2AGAA

De-ubiquitinating function of ataxin-3: insights from the solution structure of the josephin domain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
190
structure length
190
Chain Sequence
GPLGSMESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIRVQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Deubiquitinating function of ataxin-3: insights from the solution structure of the Josephin domain.
pubmed doi rcsb
molecule keywords Machado-Joseph disease protein 1
molecule tags Transcription
source organism Homo sapiens
total genus 40
structure length 190
sequence length 190
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02099 Josephin Josephin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2agaA02
3.90.70.40 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2agaA01
4YHHO 3O65A 4X66O 4DR2O 1FJGO 4JYAO 3M8AA 4JI5O 3F5TA 5FLXN 1HNWO 2VQEO 4DR7O 4DV2O 1XMOO 5IT9N 1F7YA 4DV5O 1AB3A 4YY3O 3T1HO 4X64O 4B3SO 1FYJA 2UU9O 2LW7A 1R6TA 4DR5O 2F4VO 4OPHA 1AILA 4JI0O 4DR3O 1FKAO 2HHHO 1YZBA 4DR4O 1HNXO 4LF7O 2JRIA 4DUZO 2DJVA 4LF6O 2UXCO 1XNRO 5A2QN 2N74A 1IBLO 4JV5O 4DR6O 1HNZO 3J81N 2UUAO 4NXNO 3SDLA 1DK1A 4B3TO 2FKXA 1N33O 1N32O 4DV7O 2VQFO 4A5UB 4NXMO 2AGAA 2ZM6O 1KUQA 4JI1O 4DV3O 2UUBO 4LFBO 5BY1A 4DV0O 1XMQO 1A32A 5IWAO 1XEQA 4DR1O 4AQYO 2UXBO 3OTOO 3T1YO 4B3MO 3J7AU 5LL6Y 2DOSA 4GKJO 4JI6O 4DV6O 4GKKO 1I94O 2ZKOA 4X62O 3RT3C 5LMNO 4LF9O 4OPAA 1IBKO 3JAMN 4B3RO 4LF4O 4LFCO 3J80N 1N36O 2E5LO 5H5NA 2UUCO 4X65O 4DV4O 1XNQO 4KHPO 1IBMO 4JI7O 1HR0O 4K0KO 4LF8O 1X59A 1R1BA 4DV1O 5BXZA 4JI4O 4LFAO 5BR8O 1J5EO 1G1XB 1NS1A 4JI2O 4JI3O 4DUYO 1N34O 2UXDO 4OX9O 5LMUO 4JI8O 3R66A 4LF5O 1D2DA 2Z0AA
chains in the Genus database with same CATH superfamily
5LBQA 4R8CA 4YHHO 3PNRA 1YXBA 3HPLC 1YF2A 1FJGO 2UZJA 4FK5C 4LR3A 2BE3A 2BOCC 4DR2B 1S5LZ 3CRRA 1FPOA 3ABLC 3RYHA 3KCXA 4DR5O 4I7ZB 2B1GA 4U7NA 2JTCA 2VS0A 1FKAO 3JALB 2XTAA 4D8EA 1QQCA 3K3WA 3B79A 4Q6GA 4GX1A 2HP8A 1AU2A 4UCVA 2Q0AA 2V4DA 1YCIA 2WAMA 1YK7A 4QRVA 3LNNA 1PE6A 5CBGA 2XAFA 5DN6G 3B77A 5H9CA 3BOWA 1SRYA 4MVRA 4F6RB 2J7QA 1SF9A 2GUZB 3FYIB 4BW9A 2K1EA 1N33O 4MTOA 4W4UA 3TMPA 4WFBV 2IJHA 2OIGA 3CJHB 4DXWA 2EJRA 4ZIBA 4C7UA 2KB1A 4H44B 4DR7B 3AG2C 4F4LA 1YJ9V 1R3LC 4PA9A 3FB6C 2X6AA 4P9OA 4NXMB 1PV0A 3KZIZ 3LDEA 1XDCA 4JI1B 3OTOO 3QG5A 1GM7A 3P5XA 4G54A 1Y74B 4DR4B 4DV6O 3E2EA 4P30A 2FTDA 4O4IB 2XU1A 2YDEA 3JCZA 3CH2X 4X20A 2E76B 4FLWA 1W2BU 3WG7C 4Z1MG 4I5SA 3JAKB 4JI6B 5FPRA 5LP6B 1V55C 1AP5A 2HH5A 5B1AB 4XZXA 2ATOA 5LGUA 1UKFA 4MM3B 1PM9A 2CK3G 1YT7A 2UUCO 3USVA 3MHHC 3AK2A 1G8MA 4IHJB 4RY2A 4RUEA 1G6UA 4K0KO 5EGWA 1D5AA 1PXVA 2YIAA 1XMQB 1DF0A 3HKEB 2XOKG 3PHWA 4KL1A 1YEWA 3HKCB 1OCOB 5EC2C 2J7QC 3L72H 4CDDB 4NTXA 3ZMTA 5TISZ 1QOLA 5JJNB 5GTIZ 3U0ZA 3ML0A 2F7DA 2OT5A 2XAQA 2ZNIA 1HWYA 3OEEG 1KMIZ 1NR7A 2VQEO 4I4TB 3BPMA 3LSSA 4DR7O 4H13B 2P86A 1GAXA 5JH7A 4XDJA 2RN9A 2X6BA 5D5PA 4J7KA 3DC5A 1NTKH 1BGOA 1CPJA 2EULA 4WFGA 4P2ZA 4IIJB 1ZCMA 3OUSA 3HHIA 1SQQH 3G67A 4JI4B 2Y48A 5BR8B 1IWDA 4DR4O 1PVJA 4XUIA 3GWOA 1WLEA 3F7VC 3QO5A 7PCKA 2PF4E 3RYIB 3KCYA 3H1IH 3GVMA 3ZUAA 5LMUB 3K0DA 3BFRA 3N3KA 1AP6A 5FNVB 2PUSA 1NQCA 1GRJA 4JAUA 2FKXA 1O0EA 1NR1A 2ZQMA 5JCOA 2P4VA 4YIPA 5LYJA 2HHNA 4OVZA 2ZIOA 4DV3O 2AHYA 2XU5A 4WA6A 2FL4A 2EIMC 3JAWA 4GCZA 5FL7G 1XMQO 1KU9A 2QGNA 1OJHA 2ZR2A 1Q43A 3K8UA 4P16A 5EBMC 2Q4PA 2R72A 1K73W 1SC5B 5HFLA 2G8JA 4QRXA 2P6JA 4BIUA 3ZRSA 2ZXWC 2VHSA 3JSNA 5IJ0B 3E9SA 3OEHG 4CH4A 1M9NA 2GHUA 1CVZA 4BOUA 1AJNA 2GHYA 2Y69B 2UXCB 3D3IA 2GTAA 1TAEA 5DEDA 5D5QA 3BABA 1PPPA 2Q7GA 4ZKIA 3ZHTA 4UV9A 5K1PA 1XBLA 4LF4O 1Q81W 1SQGA 3CEIA 3B2EE 1H2NA 2PGGA 5KLVH 2EBOA 1YVBA 5LHHA 1Z5VA 1PNMA 4I9QA 1JOYA 4R50A 1VIBA 3BVOA 4N23A 2XUMA 3CMEV 3CB2A 2ARHA 2B1IA 2YICA 3RWRD 3K5NA 1NH2B 2EZPA 5KHGA 3ABKC 1GM8A 5BXZA 1NH2D 4JI4O 5BR8O 1JJOA 4H37A 3QSDA 1MEGA 3CWBH 2IJIA 4FLUA 5LMUO 2PYLA 1X4TA 9PAPA 4X62B 3H7DA 1DF4A 1SQBH 5JCOC 4MSXA 3OQCA 4PA4A 3JARA 4X1KA 2RNBA 1Q6HA 3ETQA 4WFFA 1WNSA 1R3KC 5FLXN 2ZR3A 5LA6A 3HKBA 3G6BA 2JGDA 3OAAG 1MG1A 1TUEB 2AW9A 4O4LB 4ZI7A 2LW7A 3ABLB 4W4LA 1TUBA 1Q86W 1MA1A 4BW5A 4I50B 3PHXA 2XAGA 4CZZA 2DCDA 1JFFB 5IYZB 2G38A 1SZTA 4FMTA 2IH1C 3H1HH 2UXCO 2WLJA 3K24A 1P7GA 3FD9A 2NR5A 3H6SA 4I05A 2ITDC 4NXNO 3ZNHA 1XHZA 5KHJA 1BCCH 3LSUA 4R6ZA 2K9PA 1K4CC 1KBHA 1Y08A 3U10A 1KUQA 3SPHA 1FFTB 2CGOA 2BDZA 4YY3B 4J10A 1H2GA 3DC6A 1POPA 2P5OA 3CCRV 4XR7A 5LL6Y 3I5DA 4GKJO 1OCCB 3CRCA 4GKKO 1AU0A 4X62O 1GM9A 3QNEA 4X9QA 1BQZA 2DJFB 1ATKA 3ETDA 4OPAA 3WG7B 4IT5A 4U3JB 2QDOA 1B06A 1H2LA 2E3CA 2XAJA 1F2BA 3H8BA 2NNUA 3AK3A 5JQGB 2LGQA 2GTSA 3JYCA 3ABTA 3OT7A 4W5BA 4FVMA 3AG3B 2N04A 2YJ8A 3UO2A 1BP4A 3RFRA 4FM0A 5IYCO 4K8XA 5CA0A 2DE0X 1WPBA 2ETNA 1EWOA 1L1FA 2ZE6A 4HAMA 1HDJA 4DV1B 5B66Z 2QTSA 1TVKA 4LFAB 1PADA 1XUQA 3OMIB 3F75A 4FZ0A 4JAAA 3HKDA 4OX9B 2R70A 4PDRA 5L3GA 4BOQA 4CS2A 4JYAB 4DV5O 4YY3O 1FXKA 3ZHRA 1YSCA 1WB7A 2WSSG 1FYJA 3JSLA 4PA7A 1GN4A 5DECA 3BB7A 1F4MA 3N2GA 1PPOA 5KUMA 2YEVB 1YDXA 4UCOA 3SPGA 3T1HB 2IW5A 3QF7A 4X64B 3GWKC 5IJ9A 4K35A 4OXSA 1K5SA 4X88A 4DUYB 4Q8HA 2QWOB 1NTMH 2BSKA 1K8AW 1K3BB 3HWNA 4Z2WA 3MP2A 4JV5O 3FKSG 1N4CA 2HFEC 2Y6EA 3AEIA 1YK8A 6PADA 3DXRA 4BWAA 3Q4HB 3PT2A 4DV2B 4LFBO 1FH0A 3SYCA 2FYEA 3ASOB 3PHUA 1U97A 5JWPA 2P4KA 3FAVA 3OFNG 2FUDA 3LUTB 1EM1A 3CCQV 2X6CA 1FXHA 4DUZB 2DQ0A 4PI3A 1LR1A 2BTOA 4LF9O 2V1DA 3WXGA 2OCHA 2EINC 1M5IA 5JH7B 1JQ0A 2LJ2A 5LMNB 2QWRB 1XL6A 1QLEB 3EHBB 1QNMA 1KP3A 2E5LB 3CCVV 4I07A 1MNGA 1TU6A 3PRMA 2CGNA 2CAZC 1QVGU 2R9MA 1NPZA 1VQNV 4FIPC 3APOA 4MVOA 2D3OW 2YJ9A 2KKWA 4MVSA 1P49A 1FFXA 2VRZA 2YS8A 3IC7A 2YXLA 4DUYO 2HD5A 1GLOA 3CD6V 3ZN1A 5LHIA 1D2DA 2HKOA 1YTFB 4L87A 3QVNA 4PP1A 4PADA 5LYJB 4OVZB 1JVMA 1YTFD 2F1MA 3BC3A 4BOPA 3JAWB 5EF4A 3TCUA 4YYRA 4LF5B 1STFE 3L74H 1QU7A 3FYEB 5KHIA 3K06A 3D36A 2QR4A 4X66B 1SP4B 1CP9A 3ZHUA 4DV2O 1EBOA 3CMAV 2LO1A 2A3QA 5BMVA 1U9XA 2F4VO 2HVKC 5KMGA 1KP2A 4IYHA 2PI4A 1RSOA 2IPPB 4LH7A 4DUZO 5CBFA 5A2QN 3GB7C 1F23A 4J9YB 3K0GA 4LF7B 3MTNA 1HNZO 2XASA 3LXSA 4QBBA 4BSQA 3BRCA 1N0NA 4JYCA 1AIMA 4WFEA 1S0VA 1Y67A 1BSMA 4B3TB 4H33A 2UUBO 4W5CA 5JZEA 3BBAA 1ICFA 4MVQA 1NU1H 1XEQA 4HBNA 4RQFA 1PL0A 4CDEB 4DMYA 2ZM6B 4REZA 1K92A 3F5VA 5B1OA 3T2MA 3CCEV 4X1KB 3L71H 1US6A 3OF9A 4FFBA 3RVWA 4NYKA 2A7WA 2PYJA 3K57A 5LA6B 3HKBB 3IUTA 4JF3A 4N79A 1B6QA 1BS3A 1NKDA 2UXXA 4EFEA 1H38A 3VQYA 1M6DA 4IL6Z 3IMAA 4ZI7B 4CH3A 2CDYA 5KX5A 2E01A 4FK5A 3I06A 4X1IA 2CTPA 1NZ6A 3H1LH 3A0HZ 3MJ5A 3SPJA 4LFCB 1H2MA 2EILC 1I08A 4KHPB 1X9YA 2YIDA 2DC8A 4TQFA 2Y5BA 3UQ8A 1N34O 1FAFA 5LGNA 5K16A 1VJVA 2YI8A 1P7BA 2DCBA 3D8CA 2IJKA 3AG1B 4HZ3A 1A6RA 1CQDA 1KC8W 2WPDG 4YYVA 3BEHA 3RN4A 3ABMC 3E86A 2OTJV 1BHAA 5CBHA 1XI1A 2AVWA 4FPPA 2EIJB 2IM9A 4TQDA 1ME4A 5IE9A 2VHFA 3FB7C 1ZSPA 1BGYH 1IURA 2QM4A 1KB9F 2P0RA 3JCUZ 1UPGA 4QPJA 5B1NA 2EIKB 2KSDA 3ZHSA 3LSQA 4D7SA 4B7KA 1AU4A 2CH7A 4B7EA 2BCCH 4FFKA 3ZMUA 3OVZA 2R9AA 4DR6O 2PBHA 3SDLA 4DO2A 1V54C 1FXVA 2JEUA 5EIBD 3JASA 3A8TA 5CA0B 3N4CA 3ZIAG 4MW8A 2HWKA 3WB2A 3NHEA 2BTWA 2Z84A 3SYQA 3MHHA 5KAFZ 4O2BA 3C9EA 3STZC 5C93A 1Z2GA 2ATKC 1GKFA 4WCEV 2Q73A 2E75B 1MABG 1VF6C 3AG4C 3X2QC 4MTXA 1VARA 1KD1W 2IU3A 5IWAB 4X8AA 1NVPD 1HP8A 4GUAA 4ZTBA 2JEXA 4X1YA 3FB8C 2Z3YA 2DYSB 2F43G 3C3TA 1FXKB 4NVPA 5L3FA 4AI8A 2HXZA 4DV7B 4YYUA 4CBCA 2O6XA 1K5QA 3N2GB 4GX5A 3BHPA 3CS5A 4J7JA 3JD0A 4MW3A 4CDCB 5IJ9B 1H2KA 4DV4B 5JH3A 3CBJA 1SQXH 1PP9H 4QGPA 4AQYB 1R1BA 2BSKB 5B1BB 1AI5A 3KKYA 2QKCA 1W0JG 1RM1B 1VQ5V 3ZBHA 3IFXA 4UXNA 3IV2A 1KKDA 3P5WA 3DXRB 2W6IG 2Z0AA 2E02A 2AUXA 1N8RW 1IBKB 4DR2O 3HR0A 4BOZA 4GX2A 4TOIA 3TETA 4X6JA 3M7MX 4D6TH 5J2UA 4XDKA 3IJ4A 4ICGA 1AB3A 2XAHA 2OCCC 5CHVA 1K9MW 5B5EZ 3BY4A 2MK3A 1GN3A 1ZIVA 1AVMA 2JRIA 3VQXA 2LP7A 2VWJA 1ZWIC 4JI0B 1SS3A 2AZ2A 3PRPA 5CA3A 1OCZC 4R3DA 1XHXA 4DV7O 4NXMO 1GO3F 1MMMA 5KUKA 1Q6KA 4JI1O 2OZ2A 2GFOA 3FX7A 3CC7V 1ME3A 1FFXB 1K33A 4AQYO 1BE3H 1SQPH 3E83A 2HJFC 2E00A 1MIRA 4JI6O 4GYCB 3KWBX 1U9QX 3KWZA 2ZKOA 2ADPA 1O9GA 5E79Z 5EYPA 2AS8A 4DYLA 3OMNB 1U96A 1T5EA 1IBKO 1Q6UA 2BDLA 5DM6V 3CXCU 2ZIMA 3WU2Z 4OW0A 5KMGB 3LFYA 1PPDA 1RSOB 2HEPA 1E1RG 5C8YB 1CXZB 2XU4A 4DV0B 1X59A 2YXYA 1Y4HA 3I55V 2DC6A 1I0HA 3BY6A 1THZA 1QLNA 1YIJV 3MHSA 1S3JA 2AU1A 3ASNB 4D8BA 5E6JA 1RPOA 2GV9A 3MORA 1Q5OA 3KX1A 2HR3A 4GX0A 2UXDB 3L73H 1FD9A 1SZXA 4PI2A 3GCBA 1G4YB 5CVMA 2ZD9A 5FPWA 4L8JA 2CTWA 4B08A 1KECA 3UKMA 4BIZA 4RAIA 1EWLA 2JIZG 4FFBB 1R3IC 4QRGA 3CRMA 3CPWU 1SETA 1Y76A 2CB5A 4NTYA 1EFRG 2NQIA 1XMOB 2QM7A 3JD3A 3SPCA 1ENVA 2YJCA 1HUCB 1QDQA 3WXEA 4G28B 3OR7C 3NR7A 5LOVA 4I0XA 4X1IB 2R6NA 1XQ8A 1VEWA 1Q8IA 3J81N 2GDSA 4LF6B 1XNRB 2L6LA 3H01A 2ACTA 3HB3B 3E8BA 5JVDA 2AGAA 4XDLA 4TV8B 2JJ1G 5BY1A 4DV0O 1N32B 3MHSC 1KFUL 1BMFG 4TWKA 4PV1B 3BCNA 3DTUB 4LCUC 2Q67A 1VMGA 2PADA 3BAAA 3MAQA 1MSWD 4JASA 3RVZA 1JJ2U 1M56C 1KHQA 2A0LA 5LGTA 4LNUA 2YC0A 2DYRC 3OVXA 3DF0A 4M0WA 3AG2B 1YJWV 5H5NA 2F95B 4E2LA 4B3RB 4Z1VA 1WN7A 1PIPA 4PT5A 2Y0PA 4HNAA 1XNQB 2NQGA 3G4SV 4X89A 2CH7B 5GTHZ 2DZZA 1HR0B 2LGWA 3RW0A 2F93B 4BOSA 3CC4V 3OMAB 3RYCA 3TJTA 3C90A 1V55B 2BU3A 3JASB 1O9HA 1B04A 2EZOA 3RYHB 2AHZA 2QWPB 4QIWF 4JI3B 2BTWB 3HHAA 2A9HA 1Q7YW 2JJ2G 3KKUA 4AHCA 1JPXA 1QHTA 4RUFA 4MTFA 1IZ3A 3I56V 4O4JA 4W4KA 4IUMA 4GUNA 5EBLC 2OCCB 1F2AA 3SJAC 1QXPA 3CRQA 3P5VA 1MEMA 1R6TA 1NI8A 5A24A 2NQAA 3D6SA 5B3SC 2C0YA 5IY5C 1YJNV 2DJVA 2E74B 5FPOA 1S5HC 3WFVA 2RCVA 2JVDA 1H8HG 2AXTZ 4YYSA 3ZHVA 1IVSA 2JDIG 1CTEA 2A06H 2QWQB 4WBNA 4YV8A 1DGSA 2ZINA 2P90A 3EVKA 1IXBA 1IBLB 2QA4V 2IJJA 3H8CA 1F4NA 1F51A 1UFIA 1D5NA 4FLZA 3IAYA 4X20B 4J7ZA 3K58A 2UU9B 3ZJZA 3L70H 3OTFA 3BPZA 1PNLA 4ZOLA 3SYOA 1KXRA 1ZAUA 4FIPA 2QWNB 2PI5A 3K04A 1VQOV 2H7JA 4LWSA 3G71V 5CA1A 3V6CA 5J2UB 5EZSA 3CX5F 1I94B 3P3NA 4JYBA 5LHGA 3CCSV 2EIMB 4QNHB 4PJ0Z 4NB5A 2CTRA 3W31A 3E8FA 4J42A 1WP7A 1S76D 3VBBA 2ZXWB 3W7TA 1VQ7V 4X6IA 4A5UA 1IBMB 5LP6A 2IBIA 4DV1O 2Q69A 3PJSK 4LFAO 2N05A 4H0LB 4WFAV 1CJLA 3ETEA 3T4ZA 4OX9O 2Q7HA 3OGIB 3R66A 4JYYA 4RO2A 3E22A 2RMKB 3CBKA 5IYDO 2Y4UA 3K9AA 2G8EA 3PDFA 3ZMVA 4AILC 5EZYA 3OW2U 1EN4A 4QE9A 4JI8B 4JYAO 2X0LA 1WJZA 4HYOA 3IHPA 5KHHA 3RBZA 1I5XA 4X65B 4CZWA 4DRXA 1XKGA 5F2VO 1H2SB 4JI7B 2F1GA 3G6EV 1I5YA 3ABKB 3T1HO 5LXTA 3SR2C 4X64O 2UU9O 2YUAA 4YJ2A 2HG5C 3QO7A 3S3QA 1AILA 1Z5WA 4I9WA 1VF7A 1AI7A 1J5EB 3B8MA 1GN2A 4DR3B 2BOBC 4I55A 1HW7A 3CP1A 5CN0A 1JMKC 1IX9A 5AG2A 1KQSU 3NXSA 4K7CA 3G80A 5LP6C 3CSXA 3RNVA 1Y4MA 5B1AC 4U7OA 5L3EA 3LDCA 1K7DA 1AU3A 4RNAA 2VQFB 3SJQC 3OISA 3CRAA 2ILMA 1P4RA 1KKCA 3W30A 5GW7A 1TGOA 4PA6A 4CC5A 2M6YA 2ARYA 2FYUH 1GK9A 1K34A 4DR1B 4PP2E 2UXBB 1OCOC 4B3MB 3RT3C 2PNSA 5LMNO 2OP3A 3O9OA 1OZ0A 2WLIA 3N2KA 3B4SA 3CXHF 4G27B 3RVVA 2E5LO 4EFBA 1Y76B 4X65O 3K9MA 5EK0A 2H94A 2ITCC 1BZKA 1MHWA 3W7XA 4JI7O 3E89A 2WA3A 4UCTA 3JARB 4F6EA 2F23A 1TLOA 2WLNA 3TK1A 5LOVB 4MVMA 4ZBMA 1IXMA 2NQDB 1J5EO 5H6QA 4HWYA 1L0LH 3JATA 2JGDB 4FZ1A 2WLLA 5A9GA 4LF5O 1VQ6V 4P6EA 5JVDB 1FS0G 1PCIA 1RPRA 1TUBB 2DWDC 2E03A 4X66O 1ZX3A 2YSUB 2Q8VA 3N27A 4JTCB 2DZYA 2ZE5A 4BIOA 1P84F 4YHHB 3H9VA 1FJGB 5PADA 4BAYA 2DCAA 2DN9A 4BQVA 1J95A 3KSEA 4P6GA 3S3RA 3ERVA 2EJ7A 1NBMG 2AUZA 3SYAA 4DW1A 4EEQA 3K08A 4LNUB 4LF7O 1VF6A 3LDDA 2XT9A 4JI2B 3F7YC 1K3EA 1K97A 1NT2B 4FM1A 1R73A 3AK1A 2DCCA 2YJ2A 2R9IA 2WWWA 2Y69C 4B3TO 1PBHA 4HNAB 2ZNJA 4TUYA 4JI5B 1JFFA 1GMGA 3ZCCA 5IYZA 1R3JC 2R9RB 2ZM6O 1PD3A 1N33B 1CEZA 4CH5A 2Q68A 4MTGA 2WLKA 1M1KW 2IH3C 2EX3A 3J7AU 2DOSA 3VQVA 1DLBA 3JD2A 1NLJA 1NTZH 1AR1B 3OTOB 1AJQA 4TV9A 4O4JB 3JD4A 2MW2B 4OGQB 5CB4A 2LW1A 3JAMN 4FLYA 3DGEA 1WAZA 4LFCO 1E79G 4O4HA 1COWG 3MTVA 2B1NA 1XREA 2CIOA 2IU0A 3BA9A 4KHPO 1Q3EA 3CHXA 1TVKB 2KQXA 2FO5A 1MZEA 4UCRA 5JA7A 1BL8A 2UUCB 1U9VA 3VOUA 1NVPB 1V9PA 3HKDB 1VP7A 4R7CA 1AYWA 1CSBB 3B21A 4BPVA 1YITV 4U3JA 3K59A 3ETGA 4K0KB 3QJ3A 3ZMSA 3ZRXA 5JQGA 4WBNB 4JI2O 5L3DA 2HLDG 2EINB 3IOQA 3P3PA 2M7WA 2QJ1A 4FJCC 4CS4A 5KA5A 3RVYA 4JI5O 2CTQA 3C3SA 5HFMA 1ITOA 2R9FA 5J2TA 1QMYA 4MZOA 2PTMA 1DKIA 2DC9A 4FLTA 3EFFK 4ZOLB 4DMXA 4J11A 1ZL8A 1VQ8V 4FLVA 4JGSA 3ZN0A 4JPRA 2IBZH 4LWSB 2VQEB 4EKWA 3TXQA 1AROP 3RGBA 1U9WA 1GH6A 5CA1B 2Q5ZA 3IFUA 2Y4TA 1YHQV 1NJIW 2C2AA 2WLMA 1WA8A 1XOUA 2Z5UA 4QH6A 4FLXA 2DWEC 3ZRWA 3P32A 2R9OA 2QEXV 2DMXA 2WLHA 1CPYA 3TNXA 1OCCC 1W0KG 4IP3A 3M99A 3OF8A 3WB1A 2R9CA 2OTLV 1RP3B 2XNDG 3FAVB 2JK5C 2YEVA 1OHHG 4A5UB 2F66C 2UXNA 4K3AA 1AR4A 4ZHQA 3OR6C 3RYFA 2JQGR 5IWAO 4WF9V 3A2FA 4UV8A 4RF0A 3AG3C 2JS5A 3E22B 1Y66A 1XILA 4DV3B 4YYQA 1AJPA 5GONA 5EZYB 5KA6A 3ZX6A 4GT1A 3Q4HA 3BCCH 2L35A 4ABMA 5IDJA 4DRXB 2GSMB 3PSEA 4UVCA 4KXRA 1Q90D 5LXTB 1BT8A 4J80A 5CVNB 4YJ2B 1WP8A 3TGUH 4DV4O 4EB6A 4LF4B 4KUMA 5J9PC 2OWOA 2Q9LA 2AZ0A 5H6RA 3K5LA 2G6DA 4KFMA 2Q7EA 2YIBA 4I55B 1THEA 5CMUA 1R6KA 2LFRA 2ZDIA 1JCHA 4GLXA 4CDFB 3CYOA 3OD4A 1PPNA 3OGCC 3W7SA 1MOFA 3K03A 4LC1A 3JD1A 3O1GA 4BS6A 1VQKV 5BMVB 3O65A 1AECA 2XHBA 4I04A 3F5TA 3B09A 4PHZA 2EILB 1EZJA 2JGUA 4JZ2A 1SERA 4MZSA 1PKXA 2QM8A 3E1ZB 4OPHA 4JI0O 3L75H 2LFSA 2WLIB 3KFQA 3N2KB 3ASOC 3OM3B 1GN6A 1EN5A 4DW0A 3A0BZ 1NQTA 5IYBO 3CCMV 1Q82W 2FB5A 3ABMB 1L0NH 5H2FZ 2Y0IA 1M57C 3THOA 1DK1A 2FTKA 4UFZA 1PNKA 2RQ6A 1HNWB 1S4VA 3S3WA 5ITZA 1DTOA 2AYNA 2ZDIC 1BQ0A 4NXNB 2CUGA 1SESA 3CH3X 2DQ3A 1DF5A 1QLEC 3JATB 3UT5A 2YJBA 3PBHA 2WLLB 1DEUA 2PY5A 4UCUA 5KX5B 4O2AA 1ZUQA 2QTOA 1YI2V 1QR9A 3UM7A 3CCLV 2P22C 1LUWA 4IYIA 1RFYA 2W0FC 4GKJB 1V54B 4GKKB 1KYOF 1URFA 2GBOA 1S72V 3SPIA 2KG7A 1L8DA 4G2KA 2NN4A 4YJ3A 2ZT9B 3AG4B 3X2QB 2B1MA 4N8WA 3ZMZA 1SA0A 4K8ZA 1U5IA 1JA8A 5EZQA 1G1XB 4MVUA 2UXDO 4HXDB 4TUYB 1CV8A 3DSQA 3K5MA 2P67A 2RDCA 2BTQA 3EXAA 5CVOB 3PW3A 1CB5A 4D7TA 3WB0A 3M8AA 3I3TA 4LP8A 3A0RA 4IGGA 1HNWO 4QPKA 1VQMV 4QJFB 3IGAC 4MS2A 1E1QG 1XMOO 1NB5A 1PPJH 1VQ9V 4ZUXU 4LF8B 1QVFU 4TV9B 4DV5B 5CB4B 2AIMA 3MD0A 2ZE8A 4KP4A 1F29A 2H3OA 4O4HB 4LF6O 1XNRO 4PDVA 3SYPA 4O2BB 3T4DA 1KFXL 4D8IA 4YYWA 1TL9A 2YXHA 3H1KH 5L3CA 4TSFG 3L9DA 1VQ4V 1N32O 1MS6A 3V6EA 2VWKA 4JV5B 3K79A 2FRAA 4MT8A 4X1YB 2OULA 1SQFA 4YIOA 1A32A 4B3SB 3F5WC 4FM2A 2P7UA 4UVAA 4LFBB 1R6NA 4P9PA 1HNXB 2AYOA 1OCZB 3QTCA 5J2TB 1CS8A 1OCRC 1BY8A 2DJGB 3B40A 3AG7A 1ZL8B 3JALA 3SGIA 2QE7G 4B3RO 2WBFX 4NR1A 5BZBA 5L3BA 1AI6A 4LF9B 2O57A 1VQPV 3C0RA 1XNQO 3ZRVA 3AG1C 1VF5B 2HJDA 1HR0O 4YXWG 4F6RA 1M4UA 5KAIZ 2PZSA 1YVWA 2GUZA 3FFQA 1WA8B 1M90W 4LF8O 1BQIA 3ZRWB 2FMLA 3CJHA 3FB5C 3M99B 3T1YB 2EIJC 4KLBA 4DK0A 4JI3O 2JS3A 2JQFR 2Q6AA 2QSAA 5KHKA 2EIKC 3U11A 3ZS8C 4ZHQB 4LBEC 3RYFB 4X6HA 1Y74A 1EF7A 4O4IA 1N36B 4OEMA 4RWUA 1SQVH 1JQPA 1EZVH 4JTAB 1MSDA 5EIBC 2OYQA 1GMYA 3JAKA 1AYVA 1F7YA 5GONB 1QCEA 2RJZA 1K4DC 2WA4A 3CC2V 4B3SO 3CE2A 1EWMA 4RF1A 2QKSA 4IHJA 1HNXO 3WXFA 5CHTA 1ZTEA 2F4VB 3APQA 1VQLV 3HKEA 3CCUV 1Y6XA 4JTDB 2HVJC 4UB6Z 1GTOA 2NLJC 3ZEDA 2CE4A 3HKCA 4EB6B 1IBLO 5JJJB 5F02A 1NL6A 2G7YA 2DW4A 4ASUG 4Q20A 3K5OA 3H89A 2V7QG 3QO8A 1ORQC 1M57B 1B3QA 2XU3A 2DYSC 3T1CA 2LQTA 3ZHQA 1FXKC 1HNZB 1Q6IA 2YIBD 5EYPB 3QT4A 4AXMA 1GECE 1QBZA 4RKXA 3BPFA 1BHBA 4I4TA 4PELA 3T1YO 1VSNA 3P30A 2UUBB 2HHHB 2FE8A 1YALA 1I94O 5B1BC 3BWKA 1H8EG 4IIJA 4PD4F 1RM1C 3STLC 2B5UA 4MSWC 3R65A 4DK1A 2UUAB 4OELA 1N36O 3E8GA 3RYIA 4PA3A 3D3QA 4JAVA 5FNVA 4BR6A 1IBMO 2PREA 1JR9A 1ZLZA 2D2CB 4LH6A 4YVAA 1MZFA 1AYUA 4MI7A 8PCHA 4PDLA 1N0JA 2ADQB 3P5UA 2R9NA 1M56B 3E8HA 1QR8A 1WPXA 4JI8O 2DYRB 5C8YA 5ITZB 1GCBA 3UO3A 3CCJV 1AI4A 4CH6A 1N34B 2ODMA 2W0XA 5IJ0A 4GZRB 1ROPA 3UT5B 3UCSC 3IC9A 2FRQA 3LNMB 4N4ZA 1PL4A 1EN6A 3ICXA 2X7RB 3PN1A 4U3FH 4PDMA 1IDSA 5IT9N 4O2AB 1NB3A 4NKGB 3E35A 4I0XB 4TT3G 3HD3A 5E1AC 5JJEB 1S77D 2Q0OC 3H1JH 4UB8Z 4DR3O 2FT2A 2H8PC 3OE7G 5EC1C 1SNKA 2HHHO 3ABUA 4CC6A 1YZBA 3W7WA 3SJBC 1WB8A 1S5JA 4WFHA 2QKAA 4MVZA 2FQ9A 2ZCEA 2N74A 4XBFA 4BS5A 1I7FA 2KG7B 2UUAO 3U8EA 4JZGA 3S3XA 3D36C 4YJ3B 1KHPA 4CS3A 3N3GA 4AXLA 2VQFO 1SA0B 4J9ZB 4DR6B 1LNQA 4PI0A 4WURA 3OUFA 1LUVA 4N21A 1EWPA 4DR1O 5EBWC 5B3SB 1XL4A 4DR5B 2BTQB 2YI9A 4J41A 5IY5B 4B3MO 2UXBO 3SJCC 5KO3A 2DC7A 4O4LA 3TRKA 4E4EA 4TV8A 1M93A 2P06A 3W7UA 1OCRB 3TXSA 1UJWB 2B9ZA 4I50A 3ASNC 1MDWA 4NTWA 1TA8A 3VQWA 2A79B 3J80N 4FJCA 4RQEA 3RVXA 3IEJA 5K1XA 4UVBA 1AR5A 4UCSA 3RYCB 2P7TC 5J94A 3KW9A 1SKVA 1W59A 2W6JG 4UUJC 2OIEA 3BA8A 3KG2A 3MDSA 3O0UA 4QE7A 1F2CA 2ZE7A 1JX9A 3B8NA 1NS1A 3AI8A 4Q8GA 4DV6B 1OV9A 3K9SA
chains in the Genus database with same CATH topology
4YHHO 2BTWB 3O65A 4X66O 4BOPA 4DR2O 1FJGO 4JYAO 3M8AA 4JI5O 2UZJA 4BOZA 3F5TA 5FLXN 1HNWO 4BOQA 2VQEO 1DKIA 4DR7O 4DV2O 1XMOO 5IT9N 4IUMA 1F7YA 4DV5O 1AB3A 4YY3O 3T1HO 4X64O 4B3SO 1FYJA 2UU9O 3BY4A 2LW7A 1R6TA 4DR5O 2F4VO 4OPHA 1AILA 4JI0O 3BB7A 4DR3O 4RF1A 2JTCA 3IFUA 1FKAO 2HHHO 3PHXA 1PVJA 4D8EA 1YZBA 4DR4O 1HNXO 4LF7O 2JRIA 4DUZO 2DJVA 4LF6O 2UXCO 1XNRO 5A2QN 3PRPA 2N74A 1IBLO 4IP3A 3MP2A 4JV5O 4D8IA 4DR6O 1HNZO 3J81N 4R3DA 2UUAO 4NXNO 3ZNHA 3SDLA 1DK1A 4B3TO 2J7QA 2FKXA 1N33O 3TMPA 1N32O 4DV7O 2VQFO 4A5UB 4NXMO 3RNVA 2AGAA 4OVZA 2HWKA 2ZM6O 1KUQA 4JI1O 4DV3O 3PT2A 2BTWA 2Z84A 2UUBO 4LFBO 4WURA 5BY1A 4DV0O 1XMQO 4RNAA 3BBAA 5JZEA 1A32A 5IWAO 4P16A 4RKXA 1XEQA 3PHUA 4DR1O 4AQYO 4RF0A 2UXBO 3OTOO 3T1YO 4B3MO 4REZA 3W30A 5KO3A 3J7AU 5LL6Y 2DOSA 4GKJO 2FE8A 4JI6O 3E9SA 4DV6O 4GKKO 1I94O 3TRKA 4GUAA 2ZKOA 4X62O 4BOUA 4ZTBA 3RT3C 5LMNO 4LF9O 3PSEA 4OPAA 1IBKO 5EZSA 3JAMN 4B3RO 4LF4O 4LFCO 3J80N 1N36O 4XZXA 2E5LO 4M0WA 1UKFA 4MM3B 5H5NA 2UUCO 4OW0A 4X65O 3MTVA 3C0RA 4DV4O 1XNQO 4KHPO 3W31A 1IBMO 4JI7O 3MJ5A 1HR0O 4K0KO 4PT5A 4LF8O 4MI7A 1X59A 3PRMA 3B21A 3PHWA 4A5UA 1R1BA 4DV1O 5BXZA 4JI4O 4LFAO 5BR8O 4BOSA 1J5EO 5EZQA 1G1XB 1NS1A 2J7QC 4JI2O 4JI3O 4DUYO 1N34O 2UXDO 4HXDB 4OX9O 5LMUO 4JI8O 4D8BA 3R66A 4LF5O 2BU3A 1D2DA 5E6JA 2Z0AA 3OQCA 4OVZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH O;  3O65 A;  4X66 O;  4DR2 O;  1FJG O;  4JYA O;  3M8A A;  4JI5 O;  3F5T A;  5FLX N;  1HNW O;  2VQE O;  4DR7 O;  4DV2 O;  1XMO O;  5IT9 N;  1F7Y A;  4DV5 O;  1AB3 A;  4YY3 O;  3T1H O;  4X64 O;  4B3S O;  1FYJ A;  2UU9 O;  2LW7 A;  1R6T A;  4DR5 O;  2F4V O;  4OPH A;  1AIL A;  4JI0 O;  4DR3 O;  1FKA O;  2HHH O;  1YZB A;  4DR4 O;  1HNX O;  4LF7 O;  2JRI A;  4DUZ O;  2DJV A;  4LF6 O;  2UXC O;  1XNR O;  5A2Q N;  2N74 A;  1IBL O;  4JV5 O;  4DR6 O;  1HNZ O;  3J81 N;  2UUA O;  4NXN O;  3SDL A;  1DK1 A;  4B3T O;  2FKX A;  1N33 O;  1N32 O;  4DV7 O;  2VQF O;  4A5U B;  4NXM O;  2AGA A;  2ZM6 O;  1KUQ A;  4JI1 O;  4DV3 O;  2UUB O;  4LFB O;  5BY1 A;  4DV0 O;  1XMQ O;  1A32 A;  5IWA O;  1XEQ A;  4DR1 O;  4AQY O;  2UXB O;  3OTO O;  3T1Y O;  4B3M O;  3J7A U;  5LL6 Y;  2DOS A;  4GKJ O;  4JI6 O;  4DV6 O;  4GKK O;  1I94 O;  2ZKO A;  4X62 O;  3RT3 C;  5LMN O;  4LF9 O;  4OPA A;  1IBK O;  3JAM N;  4B3R O;  4LF4 O;  4LFC O;  3J80 N;  1N36 O;  2E5L O;  5H5N A;  2UUC O;  4X65 O;  4DV4 O;  1XNQ O;  4KHP O;  1IBM O;  4JI7 O;  1HR0 O;  4K0K O;  4LF8 O;  1X59 A;  1R1B A;  4DV1 O;  5BXZ A;  4JI4 O;  4LFA O;  5BR8 O;  1J5E O;  1G1X B;  1NS1 A;  4JI2 O;  4JI3 O;  4DUY O;  1N34 O;  2UXD O;  4OX9 O;  5LMU O;  4JI8 O;  3R66 A;  4LF5 O;  1D2D A;  2Z0A A; 
#chains in the Genus database with same CATH topology
 5LBQ A;  4R8C A;  4YHH O;  3PNR A;  1YXB A;  3HPL C;  1YF2 A;  1FJG O;  2UZJ A;  4FK5 C;  4LR3 A;  2BE3 A;  2BOC C;  4DR2 B;  1S5L Z;  3CRR A;  1FPO A;  3ABL C;  3RYH A;  3KCX A;  4DR5 O;  4I7Z B;  2B1G A;  4U7N A;  2JTC A;  2VS0 A;  1FKA O;  3JAL B;  2XTA A;  4D8E A;  1QQC A;  3K3W A;  3B79 A;  4Q6G A;  4GX1 A;  2HP8 A;  1AU2 A;  4UCV A;  2Q0A A;  2V4D A;  1YCI A;  2WAM A;  1YK7 A;  4QRV A;  3LNN A;  1PE6 A;  5CBG A;  2XAF A;  5DN6 G;  3B77 A;  5H9C A;  3BOW A;  1SRY A;  4MVR A;  4F6R B;  2J7Q A;  1SF9 A;  2GUZ B;  3FYI B;  4BW9 A;  2K1E A;  1N33 O;  4MTO A;  4W4U A;  3TMP A;  4WFB V;  2IJH A;  2OIG A;  3CJH B;  4DXW A;  2EJR A;  4ZIB A;  4C7U A;  2KB1 A;  4H44 B;  4DR7 B;  3AG2 C;  4F4L A;  1YJ9 V;  1R3L C;  4PA9 A;  3FB6 C;  2X6A A;  4P9O A;  4NXM B;  1PV0 A;  3KZI Z;  3LDE A;  1XDC A;  4JI1 B;  3OTO O;  3QG5 A;  1GM7 A;  3P5X A;  4G54 A;  1Y74 B;  4DR4 B;  4DV6 O;  3E2E A;  4P30 A;  2FTD A;  4O4I B;  2XU1 A;  2YDE A;  3JCZ A;  3CH2 X;  4X20 A;  2E76 B;  4FLW A;  1W2B U;  3WG7 C;  4Z1M G;  4I5S A;  3JAK B;  4JI6 B;  5FPR A;  5LP6 B;  1V55 C;  1AP5 A;  2HH5 A;  5B1A B;  4XZX A;  2ATO A;  5LGU A;  1UKF A;  4MM3 B;  1PM9 A;  2CK3 G;  1YT7 A;  2UUC O;  3USV A;  3MHH C;  3AK2 A;  1G8M A;  4IHJ B;  4RY2 A;  4RUE A;  1G6U A;  4K0K O;  5EGW A;  1D5A A;  1PXV A;  2YIA A;  1XMQ B;  1DF0 A;  3HKE B;  2XOK G;  3PHW A;  4KL1 A;  1YEW A;  3HKC B;  1OCO B;  5EC2 C;  2J7Q C;  3L72 H;  4CDD B;  4NTX A;  3ZMT A;  5TIS Z;  1QOL A;  5JJN B;  5GTI Z;  3U0Z A;  3ML0 A;  2F7D A;  2OT5 A;  2XAQ A;  2ZNI A;  1HWY A;  3OEE G;  1KMI Z;  1NR7 A;  2VQE O;  4I4T B;  3BPM A;  3LSS A;  4DR7 O;  4H13 B;  2P86 A;  1GAX A;  5JH7 A;  4XDJ A;  2RN9 A;  2X6B A;  5D5P A;  4J7K A;  3DC5 A;  1NTK H;  1BGO A;  1CPJ A;  2EUL A;  4WFG A;  4P2Z A;  4IIJ B;  1ZCM A;  3OUS A;  3HHI A;  1SQQ H;  3G67 A;  4JI4 B;  2Y48 A;  5BR8 B;  1IWD A;  4DR4 O;  1PVJ A;  4XUI A;  3GWO A;  1WLE A;  3F7V C;  3QO5 A;  7PCK A;  2PF4 E;  3RYI B;  3KCY A;  3H1I H;  3GVM A;  3ZUA A;  5LMU B;  3K0D A;  3BFR A;  3N3K A;  1AP6 A;  5FNV B;  2PUS A;  1NQC A;  1GRJ A;  4JAU A;  2FKX A;  1O0E A;  1NR1 A;  2ZQM A;  5JCO A;  2P4V A;  4YIP A;  5LYJ A;  2HHN A;  4OVZ A;  2ZIO A;  4DV3 O;  2AHY A;  2XU5 A;  4WA6 A;  2FL4 A;  2EIM C;  3JAW A;  4GCZ A;  5FL7 G;  1XMQ O;  1KU9 A;  2QGN A;  1OJH A;  2ZR2 A;  1Q43 A;  3K8U A;  4P16 A;  5EBM C;  2Q4P A;  2R72 A;  1K73 W;  1SC5 B;  5HFL A;  2G8J A;  4QRX A;  2P6J A;  4BIU A;  3ZRS A;  2ZXW C;  2VHS A;  3JSN A;  5IJ0 B;  3E9S A;  3OEH G;  4CH4 A;  1M9N A;  2GHU A;  1CVZ A;  4BOU A;  1AJN A;  2GHY A;  2Y69 B;  2UXC B;  3D3I A;  2GTA A;  1TAE A;  5DED A;  5D5Q A;  3BAB A;  1PPP A;  2Q7G A;  4ZKI A;  3ZHT A;  4UV9 A;  5K1P A;  1XBL A;  4LF4 O;  1Q81 W;  1SQG A;  3CEI A;  3B2E E;  1H2N A;  2PGG A;  5KLV H;  2EBO A;  1YVB A;  5LHH A;  1Z5V A;  1PNM A;  4I9Q A;  1JOY A;  4R50 A;  1VIB A;  3BVO A;  4N23 A;  2XUM A;  3CME V;  3CB2 A;  2ARH A;  2B1I A;  2YIC A;  3RWR D;  3K5N A;  1NH2 B;  2EZP A;  5KHG A;  3ABK C;  1GM8 A;  5BXZ A;  1NH2 D;  4JI4 O;  5BR8 O;  1JJO A;  4H37 A;  3QSD A;  1MEG A;  3CWB H;  2IJI A;  4FLU A;  5LMU O;  2PYL A;  1X4T A;  9PAP A;  4X62 B;  3H7D A;  1DF4 A;  1SQB H;  5JCO C;  4MSX A;  3OQC A;  4PA4 A;  3JAR A;  4X1K A;  2RNB A;  1Q6H A;  3ETQ A;  4WFF A;  1WNS A;  1R3K C;  5FLX N;  2ZR3 A;  5LA6 A;  3HKB A;  3G6B A;  2JGD A;  3OAA G;  1MG1 A;  1TUE B;  2AW9 A;  4O4L B;  4ZI7 A;  2LW7 A;  3ABL B;  4W4L A;  1TUB A;  1Q86 W;  1MA1 A;  4BW5 A;  4I50 B;  3PHX A;  2XAG A;  4CZZ A;  2DCD A;  1JFF B;  5IYZ B;  2G38 A;  1SZT A;  4FMT A;  2IH1 C;  3H1H H;  2UXC O;  2WLJ A;  3K24 A;  1P7G A;  3FD9 A;  2NR5 A;  3H6S A;  4I05 A;  2ITD C;  4NXN O;  3ZNH A;  1XHZ A;  5KHJ A;  1BCC H;  3LSU A;  4R6Z A;  2K9P A;  1K4C C;  1KBH A;  1Y08 A;  3U10 A;  1KUQ A;  3SPH A;  1FFT B;  2CGO A;  2BDZ A;  4YY3 B;  4J10 A;  1H2G A;  3DC6 A;  1POP A;  2P5O A;  3CCR V;  4XR7 A;  5LL6 Y;  3I5D A;  4GKJ O;  1OCC B;  3CRC A;  4GKK O;  1AU0 A;  4X62 O;  1GM9 A;  3QNE A;  4X9Q A;  1BQZ A;  2DJF B;  1ATK A;  3ETD A;  4OPA A;  3WG7 B;  4IT5 A;  4U3J B;  2QDO A;  1B06 A;  1H2L A;  2E3C A;  2XAJ A;  1F2B A;  3H8B A;  2NNU A;  3AK3 A;  5JQG B;  2LGQ A;  2GTS A;  3JYC A;  3ABT A;  3OT7 A;  4W5B A;  4FVM A;  3AG3 B;  2N04 A;  2YJ8 A;  3UO2 A;  1BP4 A;  3RFR A;  4FM0 A;  5IYC O;  4K8X A;  5CA0 A;  2DE0 X;  1WPB A;  2ETN A;  1EWO A;  1L1F A;  2ZE6 A;  4HAM A;  1HDJ A;  4DV1 B;  5B66 Z;  2QTS A;  1TVK A;  4LFA B;  1PAD A;  1XUQ A;  3OMI B;  3F75 A;  4FZ0 A;  4JAA A;  3HKD A;  4OX9 B;  2R70 A;  4PDR A;  5L3G A;  4BOQ A;  4CS2 A;  4JYA B;  4DV5 O;  4YY3 O;  1FXK A;  3ZHR A;  1YSC A;  1WB7 A;  2WSS G;  1FYJ A;  3JSL A;  4PA7 A;  1GN4 A;  5DEC A;  3BB7 A;  1F4M A;  3N2G A;  1PPO A;  5KUM A;  2YEV B;  1YDX A;  4UCO A;  3SPG A;  3T1H B;  2IW5 A;  3QF7 A;  4X64 B;  3GWK C;  5IJ9 A;  4K35 A;  4OXS A;  1K5S A;  4X88 A;  4DUY B;  4Q8H A;  2QWO B;  1NTM H;  2BSK A;  1K8A W;  1K3B B;  3HWN A;  4Z2W A;  3MP2 A;  4JV5 O;  3FKS G;  1N4C A;  2HFE C;  2Y6E A;  3AEI A;  1YK8 A;  6PAD A;  3DXR A;  4BWA A;  3Q4H B;  3PT2 A;  4DV2 B;  4LFB O;  1FH0 A;  3SYC A;  2FYE A;  3ASO B;  3PHU A;  1U97 A;  5JWP A;  2P4K A;  3FAV A;  3OFN G;  2FUD A;  3LUT B;  1EM1 A;  3CCQ V;  2X6C A;  1FXH A;  4DUZ B;  2DQ0 A;  4PI3 A;  1LR1 A;  2BTO A;  4LF9 O;  2V1D A;  3WXG A;  2OCH A;  2EIN C;  1M5I A;  5JH7 B;  1JQ0 A;  2LJ2 A;  5LMN B;  2QWR B;  1XL6 A;  1QLE B;  3EHB B;  1QNM A;  1KP3 A;  2E5L B;  3CCV V;  4I07 A;  1MNG A;  1TU6 A;  3PRM A;  2CGN A;  2CAZ C;  1QVG U;  2R9M A;  1NPZ A;  1VQN V;  4FIP C;  3APO A;  4MVO A;  2D3O W;  2YJ9 A;  2KKW A;  4MVS A;  1P49 A;  1FFX A;  2VRZ A;  2YS8 A;  3IC7 A;  2YXL A;  4DUY O;  2HD5 A;  1GLO A;  3CD6 V;  3ZN1 A;  5LHI A;  1D2D A;  2HKO A;  1YTF B;  4L87 A;  3QVN A;  4PP1 A;  4PAD A;  5LYJ B;  4OVZ B;  1JVM A;  1YTF D;  2F1M A;  3BC3 A;  4BOP A;  3JAW B;  5EF4 A;  3TCU A;  4YYR A;  4LF5 B;  1STF E;  3L74 H;  1QU7 A;  3FYE B;  5KHI A;  3K06 A;  3D36 A;  2QR4 A;  4X66 B;  1SP4 B;  1CP9 A;  3ZHU A;  4DV2 O;  1EBO A;  3CMA V;  2LO1 A;  2A3Q A;  5BMV A;  1U9X A;  2F4V O;  2HVK C;  5KMG A;  1KP2 A;  4IYH A;  2PI4 A;  1RSO A;  2IPP B;  4LH7 A;  4DUZ O;  5CBF A;  5A2Q N;  3GB7 C;  1F23 A;  4J9Y B;  3K0G A;  4LF7 B;  3MTN A;  1HNZ O;  2XAS A;  3LXS A;  4QBB A;  4BSQ A;  3BRC A;  1N0N A;  4JYC A;  1AIM A;  4WFE A;  1S0V A;  1Y67 A;  1BSM A;  4B3T B;  4H33 A;  2UUB O;  4W5C A;  5JZE A;  3BBA A;  1ICF A;  4MVQ A;  1NU1 H;  1XEQ A;  4HBN A;  4RQF A;  1PL0 A;  4CDE B;  4DMY A;  2ZM6 B;  4REZ A;  1K92 A;  3F5V A;  5B1O A;  3T2M A;  3CCE V;  4X1K B;  3L71 H;  1US6 A;  3OF9 A;  4FFB A;  3RVW A;  4NYK A;  2A7W A;  2PYJ A;  3K57 A;  5LA6 B;  3HKB B;  3IUT A;  4JF3 A;  4N79 A;  1B6Q A;  1BS3 A;  1NKD A;  2UXX A;  4EFE A;  1H38 A;  3VQY A;  1M6D A;  4IL6 Z;  3IMA A;  4ZI7 B;  4CH3 A;  2CDY A;  5KX5 A;  2E01 A;  4FK5 A;  3I06 A;  4X1I A;  2CTP A;  1NZ6 A;  3H1L H;  3A0H Z;  3MJ5 A;  3SPJ A;  4LFC B;  1H2M A;  2EIL C;  1I08 A;  4KHP B;  1X9Y A;  2YID A;  2DC8 A;  4TQF A;  2Y5B A;  3UQ8 A;  1N34 O;  1FAF A;  5LGN A;  5K16 A;  1VJV A;  2YI8 A;  1P7B A;  2DCB A;  3D8C A;  2IJK A;  3AG1 B;  4HZ3 A;  1A6R A;  1CQD A;  1KC8 W;  2WPD G;  4YYV A;  3BEH A;  3RN4 A;  3ABM C;  3E86 A;  2OTJ V;  1BHA A;  5CBH A;  1XI1 A;  2AVW A;  4FPP A;  2EIJ B;  2IM9 A;  4TQD A;  1ME4 A;  5IE9 A;  2VHF A;  3FB7 C;  1ZSP A;  1BGY H;  1IUR A;  2QM4 A;  1KB9 F;  2P0R A;  3JCU Z;  1UPG A;  4QPJ A;  5B1N A;  2EIK B;  2KSD A;  3ZHS A;  3LSQ A;  4D7S A;  4B7K A;  1AU4 A;  2CH7 A;  4B7E A;  2BCC H;  4FFK A;  3ZMU A;  3OVZ A;  2R9A A;  4DR6 O;  2PBH A;  3SDL A;  4DO2 A;  1V54 C;  1FXV A;  2JEU A;  5EIB D;  3JAS A;  3A8T A;  5CA0 B;  3N4C A;  3ZIA G;  4MW8 A;  2HWK A;  3WB2 A;  3NHE A;  2BTW A;  2Z84 A;  3SYQ A;  3MHH A;  5KAF Z;  4O2B A;  3C9E A;  3STZ C;  5C93 A;  1Z2G A;  2ATK C;  1GKF A;  4WCE V;  2Q73 A;  2E75 B;  1MAB G;  1VF6 C;  3AG4 C;  3X2Q C;  4MTX A;  1VAR A;  1KD1 W;  2IU3 A;  5IWA B;  4X8A A;  1NVP D;  1HP8 A;  4GUA A;  4ZTB A;  2JEX A;  4X1Y A;  3FB8 C;  2Z3Y A;  2DYS B;  2F43 G;  3C3T A;  1FXK B;  4NVP A;  5L3F A;  4AI8 A;  2HXZ A;  4DV7 B;  4YYU A;  4CBC A;  2O6X A;  1K5Q A;  3N2G B;  4GX5 A;  3BHP A;  3CS5 A;  4J7J A;  3JD0 A;  4MW3 A;  4CDC B;  5IJ9 B;  1H2K A;  4DV4 B;  5JH3 A;  3CBJ A;  1SQX H;  1PP9 H;  4QGP A;  4AQY B;  1R1B A;  2BSK B;  5B1B B;  1AI5 A;  3KKY A;  2QKC A;  1W0J G;  1RM1 B;  1VQ5 V;  3ZBH A;  3IFX A;  4UXN A;  3IV2 A;  1KKD A;  3P5W A;  3DXR B;  2W6I G;  2Z0A A;  2E02 A;  2AUX A;  1N8R W;  1IBK B;  4DR2 O;  3HR0 A;  4BOZ A;  4GX2 A;  4TOI A;  3TET A;  4X6J A;  3M7M X;  4D6T H;  5J2U A;  4XDK A;  3IJ4 A;  4ICG A;  1AB3 A;  2XAH A;  2OCC C;  5CHV A;  1K9M W;  5B5E Z;  3BY4 A;  2MK3 A;  1GN3 A;  1ZIV A;  1AVM A;  2JRI A;  3VQX A;  2LP7 A;  2VWJ A;  1ZWI C;  4JI0 B;  1SS3 A;  2AZ2 A;  3PRP A;  5CA3 A;  1OCZ C;  4R3D A;  1XHX A;  4DV7 O;  4NXM O;  1GO3 F;  1MMM A;  5KUK A;  1Q6K A;  4JI1 O;  2OZ2 A;  2GFO A;  3FX7 A;  3CC7 V;  1ME3 A;  1FFX B;  1K33 A;  4AQY O;  1BE3 H;  1SQP H;  3E83 A;  2HJF C;  2E00 A;  1MIR A;  4JI6 O;  4GYC B;  3KWB X;  1U9Q X;  3KWZ A;  2ZKO A;  2ADP A;  1O9G A;  5E79 Z;  5EYP A;  2AS8 A;  4DYL A;  3OMN B;  1U96 A;  1T5E A;  1IBK O;  1Q6U A;  2BDL A;  5DM6 V;  3CXC U;  2ZIM A;  3WU2 Z;  4OW0 A;  5KMG B;  3LFY A;  1PPD A;  1RSO B;  2HEP A;  1E1R G;  5C8Y B;  1CXZ B;  2XU4 A;  4DV0 B;  1X59 A;  2YXY A;  1Y4H A;  3I55 V;  2DC6 A;  1I0H A;  3BY6 A;  1THZ A;  1QLN A;  1YIJ V;  3MHS A;  1S3J A;  2AU1 A;  3ASN B;  4D8B A;  5E6J A;  1RPO A;  2GV9 A;  3MOR A;  1Q5O A;  3KX1 A;  2HR3 A;  4GX0 A;  2UXD B;  3L73 H;  1FD9 A;  1SZX A;  4PI2 A;  3GCB A;  1G4Y B;  5CVM A;  2ZD9 A;  5FPW A;  4L8J A;  2CTW A;  4B08 A;  1KEC A;  3UKM A;  4BIZ A;  4RAI A;  1EWL A;  2JIZ G;  4FFB B;  1R3I C;  4QRG A;  3CRM A;  3CPW U;  1SET A;  1Y76 A;  2CB5 A;  4NTY A;  1EFR G;  2NQI A;  1XMO B;  2QM7 A;  3JD3 A;  3SPC A;  1ENV A;  2YJC A;  1HUC B;  1QDQ A;  3WXE A;  4G28 B;  3OR7 C;  3NR7 A;  5LOV A;  4I0X A;  4X1I B;  2R6N A;  1XQ8 A;  1VEW A;  1Q8I A;  3J81 N;  2GDS A;  4LF6 B;  1XNR B;  2L6L A;  3H01 A;  2ACT A;  3HB3 B;  3E8B A;  5JVD A;  2AGA A;  4XDL A;  4TV8 B;  2JJ1 G;  5BY1 A;  4DV0 O;  1N32 B;  3MHS C;  1KFU L;  1BMF G;  4TWK A;  4PV1 B;  3BCN A;  3DTU B;  4LCU C;  2Q67 A;  1VMG A;  2PAD A;  3BAA A;  3MAQ A;  1MSW D;  4JAS A;  3RVZ A;  1JJ2 U;  1M56 C;  1KHQ A;  2A0L A;  5LGT A;  4LNU A;  2YC0 A;  2DYR C;  3OVX A;  3DF0 A;  4M0W A;  3AG2 B;  1YJW V;  5H5N A;  2F95 B;  4E2L A;  4B3R B;  4Z1V A;  1WN7 A;  1PIP A;  4PT5 A;  2Y0P A;  4HNA A;  1XNQ B;  2NQG A;  3G4S V;  4X89 A;  2CH7 B;  5GTH Z;  2DZZ A;  1HR0 B;  2LGW A;  3RW0 A;  2F93 B;  4BOS A;  3CC4 V;  3OMA B;  3RYC A;  3TJT A;  3C90 A;  1V55 B;  2BU3 A;  3JAS B;  1O9H A;  1B04 A;  2EZO A;  3RYH B;  2AHZ A;  2QWP B;  4QIW F;  4JI3 B;  2BTW B;  3HHA A;  2A9H A;  1Q7Y W;  2JJ2 G;  3KKU A;  4AHC A;  1JPX A;  1QHT A;  4RUF A;  4MTF A;  1IZ3 A;  3I56 V;  4O4J A;  4W4K A;  4IUM A;  4GUN A;  5EBL C;  2OCC B;  1F2A A;  3SJA C;  1QXP A;  3CRQ A;  3P5V A;  1MEM A;  1R6T A;  1NI8 A;  5A24 A;  2NQA A;  3D6S A;  5B3S C;  2C0Y A;  5IY5 C;  1YJN V;  2DJV A;  2E74 B;  5FPO A;  1S5H C;  3WFV A;  2RCV A;  2JVD A;  1H8H G;  2AXT Z;  4YYS A;  3ZHV A;  1IVS A;  2JDI G;  1CTE A;  2A06 H;  2QWQ B;  4WBN A;  4YV8 A;  1DGS A;  2ZIN A;  2P90 A;  3EVK A;  1IXB A;  1IBL B;  2QA4 V;  2IJJ A;  3H8C A;  1F4N A;  1F51 A;  1UFI A;  1D5N A;  4FLZ A;  3IAY A;  4X20 B;  4J7Z A;  3K58 A;  2UU9 B;  3ZJZ A;  3L70 H;  3OTF A;  3BPZ A;  1PNL A;  4ZOL A;  3SYO A;  1KXR A;  1ZAU A;  4FIP A;  2QWN B;  2PI5 A;  3K04 A;  1VQO V;  2H7J A;  4LWS A;  3G71 V;  5CA1 A;  3V6C A;  5J2U B;  5EZS A;  3CX5 F;  1I94 B;  3P3N A;  4JYB A;  5LHG A;  3CCS V;  2EIM B;  4QNH B;  4PJ0 Z;  4NB5 A;  2CTR A;  3W31 A;  3E8F A;  4J42 A;  1WP7 A;  1S76 D;  3VBB A;  2ZXW B;  3W7T A;  1VQ7 V;  4X6I A;  4A5U A;  1IBM B;  5LP6 A;  2IBI A;  4DV1 O;  2Q69 A;  3PJS K;  4LFA O;  2N05 A;  4H0L B;  4WFA V;  1CJL A;  3ETE A;  3T4Z A;  4OX9 O;  2Q7H A;  3OGI B;  3R66 A;  4JYY A;  4RO2 A;  3E22 A;  2RMK B;  3CBK A;  5IYD O;  2Y4U A;  3K9A A;  2G8E A;  3PDF A;  3ZMV A;  4AIL C;  5EZY A;  3OW2 U;  1EN4 A;  4QE9 A;  4JI8 B;  4JYA O;  2X0L A;  1WJZ A;  4HYO A;  3IHP A;  5KHH A;  3RBZ A;  1I5X A;  4X65 B;  4CZW A;  4DRX A;  1XKG A;  5F2V O;  1H2S B;  4JI7 B;  2F1G A;  3G6E V;  1I5Y A;  3ABK B;  3T1H O;  5LXT A;  3SR2 C;  4X64 O;  2UU9 O;  2YUA A;  4YJ2 A;  2HG5 C;  3QO7 A;  3S3Q A;  1AIL A;  1Z5W A;  4I9W A;  1VF7 A;  1AI7 A;  1J5E B;  3B8M A;  1GN2 A;  4DR3 B;  2BOB C;  4I55 A;  1HW7 A;  3CP1 A;  5CN0 A;  1JMK C;  1IX9 A;  5AG2 A;  1KQS U;  3NXS A;  4K7C A;  3G80 A;  5LP6 C;  3CSX A;  3RNV A;  1Y4M A;  5B1A C;  4U7O A;  5L3E A;  3LDC A;  1K7D A;  1AU3 A;  4RNA A;  2VQF B;  3SJQ C;  3OIS A;  3CRA A;  2ILM A;  1P4R A;  1KKC A;  3W30 A;  5GW7 A;  1TGO A;  4PA6 A;  4CC5 A;  2M6Y A;  2ARY A;  2FYU H;  1GK9 A;  1K34 A;  4DR1 B;  4PP2 E;  2UXB B;  1OCO C;  4B3M B;  3RT3 C;  2PNS A;  5LMN O;  2OP3 A;  3O9O A;  1OZ0 A;  2WLI A;  3N2K A;  3B4S A;  3CXH F;  4G27 B;  3RVV A;  2E5L O;  4EFB A;  1Y76 B;  4X65 O;  3K9M A;  5EK0 A;  2H94 A;  2ITC C;  1BZK A;  1MHW A;  3W7X A;  4JI7 O;  3E89 A;  2WA3 A;  4UCT A;  3JAR B;  4F6E A;  2F23 A;  1TLO A;  2WLN A;  3TK1 A;  5LOV B;  4MVM A;  4ZBM A;  1IXM A;  2NQD B;  1J5E O;  5H6Q A;  4HWY A;  1L0L H;  3JAT A;  2JGD B;  4FZ1 A;  2WLL A;  5A9G A;  4LF5 O;  1VQ6 V;  4P6E A;  5JVD B;  1FS0 G;  1PCI A;  1RPR A;  1TUB B;  2DWD C;  2E03 A;  4X66 O;  1ZX3 A;  2YSU B;  2Q8V A;  3N27 A;  4JTC B;  2DZY A;  2ZE5 A;  4BIO A;  1P84 F;  4YHH B;  3H9V A;  1FJG B;  5PAD A;  4BAY A;  2DCA A;  2DN9 A;  4BQV A;  1J95 A;  3KSE A;  4P6G A;  3S3R A;  3ERV A;  2EJ7 A;  1NBM G;  2AUZ A;  3SYA A;  4DW1 A;  4EEQ A;  3K08 A;  4LNU B;  4LF7 O;  1VF6 A;  3LDD A;  2XT9 A;  4JI2 B;  3F7Y C;  1K3E A;  1K97 A;  1NT2 B;  4FM1 A;  1R73 A;  3AK1 A;  2DCC A;  2YJ2 A;  2R9I A;  2WWW A;  2Y69 C;  4B3T O;  1PBH A;  4HNA B;  2ZNJ A;  4TUY A;  4JI5 B;  1JFF A;  1GMG A;  3ZCC A;  5IYZ A;  1R3J C;  2R9R B;  2ZM6 O;  1PD3 A;  1N33 B;  1CEZ A;  4CH5 A;  2Q68 A;  4MTG A;  2WLK A;  1M1K W;  2IH3 C;  2EX3 A;  3J7A U;  2DOS A;  3VQV A;  1DLB A;  3JD2 A;  1NLJ A;  1NTZ H;  1AR1 B;  3OTO B;  1AJQ A;  4TV9 A;  4O4J B;  3JD4 A;  2MW2 B;  4OGQ B;  5CB4 A;  2LW1 A;  3JAM N;  4FLY A;  3DGE A;  1WAZ A;  4LFC O;  1E79 G;  4O4H A;  1COW G;  3MTV A;  2B1N A;  1XRE A;  2CIO A;  2IU0 A;  3BA9 A;  4KHP O;  1Q3E A;  3CHX A;  1TVK B;  2KQX A;  2FO5 A;  1MZE A;  4UCR A;  5JA7 A;  1BL8 A;  2UUC B;  1U9V A;  3VOU A;  1NVP B;  1V9P A;  3HKD B;  1VP7 A;  4R7C A;  1AYW A;  1CSB B;  3B21 A;  4BPV A;  1YIT V;  4U3J A;  3K59 A;  3ETG A;  4K0K B;  3QJ3 A;  3ZMS A;  3ZRX A;  5JQG A;  4WBN B;  4JI2 O;  5L3D A;  2HLD G;  2EIN B;  3IOQ A;  3P3P A;  2M7W A;  2QJ1 A;  4FJC C;  4CS4 A;  5KA5 A;  3RVY A;  4JI5 O;  2CTQ A;  3C3S A;  5HFM A;  1ITO A;  2R9F A;  5J2T A;  1QMY A;  4MZO A;  2PTM A;  1DKI A;  2DC9 A;  4FLT A;  3EFF K;  4ZOL B;  4DMX A;  4J11 A;  1ZL8 A;  1VQ8 V;  4FLV A;  4JGS A;  3ZN0 A;  4JPR A;  2IBZ H;  4LWS B;  2VQE B;  4EKW A;  3TXQ A;  1ARO P;  3RGB A;  1U9W A;  1GH6 A;  5CA1 B;  2Q5Z A;  3IFU A;  2Y4T A;  1YHQ V;  1NJI W;  2C2A A;  2WLM A;  1WA8 A;  1XOU A;  2Z5U A;  4QH6 A;  4FLX A;  2DWE C;  3ZRW A;  3P32 A;  2R9O A;  2QEX V;  2DMX A;  2WLH A;  1CPY A;  3TNX A;  1OCC C;  1W0K G;  4IP3 A;  3M99 A;  3OF8 A;  3WB1 A;  2R9C A;  2OTL V;  1RP3 B;  2XND G;  3FAV B;  2JK5 C;  2YEV A;  1OHH G;  4A5U B;  2F66 C;  2UXN A;  4K3A A;  1AR4 A;  4ZHQ A;  3OR6 C;  3RYF A;  2JQG R;  5IWA O;  4WF9 V;  3A2F A;  4UV8 A;  4RF0 A;  3AG3 C;  2JS5 A;  3E22 B;  1Y66 A;  1XIL A;  4DV3 B;  4YYQ A;  1AJP A;  5GON A;  5EZY B;  5KA6 A;  3ZX6 A;  4GT1 A;  3Q4H A;  3BCC H;  2L35 A;  4ABM A;  5IDJ A;  4DRX B;  2GSM B;  3PSE A;  4UVC A;  4KXR A;  1Q90 D;  5LXT B;  1BT8 A;  4J80 A;  5CVN B;  4YJ2 B;  1WP8 A;  3TGU H;  4DV4 O;  4EB6 A;  4LF4 B;  4KUM A;  5J9P C;  2OWO A;  2Q9L A;  2AZ0 A;  5H6R A;  3K5L A;  2G6D A;  4KFM A;  2Q7E A;  2YIB A;  4I55 B;  1THE A;  5CMU A;  1R6K A;  2LFR A;  2ZDI A;  1JCH A;  4GLX A;  4CDF B;  3CYO A;  3OD4 A;  1PPN A;  3OGC C;  3W7S A;  1MOF A;  3K03 A;  4LC1 A;  3JD1 A;  3O1G A;  4BS6 A;  1VQK V;  5BMV B;  3O65 A;  1AEC A;  2XHB A;  4I04 A;  3F5T A;  3B09 A;  4PHZ A;  2EIL B;  1EZJ A;  2JGU A;  4JZ2 A;  1SER A;  4MZS A;  1PKX A;  2QM8 A;  3E1Z B;  4OPH A;  4JI0 O;  3L75 H;  2LFS A;  2WLI B;  3KFQ A;  3N2K B;  3ASO C;  3OM3 B;  1GN6 A;  1EN5 A;  4DW0 A;  3A0B Z;  1NQT A;  5IYB O;  3CCM V;  1Q82 W;  2FB5 A;  3ABM B;  1L0N H;  5H2F Z;  2Y0I A;  1M57 C;  3THO A;  1DK1 A;  2FTK A;  4UFZ A;  1PNK A;  2RQ6 A;  1HNW B;  1S4V A;  3S3W A;  5ITZ A;  1DTO A;  2AYN A;  2ZDI C;  1BQ0 A;  4NXN B;  2CUG A;  1SES A;  3CH3 X;  2DQ3 A;  1DF5 A;  1QLE C;  3JAT B;  3UT5 A;  2YJB A;  3PBH A;  2WLL B;  1DEU A;  2PY5 A;  4UCU A;  5KX5 B;  4O2A A;  1ZUQ A;  2QTO A;  1YI2 V;  1QR9 A;  3UM7 A;  3CCL V;  2P22 C;  1LUW A;  4IYI A;  1RFY A;  2W0F C;  4GKJ B;  1V54 B;  4GKK B;  1KYO F;  1URF A;  2GBO A;  1S72 V;  3SPI A;  2KG7 A;  1L8D A;  4G2K A;  2NN4 A;  4YJ3 A;  2ZT9 B;  3AG4 B;  3X2Q B;  2B1M A;  4N8W A;  3ZMZ A;  1SA0 A;  4K8Z A;  1U5I A;  1JA8 A;  5EZQ A;  1G1X B;  4MVU A;  2UXD O;  4HXD B;  4TUY B;  1CV8 A;  3DSQ A;  3K5M A;  2P67 A;  2RDC A;  2BTQ A;  3EXA A;  5CVO B;  3PW3 A;  1CB5 A;  4D7T A;  3WB0 A;  3M8A A;  3I3T A;  4LP8 A;  3A0R A;  4IGG A;  1HNW O;  4QPK A;  1VQM V;  4QJF B;  3IGA C;  4MS2 A;  1E1Q G;  1XMO O;  1NB5 A;  1PPJ H;  1VQ9 V;  4ZUX U;  4LF8 B;  1QVF U;  4TV9 B;  4DV5 B;  5CB4 B;  2AIM A;  3MD0 A;  2ZE8 A;  4KP4 A;  1F29 A;  2H3O A;  4O4H B;  4LF6 O;  1XNR O;  4PDV A;  3SYP A;  4O2B B;  3T4D A;  1KFX L;  4D8I A;  4YYW A;  1TL9 A;  2YXH A;  3H1K H;  5L3C A;  4TSF G;  3L9D A;  1VQ4 V;  1N32 O;  1MS6 A;  3V6E A;  2VWK A;  4JV5 B;  3K79 A;  2FRA A;  4MT8 A;  4X1Y B;  2OUL A;  1SQF A;  4YIO A;  1A32 A;  4B3S B;  3F5W C;  4FM2 A;  2P7U A;  4UVA A;  4LFB B;  1R6N A;  4P9P A;  1HNX B;  2AYO A;  1OCZ B;  3QTC A;  5J2T B;  1CS8 A;  1OCR C;  1BY8 A;  2DJG B;  3B40 A;  3AG7 A;  1ZL8 B;  3JAL A;  3SGI A;  2QE7 G;  4B3R O;  2WBF X;  4NR1 A;  5BZB A;  5L3B A;  1AI6 A;  4LF9 B;  2O57 A;  1VQP V;  3C0R A;  1XNQ O;  3ZRV A;  3AG1 C;  1VF5 B;  2HJD A;  1HR0 O;  4YXW G;  4F6R A;  1M4U A;  5KAI Z;  2PZS A;  1YVW A;  2GUZ A;  3FFQ A;  1WA8 B;  1M90 W;  4LF8 O;  1BQI A;  3ZRW B;  2FML A;  3CJH A;  3FB5 C;  3M99 B;  3T1Y B;  2EIJ C;  4KLB A;  4DK0 A;  4JI3 O;  2JS3 A;  2JQF R;  2Q6A A;  2QSA A;  5KHK A;  2EIK C;  3U11 A;  3ZS8 C;  4ZHQ B;  4LBE C;  3RYF B;  4X6H A;  1Y74 A;  1EF7 A;  4O4I A;  1N36 B;  4OEM A;  4RWU A;  1SQV H;  1JQP A;  1EZV H;  4JTA B;  1MSD A;  5EIB C;  2OYQ A;  1GMY A;  3JAK A;  1AYV A;  1F7Y A;  5GON B;  1QCE A;  2RJZ A;  1K4D C;  2WA4 A;  3CC2 V;  4B3S O;  3CE2 A;  1EWM A;  4RF1 A;  2QKS A;  4IHJ A;  1HNX O;  3WXF A;  5CHT A;  1ZTE A;  2F4V B;  3APQ A;  1VQL V;  3HKE A;  3CCU V;  1Y6X A;  4JTD B;  2HVJ C;  4UB6 Z;  1GTO A;  2NLJ C;  3ZED A;  2CE4 A;  3HKC A;  4EB6 B;  1IBL O;  5JJJ B;  5F02 A;  1NL6 A;  2G7Y A;  2DW4 A;  4ASU G;  4Q20 A;  3K5O A;  3H89 A;  2V7Q G;  3QO8 A;  1ORQ C;  1M57 B;  1B3Q A;  2XU3 A;  2DYS C;  3T1C A;  2LQT A;  3ZHQ A;  1FXK C;  1HNZ B;  1Q6I A;  2YIB D;  5EYP B;  3QT4 A;  4AXM A;  1GEC E;  1QBZ A;  4RKX A;  3BPF A;  1BHB A;  4I4T A;  4PEL A;  3T1Y O;  1VSN A;  3P30 A;  2UUB B;  2HHH B;  2FE8 A;  1YAL A;  1I94 O;  5B1B C;  3BWK A;  1H8E G;  4IIJ A;  4PD4 F;  1RM1 C;  3STL C;  2B5U A;  4MSW C;  3R65 A;  4DK1 A;  2UUA B;  4OEL A;  1N36 O;  3E8G A;  3RYI A;  4PA3 A;  3D3Q A;  4JAV A;  5FNV A;  4BR6 A;  1IBM O;  2PRE A;  1JR9 A;  1ZLZ A;  2D2C B;  4LH6 A;  4YVA A;  1MZF A;  1AYU A;  4MI7 A;  8PCH A;  4PDL A;  1N0J A;  2ADQ B;  3P5U A;  2R9N A;  1M56 B;  3E8H A;  1QR8 A;  1WPX A;  4JI8 O;  2DYR B;  5C8Y A;  5ITZ B;  1GCB A;  3UO3 A;  3CCJ V;  1AI4 A;  4CH6 A;  1N34 B;  2ODM A;  2W0X A;  5IJ0 A;  4GZR B;  1ROP A;  3UT5 B;  3UCS C;  3IC9 A;  2FRQ A;  3LNM B;  4N4Z A;  1PL4 A;  1EN6 A;  3ICX A;  2X7R B;  3PN1 A;  4U3F H;  4PDM A;  1IDS A;  5IT9 N;  4O2A B;  1NB3 A;  4NKG B;  3E35 A;  4I0X B;  4TT3 G;  3HD3 A;  5E1A C;  5JJE B;  1S77 D;  2Q0O C;  3H1J H;  4UB8 Z;  4DR3 O;  2FT2 A;  2H8P C;  3OE7 G;  5EC1 C;  1SNK A;  2HHH O;  3ABU A;  4CC6 A;  1YZB A;  3W7W A;  3SJB C;  1WB8 A;  1S5J A;  4WFH A;  2QKA A;  4MVZ A;  2FQ9 A;  2ZCE A;  2N74 A;  4XBF A;  4BS5 A;  1I7F A;  2KG7 B;  2UUA O;  3U8E A;  4JZG A;  3S3X A;  3D36 C;  4YJ3 B;  1KHP A;  4CS3 A;  3N3G A;  4AXL A;  2VQF O;  1SA0 B;  4J9Z B;  4DR6 B;  1LNQ A;  4PI0 A;  4WUR A;  3OUF A;  1LUV A;  4N21 A;  1EWP A;  4DR1 O;  5EBW C;  5B3S B;  1XL4 A;  4DR5 B;  2BTQ B;  2YI9 A;  4J41 A;  5IY5 B;  4B3M O;  2UXB O;  3SJC C;  5KO3 A;  2DC7 A;  4O4L A;  3TRK A;  4E4E A;  4TV8 A;  1M93 A;  2P06 A;  3W7U A;  1OCR B;  3TXS A;  1UJW B;  2B9Z A;  4I50 A;  3ASN C;  1MDW A;  4NTW A;  1TA8 A;  3VQW A;  2A79 B;  3J80 N;  4FJC A;  4RQE A;  3RVX A;  3IEJ A;  5K1X A;  4UVB A;  1AR5 A;  4UCS A;  3RYC B;  2P7T C;  5J94 A;  3KW9 A;  1SKV A;  1W59 A;  2W6J G;  4UUJ C;  2OIE A;  3BA8 A;  3KG2 A;  3MDS A;  3O0U A;  4QE7 A;  1F2C A;  2ZE7 A;  1JX9 A;  3B8N A;  1NS1 A;  3AI8 A;  4Q8G A;  4DV6 B;  1OV9 A;  3K9S A; 
#chains in the Genus database with same CATH homology
 4YHH O;  2BTW B;  3O65 A;  4X66 O;  4BOP A;  4DR2 O;  1FJG O;  4JYA O;  3M8A A;  4JI5 O;  2UZJ A;  4BOZ A;  3F5T A;  5FLX N;  1HNW O;  4BOQ A;  2VQE O;  1DKI A;  4DR7 O;  4DV2 O;  1XMO O;  5IT9 N;  4IUM A;  1F7Y A;  4DV5 O;  1AB3 A;  4YY3 O;  3T1H O;  4X64 O;  4B3S O;  1FYJ A;  2UU9 O;  3BY4 A;  2LW7 A;  1R6T A;  4DR5 O;  2F4V O;  4OPH A;  1AIL A;  4JI0 O;  3BB7 A;  4DR3 O;  4RF1 A;  2JTC A;  3IFU A;  1FKA O;  2HHH O;  3PHX A;  1PVJ A;  4D8E A;  1YZB A;  4DR4 O;  1HNX O;  4LF7 O;  2JRI A;  4DUZ O;  2DJV A;  4LF6 O;  2UXC O;  1XNR O;  5A2Q N;  3PRP A;  2N74 A;  1IBL O;  4IP3 A;  3MP2 A;  4JV5 O;  4D8I A;  4DR6 O;  1HNZ O;  3J81 N;  4R3D A;  2UUA O;  4NXN O;  3ZNH A;  3SDL A;  1DK1 A;  4B3T O;  2J7Q A;  2FKX A;  1N33 O;  3TMP A;  1N32 O;  4DV7 O;  2VQF O;  4A5U B;  4NXM O;  3RNV A;  2AGA A;  4OVZ A;  2HWK A;  2ZM6 O;  1KUQ A;  4JI1 O;  4DV3 O;  3PT2 A;  2BTW A;  2Z84 A;  2UUB O;  4LFB O;  4WUR A;  5BY1 A;  4DV0 O;  1XMQ O;  4RNA A;  3BBA A;  5JZE A;  1A32 A;  5IWA O;  4P16 A;  4RKX A;  1XEQ A;  3PHU A;  4DR1 O;  4AQY O;  4RF0 A;  2UXB O;  3OTO O;  3T1Y O;  4B3M O;  4REZ A;  3W30 A;  5KO3 A;  3J7A U;  5LL6 Y;  2DOS A;  4GKJ O;  2FE8 A;  4JI6 O;  3E9S A;  4DV6 O;  4GKK O;  1I94 O;  3TRK A;  4GUA A;  2ZKO A;  4X62 O;  4BOU A;  4ZTB A;  3RT3 C;  5LMN O;  4LF9 O;  3PSE A;  4OPA A;  1IBK O;  5EZS A;  3JAM N;  4B3R O;  4LF4 O;  4LFC O;  3J80 N;  1N36 O;  4XZX A;  2E5L O;  4M0W A;  1UKF A;  4MM3 B;  5H5N A;  2UUC O;  4OW0 A;  4X65 O;  3MTV A;  3C0R A;  4DV4 O;  1XNQ O;  4KHP O;  3W31 A;  1IBM O;  4JI7 O;  3MJ5 A;  1HR0 O;  4K0K O;  4PT5 A;  4LF8 O;  4MI7 A;  1X59 A;  3PRM A;  3B21 A;  3PHW A;  4A5U A;  1R1B A;  4DV1 O;  5BXZ A;  4JI4 O;  4LFA O;  5BR8 O;  4BOS A;  1J5E O;  5EZQ A;  1G1X B;  1NS1 A;  2J7Q C;  4JI2 O;  4JI3 O;  4DUY O;  1N34 O;  2UXD O;  4HXD B;  4OX9 O;  5LMU O;  4JI8 O;  4D8B A;  3R66 A;  4LF5 O;  2BU3 A;  1D2D A;  5E6J A;  2Z0A A;  3OQC A;  4OVZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...