;  4I05 A;  4BIZ A;  1WB8 A;  4PJ0 Z;  5EYP A;  2RJZ A;  4D8I A;  2HEP A;  4FFB B;  1NLJ A;  5KAF Z;  1L0L H;  3CBK A;  3L71 H;  5B3S B;  3E83 A;  2QA4 V;  5JZE A;  5EYP B;  4IUM A;  4X64 B;  3PT2 A;  4QBB A;  3RGB A;  5EZY B;  1U5I A;  2F1G A;  2UUB O;  3ZX6 A;  4MVZ A;  3P32 A;  1K8A W;  4A5U A;  2DC7 A;  5DEC A;  3U0Z A;  4IP3 A;  1Q7Y W;  2UUA O;  4U3J A;  4DR3 O;  1SES A;  2R9F A;  4B3M B;  3CH3 X;  3RVY A;  3ICX A;  1GCB A;  4U3J B;  3N2G B;  1H38 A;  1LUV A;  3ZN0 A;  4X89 A;  3UT5 A;  1RSO B;  4DV2 O;  4K3A A;  1XBL A;  1JR9 A;  3F7V C;  3OF9 A;  1WA8 B;  4JI5 O;  2PY5 A;  3AG1 C;  3T4Z A;  4DR4 B;  4EKW A;  4YIP A;  3MD0 A;  4GYC B;  2CAZ C;  3I3T A;  4XDJ A;  1CP9 A;  4I5S A;  1HNW O;  3FB8 C;  2AVW A;  5LOV B;  1VF6 A;  3UO3 A;  5H2F Z;  1Z5W A;  4YY3 B;  1BL8 A;  1QU7 A;  4PDL A;  2Q4P A;  3ETG A;  5CA0 A;  4O2A B;  4PDM A;  3L75 H;  2QWO B;  3PDF A;  1J95 A;  4J7J A;  2OYQ A;  4QPK A;  4BW9 A;  1K7D A;  1TAE A;  3ASN C;  1PPO A;  3J7A U;  1NR7 A;  4OGQ B;  4DW1 A;  3K9S A;  3E35 A;  4O4I A;  1MAB G;  4JF3 A;  1YIT V;  4KXR A;  2QGN A;  5C8Y A;  3RYF B;  4O4I B;  4CDC B;  4MVR A;  2WLL A;  3DF0 A;  1GN3 A;  3WG7 C;  3C9E A;  3SYC A;  2NN4 A;  3LFY A;  4IHJ A;  5CN0 A;  1ZSP A;  2MW2 B;  4BIO A;  4YJ2 A;  4PP2 E;  4ZBM A;  4UUJ C;  5GTH Z;  5JH3 A;  2HD5 A;  1HP8 A;  2QTS A;  3IC9 A;  4R50 A;  1DGS A;  1Z5V A;  2WLI B;  2P6J A;  3ZN1 A;  4GUA A;  4UV8 A;  2UUC O;  5H6Q A;  4X20 B;  3CRA A;  3H1K H;  2FRQ A;  1B06 A;  1DK1 A;  4EFE A;  2HVJ C;  3STZ C;  2E00 A;  1R3K C;  4J10 A;  5BY1 A;  5B66 Z;  4LFB B;  1AR5 A;  2HFE C;  3ABM B;  3M99 B;  4FLY A;  2WWW A;  3HKB A;  5B1B B;  3OIS A;  3RN4 A;  2OT5 A;  3OTO O;  1G1X B;  4DYL A;  1GN6 A;  1KP2 A;  1G8M A;  4LP8 A;  4B08 A;  1K5S A;  4ICG A;  4P6E A;  1PM9 A;  3N2K B;  3OD4 A;  5B3S C;  1QBZ A;  2IBI A;  3BY6 A;  3SYA A;  4WFB V;  1JQP A;  3BEH A;  4GZR B;  3TCU A;  4JYC A;  2GSM B;  2W6I G;  3ZMT A;  3UQ8 A;  5KHH A;  1YXB A;  2NQA A;  4PHZ A;  1GM7 A;  2XU4 A;  2CH7 A;  4E2L A;  1SQB H;  3SJA C;  4LF4 O;  1URF A;  5DM6 V;  4TQD A;  5IJ0 B;  1W0K G;  2CH7 B;  3HR0 A;  1XL6 A;  5FNV B;  2YJ9 A;  2K9P A;  2R9M A;  4JI1 O;  1N33 B;  3T1Y O;  2VWJ A;  4DK0 A;  5JJJ B;  3UM7 A;  2NQI A;  5JCO A;  3OVZ A;  1IZ3 A;  3ZRX A;  3KSE A;  4LFA B;  4RAI A;  2P86 A;  4I9Q A;  4RNA A;  2X6C A;  3RBZ A;  4ASU G;  1AYU A;  4LC1 A;  2IPP B;  2RNB A;  2CUG A;  2XTA A;  4UCR A;  1OJH A;  1QOL A;  4OEL A;  2E3C A;  1AIL A;  2GUZ A;  3APQ A;  3KCY A;  2WBF X;  4HXD B;  3IMA A;  1FFX A;  1QLE B;  1YSC A;  2WAM A;  4FLU A;  1N34 O;  3LXS A;  1U97 A;  3RFR A;  3CXH F;  2VWK A;  5KO3 A;  3CC4 V;  3OTF A;  2UZJ A;  4LFC O;  1UJW B;  3BBA A;  4U7O A;  1MS6 A;  3UCS C;  4PDR A;  2FKX A;  3T1H O;  1YK8 A;  1H2S B;  3ZRV A;  2Z5U A;  2YS8 A;  3PRM A;  3DXR B;  1AI5 A;  1Y67 A;  1H8E G;  3JAW A;  2EZP A;  2VRZ A;  4QJF B;  3CB2 A;  1DTO A;  1AJQ A;  3CXC U;  5CVM A;  3A0H Z;  3JSN A;  2BOB C;  3N3G A;  2NLJ C;  3OEE G;  3CC2 V;  1UFI A;  4NXM O;  2H8P C;  1Q5O A;  4AIL C;  4BS6 A;  3SPH A;  1EWM A;  4B3T B;  1Z2G A;  1RPR A;  2DOS A;  1PE6 A;  2AUZ A;  1KQS U;  3HKD A;  1KHP A;  3RYI A;  1VQK V;  5FPW A;  2QKA A;  1I0H A;  2NQD B;  3SPJ A;  1PP9 H;  1THZ A;  1TLO A;  3RYI B;  1QHT A;  1S5J A;  1D5A A;  1IBK B;  1XMQ B;  5KLV H;  4WFH A;  1PXV A;  3PHX A;  1K3E A;  2QWR B;  3CCJ V;  2FO5 A;  4E4E A;  1VQ6 V;  4XDK A;  1H2M A;  4O4J A;  3ABM C;  4DV6 B;  3D6S A;  5CHV A;  1OHH G;  3I5D A;  4HBN A;  1XMO B;  5B1B C;  3RYC B;  1AR4 A;  1SQX H;  3RYH B;  2PAD A;  4RKX A;  2Q69 A;  1Q86 W;  5F02 A;  1LNQ A;  3KWB X;  4BOP A;  1M56 B;  3G71 V;  3T1C A;  2G6D A;  1VQN V;  1TA8 A;  3K03 A;  1K34 A;  5J2U A;  1BCC H;  4MTO A;  3EFF K;  2ACT A;  2P7U A;  3U8E A;  1WLE A;  4MSW C;  5J2U B;  4EEQ A;  3CCM V;  2M6Y A;  1BGO A;  4UVC A;  3OT7 A;  4X66 O;  2P06 A;  4XZX A;  2R9O A;  4U7N A;  2GDS A;  5CB4 A;  1SKV A;  3IGA C;  3W7U A;  4D6T H;  3KCX A;  4BS5 A;  2R72 A;  3ETD A;  1QMY A;  4LF6 B;  3TRK A;  5L3F A;  3G67 A;  2KG7 B;  3PHU A;  4NR1 A;  2ZNI A;  4X1Y A;  1KD1 W;  3MTN A;  4OVZ B;  3ZIA G;  2F7D A;  2R9R B;  1H2L A;  2XOK G;  4ZOL A;  4GX0 A;  1FAF A;  3EHB B;  1BQI A;  2JDI G;  3CCR V;  4ZTB A;  2AHY A;  2ZNJ A;  3BA9 A;  3SYO A;  2BOC C;  1ZL8 A;  3ZMV A;  2HHN A;  5L3G A;  3SYP A;  2N04 A;  1R6N A;  2JGD B;  5JVD A;  1CS8 A;  2ATK C;  5FLX N;  2UU9 B;  1PNK A;  4X65 O;  1AB3 A;  4TT3 G;  1N8R W;  3AI8 A;  3B21 A;  2KSD A;  3V6E A;  2YXY A;  1QLE C;  4Z1M G;  1THE A;  4QRG A;  2B1M A;  4I4T B;  4OPH A;  1MEM A;  1XUQ A;  4FZ0 A;  5K1P A;  2XHB A;  4H33 A;  1I08 A;  1Q8I A;  2J7Q C;  1GLO A;  1ROP A;  2DZY A;  1PVJ A;  5BMV A;  2AHZ A;  1ICF A;  2R9I A;  1SQF A;  2W6J G;  4BPV A;  3FAV A;  1XQ8 A;  4FLZ A;  1K73 W;  2ZXW B;  2LFR A;  1W0J G;  2B1G A;  2CGN A;  3BPZ A;  4EFB A;  5CBF A;  5LP6 B;  4DXW A;  1NVP D;  1BY8 A;  2AU1 A;  2X6B A;  1IUR A;  3P5X A;  3RVW A;  2R9N A;  5BXZ A;  2GTS A;  2ZCE A;  2D2C B;  2DJG B;  3ERV A;  1OCR B;  3LSU A;  5EK0 A;  3E8H A;  5FPR A;  5J94 A;  4W4L A;  3FB5 C;  3CCU V;  2IJH A;  4QRV A;  1K97 A;  2ADP A;  4B3S O;  3HHA A;  2NQG A;  3B09 A;  1E1R G;  3IC7 A;  1OV9 A;  4Z2W A;  3QSD A;  4R3D A;  1GM8 A;  2F66 C;  4CS4 A;  1VQO V;  4JGS A;  2H7J A;  4JAV A;  4GKK B;  4DV3 O;  2ZDI A;  4WF9 V;  1Y76 B;  3D3Q A;  2JGU A;  4WBN B;  1S0V A;  5CA1 A;  2DZZ A;  1S5H C;  1KHQ A;  2HHH B;  3FB6 C;  1YI2 V;  1EZJ A;  1NVP B;  2JS5 A;  1VQ8 V;  4BR6 A;  2WLJ A;  2VS0 A;  2ILM A;  3TJT A;  2B5U A;  1FXK B;  1KP3 A;  3ZCC A;  2R70 A;  2E5L B;  2DQ0 A;  2KB1 A;  1SA0 A;  4Q20 A;  3VQY A;  1NT2 B;  4UCO A;  4P6G A;  2FTK A;  1E79 G;  1EN4 A;  3ZJZ A;  4GUN A;  1EM1 A;  4PEL A;  2Y4U A;  5C93 A;  1SA0 B;  1HUC B;  3DSQ A;  3Q4H B;  2BTO A;  2F4V O;  2BTW A;  2CDY A;  1SZX A;  5LYJ B;  2LFS A;  2UXD B;  2JVD A;  2Q73 A;  5EC1 C;  5K16 A;  4DMX A;  1M56 C;  4LWS B;  4DUZ B;  1Q6H A;  2BTW B;  1PPJ H;  3FYI B;  5EBM C;  3W31 A;  4IIJ B;  4ZKI A;  3SDL A;  4IYH A;  1FFT B;  2UXN A;  1TUB A;  1L8D A;  4PDV A;  3K8U A;  2F1M A;  1HNZ B;  2B1I A;  3JAK B;  3K0G A;  2AIM A;  5LBQ A;  1AIM A;  3W7S A;  4FLV A;  2PYJ A;  2XU5 A;  1QVG U;  3HHI A;  4MZS A;  3HD3 A;  3USV A;  4KHP O;  1XOU A;  4QE7 A;  3N27 A;  1ZLZ A;  3MJ5 A;  3A8T A;  1WB7 A;  2JQG R;  2V7Q G;  4CZZ A;  3CMA V;  5EIB D;  1S5L Z;  3P3N A;  4NB5 A;  4K0K O;  4JTD B;  2WSS G;  3JSL A;  1WN7 A;  2LO1 A;  5IJ9 B;  2VQF O;  1OCC B;  1VJV A;  1K3B B;  3TXS A;  3QT4 A;  3OE7 G;  2E76 B;  4UVB A;  1ZUQ A;  3IFX A;  4FZ1 A;  5JQG A;  1XNQ O;  5CBH A;  1M4U A;  2DWD C;  4ZHQ B;  1EWO A;  6PAD A;  1FH0 A;  2UUA B;  4JAU A;  1DEU A;  4G2K A;  1M5I A;  2V4D A;  4DRX A;  3SGI A;  3AK1 A;  3PRP A;  1JX9 A;  1Q6U A;  3WXG A;  1RP3 B;  4DV1 B;  1BQZ A;  1VIB A;  1BP4 A;  1Y74 B;  4MVO A;  2P90 A;  2CB5 A;  3ZMS A;  5IYZ A;  4JTA B;  2AGA A;  4O2B A;  4DV2 B;  1SF9 A;  1NU1 H;  1CB5 A;  3ZMZ A;  5KX5 A;  3GB7 C;  3E8G A;  3B40 A;  3ZHR A;  4YXW G;  2P4V A;  4JI0 B;  3RT3 C;  2YIB D;  5IDJ A;  2ZXW C;  1KYO F;  3ZRW A;  5LP6 C;  1GN4 A;  4JYB A;  4GKJ B;  2F43 G;  2JQF R;  1SQP H;  3E2E A;  4NXN B;  1HNW B;  1OCR C;  4I50 A;  4UCV A;  3EXA A;  1FS0 G;  2Z84 A;  3ETE A;  3R66 A;  2H94 A;  2WLK A;  3I56 V;  3ZUA A;  2Q7H A;  5IY5 B;  1NJI W;  3ZS8 C;  2YIB A;  4MVM A;  2V1D A;  2WLH A;  2JS3 A;  3X2Q B;  4DR7 O;  4LF8 B;  2IH1 C;  5KMG A;  3FYE B;  4PV1 B;  1NQC A;  2PGG A;  1T5E A;  1LUW A;  3CS5 A;  1JMK C;  4F4L A;  2PTM A;  3H1J H;  4X1K A;  1YVW A;  3KFQ A;  3PN1 A;  4C7U A;  4DV7 O;  3CRC A;  1O9H A;  1FXK C;  3L73 H;  3ABK B;  2ARH A;  3BWK A;  1CV8 A;  2PBH A;  4A5U B;  5KA6 A;  1NBM G;  1VF5 B;  1WPX A;  2M7W A;  3OR7 C;  2IU3 A;  1AI6 A;  5KUK A;  4CH3 A;  4L87 A;  2GHY A;  2XU1 A;  4UXN A;  2Z3Y A;  1Y4H A;  3QG5 A;  2PZS A;  5HFL A;  1DF5 A;  2RMK B;  3QO7 A;  1NPZ A;  3S3W A;  2FE8 A;  2IJK A;  4DR5 B;  1SQG A;  5D5Q A;  3UT5 B;  1WP8 A;  1AYW A;  2ODM A;  2UUC B;  4X6I A;  3P5V A;  1F2B A;  3ETQ A;  1K92 A;  5KHI A;  4LF5 B;  4LF7 O;  3AK2 A;  4FVM A;  4UVA A;  1N0J A;  1NTM H;  2BSK A;  1GAX A;  1GM9 A;  3D3I A;  2YID A;  3CCS V;  4X88 A;  5LA6 A;  1S76 D;  1AI4 A;  3F5T A;  1YK7 A;  2XAH A;  1KFU L;  1PBH A;  3MTV A;  4JYA B;  2BSK B;  4H0L B;  4KUM A;  2ADQ B;  2ZM6 O;  2FT2 A;  1FD9 A;  1AP5 A;  3H89 A;  3OTO B;  5H6R A;  5LGT A;  2DQ3 A;  4DMY A;  4TSF G;  5CA0 B;  1F4N A;  3F5W C;  1F2A A;  5LMU O;  1NB3 A;  4RWU A;  4YYU A;  1R3I C;  1YT7 A;  4CDE B;  4R7C A;  3CE2 A;  3T4D A;  3JAS A;  1OCC C;  2EIJ B;  2Q68 A;  2QDO A;  1W59 A;  1K9M W;  1P49 A;  1P7G A;  1MOF A;  3E86 A;  2K1E A;  4LF4 B;  3JAS B;  1AEC A;  1SRY A;  4N79 A;  1AU0 A;  5C8Y B;  4YHH B;  3AG2 B;  3KKU A;  2E03 A;  2WA3 A;  4NTW A;  1L0N H;  1CXZ B;  2WLL B;  3LDE A;  3LNM B;  4OXS A;  5F2V O;  3T1Y B;  1XNR B;  1V9P A;  1MDW A;  4KFM A;  1DKI A;  1X59 A;  1KU9 A;  4IHJ B;  2CTP A;  1N36 O;  4YJ2 B;  3SJQ C;  4JI6 O;  3ABU A;  5EIB C;  2LGQ A;  3JD4 A;  4BOS A;  4GX5 A;  3E89 A;  2ZIO A;  1H2G A;  2JTC A;  4BSQ A;  4IT5 A;  5GON A;  3CJH A;  1VP7 A;  5IE9 A;  3IEJ A;  3L9D A;  2DCA A;  1AU3 A;  1XRE A;  2QWQ B;  3H1H H;  2XAG A;  3JAT A;  1PL0 A;  3MHS C;  3CJH B;  2GFO A;  1HWY A;  2XT9 A;  4J7Z A;  3B4S A;  4HAM A;  4LNU A;  1GMG A;  1N34 B;  3JD2 A;  1GMY A;  1BHA A;  1YVB A;  2A9H A;  2YIC A;  1A6R A;  2EIK B;  1JPX A;  3PW3 A;  1AI7 A;  1NB5 A;  4LNU B;  3HKB B;  4J42 A;  4FIP A;  4JI3 B;  5IY5 C;  3P5U A;  1IX9 A;  4LFC B;  4YJ3 A;  3DTU B;  2BDZ A;  2PRE A;  4BOQ A;  4H44 B;  3X2Q C;  4I07 A;  4YJ3 B;  5H9C A;  2ZQM A;  3MDS A;  1BGY H;  1BE3 H;  1FXH A;  5E6J A;  3T2M A;  5LMN B;  4FK5 A;  3G80 A;  4PA9 A;  3QF7 A;  4P9P A;  1QXP A;  4O4H A;  2O57 A;  2R9C A;  1A32 A;  3ABK C;  3SYQ A;  4RF1 A;  4JI2 O;  1UKF A;  3KWZ A;  4NXM B;  4I04 A;  1KKD A;  4JI7 O;  1CSB B;  4X62 B;  5H5N A;  4FLW A;  5L3B A;  2FB5 A;  1FKA O;  1I5Y A;  1NH2 D;  2Y69 B;  3JD3 A;  1NTK H;  2ITD C;  4UFZ A;  4I0X A;  5BR8 O;  1UPG A;  2BTQ A;  3IFU A;  4I7Z B;  2AW9 A;  2JEU A;  3H7D A;  2YXH A;  4D8E A;  3RVZ A;  1YJW V;  4ZI7 A;  2LGW A;  2G8J A;  1R73 A;  3BRC A;  4XDL A;  2PI4 A;  2GUZ B;  3IAY A;  4ZI7 B;  2H3O A;  2CE4 A;  2DC8 A;  2CTR A;  4DUY B;  2UXB O;  4BOU A;  1FFX B;  5KUM A;  1KBH A;  1FYJ A;  1VF6 C;  4WFA V;  3OAA G;  3H8B A;  3WB0 A;  2CTQ A;  1NH2 B;  5IYD O;  3E9S A;  3H1I H;  4LFB O;  4UCU A;  3ASO C;  3BCC H;  4FPP A;  5GTI Z;  4R8C A;  2BDL A;  4GT1 A;  1M57 B;  3P30 A;  1GRJ A;  4O4L A;  3H01 A;  2EIJ C;  3AK3 A;  4X66 B;  4JV5 O;  1COW G;  3APO A;  1ZTE A;  5CVO B;  3JAW B;  1JA8 A;  3OGI B;  3NHE A;  3GWO A;  1DF4 A;  3A2F A;  4X9Q A;  2IJJ A;  4AHC A;  2YJC A;  3AG2 C;  3K58 A;  4EB6 A;  1IBM B;  1CJL A;  3TNX A;  2Y0P A;  4X1I A;  2E02 A;  2IJI A;  1QVF U;  3K59 A;  1F4M A;  5EC2 C;  2PYL A;  3BPF A;  1Y6X A;  3QVN A;  4JAS A;  2G7Y A;  3BB7 A;  4PI3 A;  3FFQ A;  1ATK A;  1BS3 A;  2AYN A;  3K57 A;  3HKD B;  1AVM A;  4LR3 A;  2W0F C;  4QGP A;  3U11 A;  3JYC A;  3E22 A;  4DR6 B;  3SPI A;  1HNX O;  1P7B A;  3V6C A;  3C3S A;  4X65 B;  4QH6 A;  3J81 N;  4P30 A;  1U9V A;  3K5N A;  5KA5 A;  3IHP A;  4B7K A;  3S3R A;  5A9G A;  1ZIV A;  1PCI A;  3IV2 A;  1YJ9 V;  4TV8 A;  3CYO A;  1BZK A;  5KHK A;  3W7T A;  4MW3 A;  4O4J B;  2FYE A;  3VOU A;  2EIK C;  2RCV A;  3O65 A;  3RVV A;  1YHQ V;  5JWP A;  2RQ6 A;  1Q6I A;  4PD4 F;  3A0R A;  3CCL V;  2ZE6 A;  4FLT A;  3B2E E;  3VBB A;  4TOI A;  4MVQ A;  1W2B U;  4XUI A;  3B8N A;  1QNM A;  1QQC A;  2OUL A;  1MSW D;  4PAD A;  1STF E;  2JIZ G;  3D36 A;  1AU4 A;  3RVX A;  1N0N A;  1H2N A;  2A79 B;  5CB4 B;  4B3S B;  4HNA A;  4JZ2 A;  3CP1 A;  1XEQ A;  3K9M A;  2VHF A;  5EBW C;  4HNA B;  1I94 O;  3OUF A;  4DV3 B;  1MZF A;  4MI7 A;  4X1Y B;  2DN9 A;  1V55 B;  2Y69 C;  5JCO C;  4ZOL B;  4FM2 A;  4B3T O;  2ZE7 A;  5E79 Z;  1Q3E A;  4DR2 B;  3K3W A;  1ZL8 B;  2IH3 C;  5B1A B;  1IBL B;  4I55 A;  3CHX A;  1TUE B;  1PL4 A;  3MHH A;  3ZMU A;  5JVD B;  4F6R A;  2PI5 A;  1YAL A;  1EZV H;  4MTX A;  1PPN A;  1LR1 A;  1MEG A;  1X9Y A;  2OWO A;  1X4T A;  5IT9 N;  1KC8 W;  3O9O A;  1CEZ A;  3NR7 A;  2QEX V;  2VQE B;  1R3L C;  3P5W A;  2F95 B;  2E74 B;  5BMV B;  3CD6 V;  3TXQ A;  4PI0 A;  1SS3 A;  1BHB A;  3FAV B;  2QR4 A;  1M57 C;  5LGN A;  5HFM A;  1CPY A;  2XU3 A;  1KKC A;  2AS8 A;  3KKY A;  4TUY A;  2EJ7 A;  3OMN B;  3H1L H;  4ZIB A;  1S77 D;  3BOW A;  1KMI Z;  1Y4M A;  2X6A A;  5L3C A;  1QR9 A;  1KEC A;  1F7Y A;  1QCE A;  3LUT B;  4FM1 A;  4JI8 B;  3JAR A;  5JH7 A;  1V54 B;  2NNU A;  3CC7 V;  3CPW U;  5K1X A;  3SR2 C;  1K33 A;  2JJ2 G;  4DR1 O;  3K24 A;  5JH7 B;  1XIL A;  2GV9 A;  1MHW A;  1JJ2 U;  1ZCM A;  2FTD A;  3AG4 B;  2Z0A A;  2DYS B;  5CA1 B;  5IWA B;  1CVZ A;  5LXT A;  2WLM A;  5LXT B;  1EN5 A;  2JJ1 G;  2YJ2 A;  3CRR A;  1JFF A;  1SC5 B;  4YIO A;  3ZBH A;  2N74 A;  1N32 O;  4WA6 A;  4AQY O;  2Q0O C;  1FJG B;  1TGO A;  2QWP B;  1XL4 A;  2A0L A;  4JI4 B;  2UU9 O;  2B1N A;  3C90 A;  1NQT A;  5KHJ A;  1CPJ A;  1RFY A;  3STL C;  3HKC A;  2ZE5 A;  4DO2 A;  4LF9 O;  3WB2 A;  2P0R A;  4FFK A;  3W7X A;  4QPJ A;  2L35 A;  3RWR D;  3LSS A;  4OX9 B;  3H8C A;  2Q6A A;  2OCC B;  1TUB B;  3TMP A;  4MTG A;  2FRA A;  2UXC B;  2FQ9 A;  2A3Q A;  3THO A;  1JCH A;  5IYC O;  4W4U A;  3OF8 A;  2YI8 A;  2XUM A;  3OEH G;  5J9P C;  3E1Z B;  3ZNH A;  2HVK C;  5ITZ A;  1BT8 A;  5BZB A;  1WPB A;  3OM3 B;  3BPM A;  3ZED A;  3BAB A;  4RQE A;  4DR7 B;  1KXR A;  1TU6 A;  1M6D A;  3CRQ A;  1V55 C;  5L3D A;  1MNG A;  1NL6 A;  1PAD A;  2X0L A;  2ATO A;  4TV9 A;  2UUB B;  2HWK A;  2BU3 A;  4LH7 A;  4GKK O;  3FD9 A;  5B1A C;  3RNV A;  2CIO A;  1ME3 A;  4HZ3 A;  3SJC C;  5JQG B;  5J2T A;  5A24 A;  4YVA A;  4DR3 B;  1XHZ A;  4W5B A;  2N05 A;  4OW0 A;  3JD0 A;  3ML0 A;  4CC6 A;  1AP6 A;  4DRX B;  7PCK A;  2EIL B;  4UV9 A;  2E5L O;  3CCV V;  2R9A A;  4DV5 O;  3HKE A;  4DV0 O;  4K35 A;  2PNS A;  5EGW A;  3F75 A;  4N21 A;  4JI5 B;  2WLN A;  5IYZ B;  4O2B B;  3OMI B;  4QE9 A;  5KX5 B;  2Q5Z A;  4W5C A;  1U9W A;  4BWA A;  5L3E A;  3LDD A;  5LHH A;  3JCZ A;  1KFX L;  4LF7 B;  4MTF A;  1SET A;  2GTA A;  5B5E Z;  2A06 H;  3ZRW B;  5E1A C;  2Q8V A;  2FL4 A;  1HR0 O;  2P7T C;  2DJV A;  4DV4 O;  4NTY A;  2EUL A;  3KX1 A;  4I50 B;  2IM9 A;  1Y08 A;  4Q8G A;  2LP7 A;  3ZHQ A;  4YYR A;  1PNL A;  4RUE A;  1H2K A;  1EWL A;  2IW5 A;  1Q82 W;  1V54 C;  2Q7E A;  3B77 A;  5LMU B;  4FFB A;  3K9A A;  2ETN A;  4X6J A;  2XAS A;  2Q67 A;  5DN6 G;  3IUT A;  2ZDI C;  5CHT A;  5KMG B;  2D3O W;  3AG4 C;  1S4V A;  3W7W A;  2DYS C;  4J41 A;  4G27 B;  2GBO A;  4X1K B;  5EZY A;  2YXL A;  3WU2 Z;  1ORQ C;  1AR1 B;  4PA7 A;  4J80 A;  3CCQ V;  1OCZ B;  1EF7 A;  1IVS A;  2G8E A;  1XKG A;  3K0D A;  2DCB A;  3TET A;  4W4K A;  1N36 B;  3FX7 A;  4DK1 A;  4JI6 B;  4PP1 A;  3OUS A;  3KZI Z;  1VEW A;  1YTF D;  3OR6 C;  1VMG A;  3N2G A;  1HW7 A;  4UCT A;  3ABL C;  4CH4 A;  4AXL A;  1RSO A;  1AJP A;  2BE3 A;  3BVO A;  1VF7 A;  2DCC A;  4DV1 O;  3KW9 A;  2CK3 G;  1KB9 F;  1WA8 A;  2OZ2 A;  4HWY A;  1YZB A;  3GCB A;  2QM7 A;  2XAQ A;  2FML A;  2OCC C;  1GH6 A;  2LJ2 A;  3OMA B;  4JI0 O;  4PI2 A;  4J7K A;  4MZO A;  4CH5 A;  3BA8 A;  2EBO A;  5LA6 B;  2YDE A;  5B1O A;  1ZAU A;  1JOY A;  4GKJ O;  5LOV A;  1I7F A;  4Q8H A;  1J5E O;  3ASO B;  4NXN O;  1NS1 A;  1S3J A;  1R3J C;  3BC3 A;  1YTF B;  2CTW A;  4B3R O;  3F5V A;  1Y66 A;  4PA3 A;  5LL6 Y;  4FJC A;  4O2A A;  2JK5 C;  2EIM B;  3S3Q A;  2JEX A;  1AU2 A;  1D2D A;  4N8W A;  4D8B A;  2XAJ A;  1VQ7 V;  2GHU A;  1RPO A;  1GO3 F;  2HG5 C;  2AZ2 A;  4CZW A;  3K5O A;  4X64 O;  2BCC H;  4LF8 O;  8PCH A;  2W0X A;  4G54 A;  4JI2 B;  4JI1 B;  2QKS A;  4UB8 Z;  2OIE A;  2YC0 A;  4JI7 B;  2YJ8 A;  1ZWI C;  4KL1 A;  3RYF A;  4WFF A;  3ZHV A;  2LW1 A;  1JVM A;  4ABM A;  2EZO A;  2EJR A;  2EIL C;  4BQV A;  4KP4 A;  2AUX A;  1BSM A;  1MIR A;  2LQT A;  3JD1 A;  3L72 H;  3OGC C;  4XBF A;  5BR8 B;  2R6N A;  3UO2 A;  3HWN A;  1WP7 A;  4B3M O;  1S72 V;  1VAR A;  4Q6G A;  4YYQ A;  2WLI A;  1SNK A;  2P67 A;  5GON B;  4X20 A;  3K5M A;  4WCE V;  4DR5 O;  3A0B Z;  3JAT B;  2FYU H;  1G4Y B;  3WXE A;  5EZS A;  4DR4 O;  3ZHT A;  2UXB B;  5CMU A;  2IBZ H;  1GK9 A;  4U3F H;  1SP4 B;  2DW4 A;  4LF5 O;  2DMX A;  4LH6 A;  3B8M A;  2DYR B;  4UB6 Z;  1H8H G;  3M99 A;  1L1F A;  2AYO A;  4P9O A;  3T1H B;  4MM3 B;  3LSQ A;  1F2C A;  4YY3 O;  3PNR A;  4JYA O;  3CBJ A;  4Z1V A;  5CVN B;  3N2K A;  4HYO A;  4DW0 A;  4RF0 A;  1NZ6 A;  4NKG B;  3M8A A;  3SPG A;  3PSE A;  4JV5 B;  4YV8 A;  1JJO A;  2OIG A;  3BAA A;  1EFR G;  4RY2 A;  4TQF A;  1NR1 A;  3SJB C;  2F23 A;  2DC9 A;  4BAY A;  1M1K W;  3H9V A;  2HJD A;  1OCZ C;  4O4H B;  1P84 F;  5IJ0 A;  4NTX A;  4PA6 A;  3MOR A;  3M7M X;  3ZHS A;  5FNV A;  5EBL C;  1DF0 A;  9PAP A;  1PNM A;  2ZE8 A;  2DE0 X;  5EZQ A;  2HJF C;  4JTC B;  2C2A A;  2RN9 A;  4YHH O;  2PUS A;  4H37 A;  5PAD A;  1XNR O;  1XI1 A;  4I0X B;  1CQD A;  2BTQ B;  4JZG A;  1OZ0 A;  3B79 A;  3K06 A;  1HNX B;  3WXF A;  3RW0 A;  2O6X A;  1BMF G;  5LHG A;  3DC6 A;  1B3Q A;  5LGU A;  3PBH A;  1D5N A;  2YJB A;  4BW5 A;  2Y6E A;  5CBG A;  2KKW A;  1B6Q A;  1ARO P;  2ARY A;  2HXZ A;  1GEC E;  5DED A;  1Q90 D;  2OTJ V;  3C3T A;  4AI8 A;  1FPO A;  2WPD G;  2J7Q A;  2RDC A;  3KG2 A;  4KLB A;  2NR5 A;  1ME4 A;  2EIM C;  5FPO A;  4QNH B;  2EIN B;  3PJS K;  2Q0A A;  1GN2 A;  4FJC C;  4OPA A;  3OFN G;  4JI3 O;  1NI8 A;  2YIA A;  2XAF A;  4O4L B;  3FB7 C;  3DXR A;  4GX2 A;  2YSU B;  4IL6 Z;  1PIP A;  4K8Z A;  2ZT9 B;  4P2Z A;  4BIU A;  2P5O A;  3EVK A;  2HP8 A;  5LMN O;  4EB6 B;  3AG7 A;  4REZ A;  1I94 B;  4X1I B;  3K08 A;  3MP2 A;  1QR8 A;  1F23 A;  3OVX A;  2JRI A;  4YYS A;  4MT8 A;  5B1N A;  1N33 O;  2QE7 G;  4X62 O;  1U9X A;  4IYI A;  1IWD A;  4JYY A;  1SQV H;  4MSX A;  3I55 V;  2OTL V;  4GX1 A;  1U96 A;  4LFA O;  2HLD G;  3E22 B;  1K4D C;  1MG1 A;  4WFE A;  4J9Z B;  4RQF A;  1WNS A;  4MW8 A;  2DCD A;  2AZ0 A;  3VQW A;  4IGG A;  4NYK A;  4TV8 B;  4M0W A;  3VQV A;  1FXV A;  3CSX A;  1SER A;  2DYR C;  1MZE A;  2PF4 E;  5TIS Z;  3AG3 B;  3RYC A;  2DC6 A;  3RYH A;  1PKX A;  4FIP C;  2F93 B;  1QLN A;  4DUY O;  2C0Y A;  3N3K A;  3K79 A;  1I5X A;  4MVS A;  4LCU C;  4BOZ A;  4CS2 A;  2A7W A;  4NVP A;  5KAI Z;  5A2Q N;  4YYV A;  5JJE B;  2MK3 A;  1Q81 W;  4FK5 C;  3LDC A;  2ZIM A;  3TGU H;  1XHX A;  1P4R A;  3N4C A;  4RO2 A;  2KG7 A;  1YEW A;  4B7E A;  3D8C A;  5JJN B;  3CCE V;  3IOQ A;  2XND G;  3G6B A;  4OVZ A;  4DR1 B;  1VQ9 V;  1YIJ V;  2E01 A;  1IBM O;  1RM1 B;  4RUF A;  3CWB H;  5IYB O;  3E8B A;  2ZIN A;  4P16 A;  3OQC A;  1Q6K A;  3C0R A;  2QM8 A;  1E1Q G;  4FM0 A;  4FMT A;  4X8A A;  2OCH A;  2G38 A;  2KQX A;  2CGO A;  2Q7G A;  3AEI A;  4I55 B;  3LNN A;  2EX3 A;  2JGD A;  3QO8 A;  3QO5 A;  3WFV A;  4F6R B;  1IBK O;  2F4V B;  2P4K A;  1XMQ O;  1N32 B;  4DR6 O;  4AQY B;  2L6L A;  1IXM A;  3BFR A;  5GW7 A;  3H6S A;  5FL7 G;  2QKC A;  4I4T A;  1EWP A;  5JA7 A;  4DV6 O;  1XMO O;  4LF9 B;  4OEM A;  2HH5 A;  2B9Z A;  1AYV A;  1VQL V;  4J9Y B;  2EIN C;  5LHI A;  3WB1 A;  2WA4 A;  1TVK A;  1NTZ H;  4CS3 A;  3G6E V;  3L70 H;  1WJZ A;  5LP6 A;  4KHP B;  1VQP V;  3ZRS A;  4TUY B;  1TVK B;  1OCO B;  3HPL C;  4LBE C;  4JPR A;  1YF2 A;  1YJN V;  2ZKO A;  3JAM N;  3CX5 F;  1DLB A;  1IDS A;  4GCZ A;  1NKD A;  1VSN A;  3TK1 A;  2P22 C;  1O9G A;  4H13 B;  3OW2 U;  2Q9L A;  4K0K B;  4ZUX U;  1HDJ A;  3JAR B;  3QTC A;  3K5L A;  2VQF B;  3BCN A;  4LF6 O;  2HR3 A;  2OP3 A;  3P3P A;  1VQ4 V;  2DWE C;  2HKO A;  1ITO A;  1Y76 A;  1XNQ B;  2AXT Z;  4F6E A;  3VQX A;  2QSA A;  4WBN A;  2FUD A;  4J11 A;  4WFG A;  1YDX A;  1US6 A;  3G4S V;  4X6H A;  1YCI A;  4N23 A;  4R6Z A;  1FXK A;  4YYW A;  4G28 B;  5CA3 A;  3E8F A;  2QM4 A;  2YI9 A;  4I9W A;  4DR2 O;  1JFF B;  2X7R B;  5EF4 A;  1IBL O;  1M9N A;  1JQ0 A;  4TWK A;  4DV5 B;  2DJF B;  1U9Q X;  4DV0 B;  3Q4H A;  4CDD B;  3ABL B;  3AG3 C;  4GLX A;  1MSD A;  3PHW A;  1R6K A;  1EN6 A;  5LYJ A;  4LWS A;  3HKC B;  1WAZ A;  1MMM A;  2LW7 A;  1M90 W;  2Y4T A;  4IIJ A;  3J80 N;  2VQE O;  1G6U A;  1TL9 A;  5KHG A;  1HR0 B;  4DV4 B;  4K8X A;  2UXX A;  1ZX3 A;  3AG1 B;  2Y48 A;  1O0E A;  1PPD A;  3JAK A;  3CH2 X;  4N4Z A;  1VQM V;  1Q43 A;  3D36 C;  1BQ0 A;  3NXS A;  3QNE A;  5D5P A;  3GVM A;  3O1G A;  1POP A;  3FKS G;  4WUR A;  3SPC A;  3BHP A;  2ZR2 A;  4D7T A;  5ITZ B;  4UCS A;  1F29 A;  3I06 A;  1K5Q A;  1PD3 A;  1ENV A;  2Y5B A;  3CEI A;  4JI8 O;  1RM1 C;  2ZD9 A;  4MS2 A;  4DV7 B;  1GKF A;  2E75 B;  3K04 A;  3JAL A;  4TV9 B;  5IJ9 A;  4PT5 A;  3ASN B;  4XR7 A;  1SZT A;  2VHS A;  3JAL B;  2HHH O;  3DC5 A;  5J2T B;  4ZHQ A; 
#chains in the Genus database with same CATH homology
 2N74 A;  2JTC A;  4DV7 O;  1N32 O;  4KHP O;  4OPH A;  5IWA O;  4AQY O;  1I94 O;  4DUY O;  4MI7 A;  4LF8 O;  4X64 O;  3MJ5 A;  2J7Q C;  2UU9 O;  4A5U B;  4LF6 O;  1PVJ A;  4BOZ A;  1HNW O;  4JV5 O;  4B3T O;  5A2Q N;  3W30 A;  3BY4 A;  4LF4 O;  4LF9 O;  1KUQ A;  3E9S A;  1FJG O;  4K0K O;  1R6T A;  3PHX A;  2UXD O;  2VQF O;  4JI4 O;  2FE8 A;  1R1B A;  4DUZ O;  4JI1 O;  3T1Y O;  5BXZ A;  4B3M O;  3TMP A;  4BOQ A;  1XNQ O;  2J7Q A;  4DR2 O;  5IT9 N;  3J7A U;  3BB7 A;  1IBL O;  4LF7 O;  4RKX A;  1HNZ O;  4B3S O;  4OVZ A;  4BOP A;  3ZNH A;  4OX9 O;  4DR5 O;  4OPA A;  5E6J A;  4JI3 O;  4RNA A;  3PRP A;  1IBM O;  3PHW A;  4R3D A;  3F5T A;  5EZS A;  4DR4 O;  3MTV A;  4P16 A;  4DV3 O;  2UXC O;  3OQC A;  1HNX O;  2ZM6 O;  3C0R A;  1A32 A;  1AIL A;  2AGA A;  4LF5 O;  4RF1 A;  4JI2 O;  1UKF A;  2LW7 A;  3J81 N;  4D8I A;  4X66 O;  4JI7 O;  4XZX A;  3J80 N;  2HWK A;  4HXD B;  5H5N A;  2VQE O;  2BU3 A;  1N34 O;  5LMN O;  3RT3 C;  1IBK O;  1XMQ O;  5JZE A;  4MM3 B;  4DR6 O;  1FKA O;  4DV1 O;  4YY3 O;  4REZ A;  5LMU O;  4GKK O;  4IUM A;  4JYA O;  3MP2 A;  3RNV A;  3PT2 A;  5KO3 A;  1YZB A;  3O65 A;  4BOS A;  4RF0 A;  2JRI A;  3TRK A;  1N33 O;  1F7Y A;  5BR8 O;  3M8A A;  4OW0 A;  2UZJ A;  4LFC O;  4GUA A;  4X62 O;  3IFU A;  3PHU A;  3PSE A;  2UUC O;  2UUB O;  4WUR A;  4DV6 O;  3BBA A;  4OVZ B;  4JI0 O;  2Z84 A;  1XMO O;  3T1H O;  2F4V O;  2FKX A;  4A5U A;  4D8E A;  3R66 A;  2E5L O;  2BTW A;  4LFA O;  1DK1 A;  3PRM A;  4DV5 O;  4IP3 A;  2UUA O;  4DV0 O;  4GKJ O;  4ZTB A;  4DR3 O;  4DR1 O;  5BY1 A;  1J5E O;  4JI8 O;  2BTW B;  4NXN O;  1NS1 A;  1DKI A;  1X59 A;  2Z0A A;  3W31 A;  4B3R O;  2UXB O;  5LL6 Y;  4DR7 O;  4BOU A;  3SDL A;  1N36 O;  4PT5 A;  4JI6 O;  4M0W A;  5FLX N;  1AB3 A;  1FYJ A;  4X65 O;  3OTO O;  4DV2 O;  1G1X B;  4NXM O;  5EZQ A;  1D2D A;  2ZKO A;  4D8B A;  3JAM N;  4YHH O;  1XEQ A;  2HHH O;  3B21 A;  2DOS A;  4JI5 O;  1HR0 O;  4DV4 O;  2DJV A;  1XNR O;  4LFB O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...