2AGAA

De-ubiquitinating function of ataxin-3: insights from the solution structure of the josephin domain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
190
structure length
190
Chain Sequence
GPLGSMESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIRVQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Deubiquitinating function of ataxin-3: insights from the solution structure of the Josephin domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Machado-Joseph disease protein 1
total genus 40
structure length 190
sequence length 190
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02099 Josephin Josephin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2agaA02
3.90.70.40 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2agaA01
4JI8O 1HNXO 1R6TA 4OPAA 4AQYO 1YZBA 2DJVA 3T1HO 2JRIA 4KHPO 2UUBO 3J81N 5BXZA 4DR5O 2N74A 4JI1O 5BY1A 4JYAO 4LF7O 1XNQO 4GKKO 4LF6O 2UUCO 4B3SO 4JV5O 3SDLA 4DV3O 2UXDO 4DV1O 4DUZO 5FLXN 4DR2O 1HNWO 4DV2O 5LMNO 5A2QN 3O65A 5H5NA 5LL6Y 4LF5O 1FYJA 4LF4O 3OTOO 4DV0O 3J7AU 4JI2O 4JI3O 4X64O 1XNRO 2AGAA 4A5UB 4DR1O 1I94O 2HHHO 4DR7O 1DK1A 4DR6O 3J80N 1J5EO 2VQEO 4X65O 2DOSA 1R1BA 4DV6O 4LF9O 1XEQA 4K0KO 5BR8O 2F4VO 3JAMN 3RT3C 4DV5O 4LFCO 4DUYO 2UXBO 2Z0AA 1XMQO 2ZM6O 4JI0O 4JI7O 2ZKOA 4YHHO 3F5TA 4B3TO 4NXNO 4LF8O 4JI6O 2FKXA 1N34O 1D2DA 1IBLO 1FKAO 5LMUO 2UU9O 4OX9O 4X66O 1G1XB 1KUQA 4YY3O 1N36O 4OPHA 1IBMO 4JI4O 3T1YO 3M8AA 1IBKO 4LFAO 4B3RO 2LW7A 1AILA 1F7YA 1HNZO 1N32O 2E5LO 1XMOO 4NXMO 3R66A 4LFBO 2UUAO 4GKJO 4X62O 4JI5O 2UXCO 1HR0O 1N33O 1FJGO 4DR3O 1X59A 4B3MO 1AB3A 4DR4O 5IT9N 4DV7O 1NS1A 2VQFO 1A32A 5IWAO 4DV4O
chains in the Genus database with same CATH superfamily
1V55B 4RUEA 1Q8IA 3W7WA 3KZIZ 5LXTA 4DV2B 5K16A 1MZFA 4H13B 1AJQA 4X9QA 3X2QB 4I4TA 5BXZA 3EFFK 1SQVH 4YJ3A 5E79Z 2QSAA 2R9NA 2W0FC 5B66Z 4J7ZA 1PPJH 3ETEA 3O9OA 1BCCH 4LF6O 1VF6A 3DSQA 1NTMH 4PDVA 4DUZO 3OF8A 4AILC 4JYBA 1GKFA 4DV6B 2A7WA 3ERVA 3L74H 1M56C 4JI4B 4UUJC 3ZHRA 5IY5B 2LFRA 4JI2O 1V55C 3PDFA 4P9PA 2IBZH 3P5XA 1TA8A 2Q4PA 4YYRA 1YDXA 3SJBC 5CN0A 2JIZG 2YXYA 4Q20A 1K97A 4OEMA 5JWPA 2B1MA 6PADA 1VQMV 5FPRA 3W7TA 4EB6B 1N8RW 2O6XA 3RYCB 3JASB 4LF9O 4DV0B 2QGNA 3ZHTA 1YK8A 4XDJA 1WP8A 1KKDA 2AS8A 1VQ6V 4YYWA 5CMUA 1OCOC 2EIMB 2CTWA 4U7NA 1THZA 1VQOV 5LBQA 3K5OA 3JD0A 4MSXA 5CB4A 3CX5F 3H8BA 5CBGA 3VQXA 2IBIA 1NH2B 3E35A 2ZM6B 2CB5A 2UXDB 3LXSA 4WFBV 1Y4MA 2LW7A 5LXTB 2NQIA 3FYIB 1WJZA 3ZHVA 3WB0A 4CC6A 2HHNA 1AI4A 1HNXB 2ZT9B 2MW2B 3IC9A 5LMUB 3ZRVA 1S5LZ 1VQ8V 4EB6A 1KU9A 4JI1B 3OR6C 3T1CA 5DM6V 1YTFD 2PNSA 4DV7O 4DV4O 1VP7A 1EWMA 4J41A 3MJ5A 1HNXO 3NHEA 2AW9A 2BE3A 4AQYO 1YF2A 3ABLC 2Y48A 3LDEA 1TUBB 4PELA 3ABKC 2YIAA 4LR3A 1Q82W 1I5YA 4UXNA 4DXWA 1M90W 2P4VA 2Y4TA 3MD0A 5BY1A 3PT2A 3BY6A 4JYCA 1Q6IA 5KHGA 2DJFB 2G6DA 4QRGA 1U97A 4GKKO 2QWPB 5K1PA 1AP6A 3AG1C 4LNUA 5FLXN 1RM1C 3PHWA 1GO3F 3UT5A 4YV8A 2Q68A 2BDZA 2HH5A 2BTOA 2V4DA 3OTOO 1KFUL 3N2KA 1U5IA 4CBCA 1ZTEA 4CH5A 4ICGA 3BPMA 5JA7A 1NZ6A 2DC8A 1EN5A 1VIBA 2DYRC 1SF9A 1SQPH 1PCIA 5EGWA 4X65O 5KA5A 4YXWG 5LGNA 1WPXA 5GTIZ 4G2KA 2OIEA 3KKUA 1PADA 4G27B 4TUYB 4BW9A 1YJNV 1BGYH 4KL1A 1K7DA 3IC7A 4CS4A 2L35A 1Y74B 4BS6A 4LFAB 2ZCEA 4X65B 3SYAA 4DK0A 2UUCB 1AYWA 2IU0A 2XU5A 4BR6A 2PI5A 1D2DA 2DCAA 2R72A 5L3EA 4DMXA 2QWRB 3A0RA 1ZX3A 2GTAA 5D5PA 4JYYA 4LFAO 1BGOA 3HWNA 1CTEA 3BWKA 4LC1A 3O0UA 4FIPC 1VSNA 3TK1A 4JZ2A 1PVJA 2W0XA 1RP3B 3TNXA 4PA6A 4MTXA 3CS5A 3WU2Z 1HR0O 1I94B 5JZEA 1US6A 2FO5A 3OGCC 1JFFB 3BAAA 1KHPA 2P5OA 4DYLA 3WG7C 1AI5A 5H9CA 5J2TA 3AG2C 4FJCC 5FNVA 2ZIMA 3RVVA 3N27A 1KD1W 2PI4A 4YYUA 1LNQA 1PNMA 3K79A 1F4MA 4AHCA 1XKGA 3PHUA 1OCZB 4J7JA 5KHIA 4DV3O 3F5WC 5EC2C 3M99B 4DV1O 2JK5C 1E79G 4QJFB 3QSDA 1PXVA 5LMNO 3VOUA 1QLEB 3HKBB 2GV9A 2JDIG 1FXKC 1N36B 3HPLC 3H89A 4NTXA 1IBMB 5ITZB 3D8CA 5ITZA 1MEMA 3J7AU 1TVKB 2J7QA 2ARYA 2C0YA 1Y6XA 1CQDA 4DV1B 3MHSC 1WP7A 5BMVA 4I0XA 5KLVH 3MP2A 1NTZH 2CH7A 1B6QA 3L70H 1JMKC 1HDJA 2PADA 3I3TA 3JAKA 2YEVA 4O2BA 2KQXA 5LHIA 2Z0AA 3N2KB 1GH6A 5CBHA 1M1KW 5KMGB 1GM9A 4X1YA 2ITCC 2E74B 1OCCC 4J9ZB 5B3SB 5F2VO 4JI6O 4B08A 1QBZA 2YUAA 2Q7HA 4NYKA 3A2FA 4GZRB 5CB4B 3P5WA 2UUAB 1PL0A 4PD4F 1KUQA 1AI6A 2CAZC 4RAIA 3CRQA 4YY3O 5GONB 5A9GA 2L6LA 3JD2A 4ZUXU 2Q6AA 2WLJA 1BP4A 3CBJA 2GSMB 2JEUA 4DR3B 2B1IA 2YI9A 3TXSA 2Q8VA 3QO5A 2X6BA 5GW7A 3G6BA 2IJHA 3W7UA 4N79A 2UUAO 1XHZA 5LOVA 4D8IA 3L73H 2HLDG 1S4VA 3FD9A 2Q5ZA 2FE8A 2XU3A 2PUSA 4XDKA 2KB1A 2LQTA 2EIMC 4DR3O 1MZEA 3K9AA 2DYRB 3ZN0A 2XAHA 2YEVB 3M99A 4I05A 3H1JH 3K03A 4ZKIA 4J9YB 5EZYB 5EZQA 4MSWC 2DJVA 2F23A 2JRIA 2UUBO 4DV5B 2OULA 2CTQA 4LF4B 4O2AA 4O4HB 1H8HG 1YTFB 4NVPA 3LSSA 4B3TB 1M6DA 1KXRA 1PPDA 4I07A 3ZUAA 5B5EZ 3K24A 1R73A 3WB2A 3DXRA 4D6TH 4RO2A 4LF4O 3OR7C 3DGEA 1P7GA 2PYJA 2PREA 2ZE6A 3U10A 2QWOB 4K7CA 3ABTA 3USVA 2RJZA 2EINC 2EILB 2BCCH 4B3SB 4PDRA 1L1FA 1SZXA 4R50A 2VQEO 4U3FH 1Y67A 2KKWA 3JARA 3K0DA 3H8CA 1GN3A 4I50B 3F75A 1GK9A 3CP1A 3KG2A 2X7RB 2F4VO 4F6RB 2ATKC 2PTMA 4YVAA 1Q5OA 2R9IA 2AZ2A 3E9SA 4X6JA 1XMQO 1F51A 4N4ZA 3ZS8C 4KLBA 4UV8A 4ZOLA 4PA4A 2EJ7A 1UFIA 4H44B 5B1AB 1QR9A 1PM9A 3IMAA 1VQ4V 2YIBD 1AYUA 1XL4A 3DTUB 1GLOA 1SNKA 4U3JA 3RVXA 2FYUH 5JVDA 4JI4O 1EN6A 3M8AA 4HZ3A 3HKBA 3C9EA 4J11A 4X88A 4B3RO 2PF4E 4X20B 3RGBA 3N3GA 1QHTA 4QGPA 4R7CA 1N0JA 3B09A 2PGGA 2VWKA 3K57A 5KUMA 1MDWA 2QKSA 4YYVA 4DR7B 4GX0A 2R6NA 4F6EA 3PSEA 1DKIA 3SYCA 1CPJA 3H9VA 5JH7A 4DR4O 3OEEG 1NS1A 1GMGA 3OAAG 1YJWV 4BOUA 1N32B 1FFTB 1N4CA 1WAZA 4Q6GA 1H2LA 2OIGA 1VF7A 2FTDA 4K8ZA 3KX1A 4NXNB 2IH1C 2F66C 4O4IB 3I56V 2KG7B 2GHYA 5IJ0B 1MOFA 4JI2B 4JYAO 4DR4B 2GUZB 5CA0B 4PA3A 3E8HA 3OW2U 1JQPA 1B3QA 2PBHA 4L87A 2UXDO 3E22A 3JD4A 1NVPD 1N0NA 3BCNA 4Z2WA 1S76D 2E5LB 1NH2D 2YJ9A 2DW4A 1SA0A 3IJ4A 4DV0O 2QWNB 4FLUA 3CCSV 2NNUA 1AYVA 3SPHA 2YXHA 1COWG 1QNMA 3B8MA 3JD3A 4P6GA 2G7YA 4GT1A 4DR6O 3HKDA 2JS5A 4Z1VA 2OTLV 4REZA 1FH0A 3NR7A 2XOKG 2A0LA 4DV7B 1FXVA 1K92A 2DOSA 3CMEV 3HKEA 3SJCC 5IJ9B 2YDEA 3DF0A 1Q3EA 3QJ3A 3OEHG 4HNAA 1DF4A 3JAMN 2AVWA 4X20A 3APQA 4FK5C 4FLXA 4DUYO 2IU3A 1YITV 2P6JA 1XILA 2ZM6O 4JI7O 1K73W 3CCUV 1AU3A 5GTHZ 1HUCB 1EZVH 3TCUA 2BTWA 1ZLZA 5EBMC 5LMUO 4OX9O 2ZNIA 1AP5A 3OTOB 2OCCB 3VQVA 4FLVA 1F2BA 4JV5B 3PJSK 3ABMB 1J95A 3FKSG 1VQNV 4OVZA 1Q6HA 2K1EA 3BA9A 1M9NA 5FNVB 2KG7A 4LFBO 4X62O 4TQDA 1YJ9V 1OV9A 2Q73A 3ZMZA 3GVMA 1ENVA 2P7UA 4PI3A 3U11A 1IVSA 4QH6A 2A79B 3E22B 4HXDB 2LFSA 4GKKB 1AR5A 9PAPA 1Q43A 5LHHA 3T1HO 2Y0PA 4KHPO 1FXKB 2F7DA 4BPVA 3OT7A 2WLIB 2ZD9A 2N74A 1IURA 1YVWA 4NB5A 3UKMA 5JQGA 2O57A 1Y76B 2W6IG 3L72H 1AI7A 1S77D 1GN6A 2P67A 3ZRWB 4DR2O 3ZIAG 3O1GA 2Q67A 3T1HB 4KHPB 4WFHA 4RQFA 4HNAB 3O65A 5IYZA 3CRCA 3OVZA 4WFEA 5CA1B 1XNRO 2MK3A 2P22C 2AGAA 1I94O 1GCBA 2JJ2G 4I4TB 1XHXA 2BTQB 1BHAA 4QE9A 4IGGA 3OQCA 1SETA 3KCYA 4PI0A 3G80A 2ILMA 1IX9A 1R1BA 2UZJA 2WA4A 1M57C 3RYIB 2UU9B 3ZRSA 1MABG 2F43G 1ITOA 1URFA 2H3OA 4WFGA 3P5UA 2W6JG 2RNBA 1P49A 3OMAB 3BVOA 1LUVA 4A5UA 1IBKB 4I7ZB 4TOIA 1SS3A 4DV3B 2QKCA 1GRJA 2UU9O 3MORA 1W0JG 1N36O 1HR0B 3ZNHA 1IBMO 4I5SA 1PPPA 2NLJC 5JVDB 4QBBA 2YI8A 5L3DA 3AK3A 4GYCB 2QJ1A 4MVUA 1IBKO 1F7YA 1D5AA 3CRMA 2B5UA 5LP6B 2NQAA 3AI8A 1FXKA 3BA8A 4QE7A 4FK5A 3G4SV 5IYBO 2ZNJA 4FZ0A 2X0LA 1W2BU 4YIPA 1SRYA 2YJCA 4GLXA 1S3JA 2AHZA 1YK7A 1YXBA 2P06A 2K9PA 2YIBA 4J7KA 4DMYA 4B7KA 2R9OA 1R6TA 3JD1A 2IJJA 2QA4V 4XZXA 5KX5B 2ZQMA 3STZC 3ABUA 3LDCA 1O0EA 1K4CC 4G28B 5FL7G 2H7JA 4X1KA 4N21A 3ICXA 3CEIA 2Q7EA 4KXRA 1FAFA 3CCRV 4PJ0Z 4DRXA 4JPRA 4WBNA 4IT5A 4BOPA 2ITDC 2GFOA 3RBZA 5IY5C 3CHXA 5D5QA 4P9OA 3F7YC 1BQZA 4MT8A 4O4LA 2ZDIC 1BL8A 3UQ8A 1K8AW 5C8YA 1L0LH 3ABLB 5LL6Y 1K5SA 3CPWU 4LF5O 1GMYA 3JSNA 3TRKA 1OZ0A 2RMKB 3ABMC 1QVGU 1CEZA 1Q6UA 3RYFA 2YJ8A 3JALB 3WXFA 1PV0A 1E1RG 4GX1A 2NR5A 4UCSA 1UJWB 3UO2A 4JI6B 3HD3A 1U96A 2FMLA 5IJ9A 3H01A 2CIOA 4LF5B 2E03A 1PBHA 2D2CB 4KP4A 1XQ8A 4UCVA 1UKFA 2AUZA 1PD3A 1SQFA 4DV5O 1JQ0A 3BOWA 1Y66A 4PV1B 2XU4A 3CH3X 2RQ6A 2WLKA 4TSFG 4PHZA 2WLMA 3AG7A 3ETDA 4ABMA 3K06A 5FPWA 2QEXV 1TLOA 3CWBH 1STFE 4B3TO 3OUSA 4FLYA 4LF8O 5J2UB 4YJ3B 4K3AA 1CP9A 3BC3A 3ML0A 3CC7V 4FFBA 3H7DA 1P84F 1X4TA 3GWOA 3BPFA 3Q4HA 3T1YO 1RFYA 4FJCA 1FS0G 3Q4HB 2LJ2A 3N4CA 1AILA 5BZBA 3L75H 1U9XA 2Y6EA 4CDEB 2OTJV 3RVZA 3S3XA 2VQEB 1ME3A 3RNVA 2EJRA 4MS2A 2UXCO 4UV9A 1NLJA 2QM7A 1YALA 2UXBB 3SPGA 3W7SA 2A9HA 3BBAA 4MZOA 3ZCCA 3FFQA 4UB6Z 1AECA 3TJTA 2EZOA 2HKOA 4PDMA 4IIJA 5E6JA 3L71H 3S3WA 4JI5B 1JOYA 5LYJA 4X89A 1WB8A 4JGSA 1MG1A 3FYEB 3KWBX 3A0BZ 1I7FA 3K9SA 2EILC 2EINB 4DR1B 2Z3YA 4FFBB 1JR9A 2EZPA 4LP8A 1WA8B 4B3SO 3IGAC 1G6UA 1JVMA 4RY2A 4DO2A 2GHUA 1QU7A 3UT5B 3D3IA 3MTVA 2R9RB 4LCUC 2J7QC 2EIJB 5TISZ 2CGNA 2EIKB 3APOA 2F4VB 1ZCMA 4DR1O 3B77A 1GM8A 1KB9F 4X1KB 3ASNB 3B79A 4NTWA 2PY5A 3W31A 2AIMA 4O4JB 3E1ZB 2X6AA 2IH3C 2IM9A 3LSUA 1NQCA 4WCEV 5FPOA 3E83A 5CVOB 3CCMV 1DTOA 2DQ0A 2YSUB 3QO8A 3OGIB 3SPIA 3PBHA 1KECA 4WA6A 4AXLA 3LUTB 2UXXA 4B3RB 3I06A 1NPZA 1V54C 4I04A 2Y4UA 3WXGA 1FD9A 1OCRB 1YEWA 3ZHQA 1BQ0A 3F7VC 4DUZB 1GTOA 1CJLA 4DRXB 4I0XB 1YCIA 1G1XB 1ZL8A 4BAYA 3SYPA 4YIOA 3CC4V 3I5DA 4HAMA 1M56B 2PZSA 4FM2A 3QO7A 1AU2A 4BS5A 1N32O 1R3JC 1H8EG 3M7MX 1S72V 4GKJO 2WPDG 4X66B 2XNDG 2F93B 3GB7C 1FPOA 1VQPV 4MTOA 1WA8A 1R3IC 1FJGO 4CH3A 1PNLA 3AK1A 4JYAB 1VQKV 4I55B 3KCXA 1JX9A 3C3SA 4DUYB 3SYOA 1BS3A 3HKCA 2YXLA 5IWAO 1H2GA 2WLHA 1ZUQA 4JI7B 2JVDA 4GKJB 4UFZA 1YZBA 5CVNB 3CBKA 4NR1A 1N33B 1FJGB 2OZ2A 1Z5VA 4FM1A 4LF7O 4RKXA 2Q0AA 2QDOA 3OTFA 4X1IB 3RYHB 4PA9A 1AVMA 1TAEA 4TUYA 3LSQA 3SPCA 3CD6V 2B1NA 3K08A 1SC5B 1QQCA 3MTNA 1GAXA 2LGQA 1TL9A 1CB5A 4HBNA 4ZIBA 1XMOB 3ZHUA 3IV2A 1I08A 3VBBA 3JASA 4UCUA 1SQBH 1K3BB 4IUMA 3WG7B 4OX9B 1QOLA 1NL6A 2XAGA 4J10A 3ZN1A 2OCHA 4XDLA 3PNRA 3ZMSA 3G71V 4CC5A 4RWUA 2JGDA 1EWOA 3JAWB 2LGWA 4JZGA 5EBLC 4NXMB 3V6EA 4IHJA 3JCZA 1AROP 4DR2B 3MDSA 1MA1A 3AEIA 1OCRC 2E3CA 2DCDA 4F4LA 4LFCB 4I50A 4JTAB 4JF3A 4OXSA 3BY4A 2CTRA 1ROPA 3K3WA 5KHHA 1OHHG 2XU1A 3UCSC 4JTCB 4NXMO 2BSKA 4WF9V 3P5VA 2HVJC 2HG5C 1DF5A 3K5LA 5EIBD 8PCHA 3K58A 3DC6A 2CH7B 1YT7A 1MS6A 1K3EA 4R6ZA 1X59A 3RVWA 3L9DA 4LWSB 3BFRA 3BPZA 2Y5BA 4OGQB 4LF9B 2DJGB 3C3TA 4PADA 1POPA 5IE9A 1Y74A 1E1QG 1T5EA 2X6CA 1XNRB 5LA6A 5LA6B 2DWEC 5JJJB 1RSOB 2VQFB 2E75B 2A3QA 3N3KA 2ZXWC 5KA6A 3PHXA 5CHTA 3KW9A 1NT2B 3CXCU 1K4DC 4JAAA 4FMTA 3DXRB 3OVXA 4QRVA 2GDSA 4JI3O 2G8EA 4IL6Z 1ATKA 5KHKA 3CJHB 4TV9A 1ICFA 4W4KA 4X1YB 2E76B 3V6CA 5IJ0A 1XL6A 3K9MA 3PW3A 5EYPB 3WFVA 1NR7A 4XBFA 4Q8HA 3IAYA 3CXHF 4N8WA 1N34B 4YJ2B 5EF4A 3HKCB 4JI3B 1BSMA 5B1NA 1SA0B 4GX5A 2AXTZ 3FAVB 3SGIA 2FRAA 2BSKB 2ODMA 3FAVA 4QIWF 1VQ5V 2KSDA 2Y69B 3JYCA 3GWKC 1VJVA 1N34O 1IBLO 3ZRXA 4YYQA 2RN9A 3H1KH 1KKCA 3K5MA 4LNUB 2NN4A 1Q81W 3ZMTA 1VQ7V 5K1XA 1YIJV 1CSBB 4IIJB 2EBOA 2CUGA 3AG4C 2EULA 2XASA 3PN1A 1HNWB 3H1IH 4MM3B 2M6YA 1Q86W 2ZDIA 5LYJB 4JTDB 2YC0A 1IBLB 4TT3G 1JA8A 2DYSB 4H37A 4ZTBA 3QTCA 2ADPA 3ZX6A 1VQLV 4DR5B 1KQSU 1RSOA 2P7TC 1GN2A 1ZIVA 1DLBA 1H2KA 5H6QA 4CZZA 4R8CA 1HNWO 3EXAA 2M7WA 2RCVA 4OPAA 2LO1A 2AHYA 1Q6KA 2QTSA 3J81N 1PIPA 2WSSG 1S5HC 5LOVB 2DMXA 4DR5O 2IPPB 1R6KA 4W5CA 3JAWA 1XNQO 4O4JA 1KBHA 3SR2C 2DYSC 1IZ3A 2Z5UA 2UUCO 4BIOA 4J80A 3N2GB 2YIDA 3CCVV 3CCJV 5KO3A 1MHWA 5A2QN 4F6RA 3P3PA 1DEUA 2HD5A 2WLNA 2HFEC 3ZMUA 3ASOC 1LUWA 2JEXA 4PP2E 4D8BA 1TUBA 2UXCB 1GN4A 1XNQB 3W7XA 3KKYA 4O4HA 3K8UA 1MMMA 2CGOA 3CRAA 2ZINA 2G8JA 1ZL8B 5BMVB 3X2QC 2B9ZA 3MAQA 2QM4A 2Q0OC 1P7BA 1XEQA 4K0KO 1EWLA 3RT3C 1NVPB 3EVKA 3CMAV 1U9QX 5B1OA 3UO3A 4D7SA 3OFNG 3T1YB 5B1BB 4O4IA 4MTGA 4JI0O 1EBOA 3IFUA 1S5JA 2ZE8A 3ASOB 2EIKC 3FB7C 3D36C 3P3NA 3E86A 2YJ2A 3LFYA 2Y0IA 3JARB 4QRXA 4K0KB 1X9YA 1Q90D 1GM7A 1SZTA 4OW0A 4OPHA 3IFXA 4K35A 4RUFA 2AYOA 4E4EA 4ASUG 1TVKA 4JAUA 2QE7G 1K9MW 2P0RA 1H38A 3VQWA 2VWJA 3TGUH 3HHIA 1Y08A 1FFXB 1EFRG 4JI5O 1F4NA 5EK0A 4X64B 3HHAA 3IEJA 4I9WA 4CH6A 1TU6A 5B3SC 1UPGA 1R3KC 3HKEB 2Y69C 1VARA 4U3JB 2F1GA 2R9FA 3N2GA 2D3OW 1Z2GA 4H0LB 4O2BB 5LGTA 4YJ2A 2DC7A 2ZIOA 4LWSA 1MSDA 1QXPA 1MNGA 4HYOA 1H2MA 5L3BA 1PL4A 2DWDC 2XHBA 2A06H 1R3LC 3CCEV 3CH2X 4PI2A 4E2LA 1FXHA 3QG5A 3CB2A 2IJKA 5DECA 5H6RA 5KAFZ 2R70A 4U7OA 3RYCA 4B7EA 4BOQA 4CS3A 2PYLA 3R65A 4YY3B 2YS8A 1F29A 5IYZB 2JGUA 3QVNA 1YSCA 3H1LH 4LBEC 3CYOA 4DR7O 1BT8A 1DK1A 3P32A 1CPYA 4QPJA 3TETA 4H33A 4IHJB 4KFMA 1BZKA 3FB6C 4EFBA 1M57B 4CS2A 4FLTA 3QNEA 3FB8C 1L0NH 3SJAC 5IDJA 3ETQA 5LP6C 4L8JA 4MVMA 2ATOA 3HB3B 4JI8B 2P86A 3F5TA 1FFXA 4FPPA 4GUNA 3OISA 5JJNB 3D36A 1FKAO 2ARHA 2DC6A 5BR8B 4X66O 1SERA 3E2EA 1AR1B 2JJ1G 3G6EV 4M0WA 3LNNA 2B1GA 2HWKA 1P4RA 5L3GA 3QF7A 1V9PA 3JATA 4UVBA 4BIZA 5IWAB 1SQXH 1XMOO 4X6IA 2BOCC 2XAJA 4O2AB 4RQEA 4FIPA 4UVAA 7PCKA 3LNMB 4PA7A 4RNAA 2BTWB 4CDFB 5C93A 1CV8A 1IXMA 2JTCA 1N33O 4MTFA 2YICA 4B3MO 1AB3A 1BE3H 4WURA 4MVZA 1SESA 1NKDA 1XBLA 2P4KA 3RWRD 3A0HZ 5DN6G 5J2TB 1L8DA 2FQ9A 2DCCA 2FB5A 4UCOA 1QLEC 4ZOLB 3PRPA 4MVOA 5KMGA 3B2EE 2RDCA 1SP4B 3OD4A 1KYOF 1F2CA 5KAIZ 1QR8A 2DQ3A 2R9AA 4AXMA 4JV5O 1BY8A 5F02A 2VHSA 1AR4A 2GTSA 2EIJC 5EBWC 4DV2O 5EZYA 4JASA 1TGOA 2YJBA 3IHPA 3T4DA 1WNSA 4CH4A 2WLIA 1XREA 3J80N 4MVRA 1Y76A 3BB7A 5AG2A 1VQ9V 2JQGR 3A8TA 3KSEA 2CE4A 3MHSA 4DV6O 1ZSPA 1HW7A 4G54A 3E89A 3RFRA 1SQQH 2FTKA 3JATB 4LFCO 4I9QA 2OWOA 2Q9LA 3AG3B 3BRCA 1HP8A 1GECE 5LP6A 1H2NA 1MIRA 2ZKOA 4YHHO 5DEDA 1BHBA 4UCTA 4NXNO 1VF6C 2ZE7A 2AU1A 2EX3A 3S3RA 4LH6A 2HVKC 3TMPA 1SQGA 4MVQA 5KHJA 1F2AA 4MZSA 2OYQA 3OE7G 5CHVA 2XAQA 1JFFA 2CK3G 3DC5A 1ORQC 3K5NA 4P30A 4O4LB 4LF6B 1JCHA 5C8YB 4ZHQB 1QDQA 1PE6A 4YHHB 1F23A 1AU0A 2DN9A 1O9HA 4KUMA 4WFAV 2E5LO 1PNKA 2F1MA 4QPKA 4ZI7B 2N04A 1MEGA 1B06A 3C90A 1B04A 4DR6B 1DF0A 5CA0A 2DZYA 3BHPA 1Y4HA 3VQYA 2VHFA 2Q69A 2IW5A 1A6RA 3ZMVA 2N05A 2ZE5A 2VQFO 1RPOA 1O9GA 4DW1A 1EWPA 1EF7A 4MVSA 2XUMA 3E8FA 5EIBC 2DCBA 2C2AA 3ZBHA 4TWKA 2WA3A 3HKDB 4JI1O 4EFEA 1WN7A 3IUTA 4YYSA 4DV4B 3B8NA 1KP3A 2HJFC 3JAKB 3SDLA 3WXEA 1G4YB 4DW0A 1QMYA 4I55A 4AQYB 4NTYA 1M5IA 3KFQA 2HJDA 1BMFG 3C0RA 1M93A 5EC1C 2LW1A 2WLLA 3THOA 2H94A 2WAMA 3OF9A 5KX5A 2HP8A 3WB1A 2FYEA 2R9MA 4EKWA 2UXNA 2BTQA 1VMGA 1I0HA 1J5EO 4LFBB 2GUZA 4WBNB 4PP1A 1PKXA 3T2MA 4X62B 1THEA 1NB5A 1WB7A 3PRMA 2R9CA 2ETNA 1NI8A 3B4SA 5JH7B 2Z84A 4N23A 4BWAA 1K5QA 4UVCA 3RVYA 3STLC 1XI1A 2DZZA 1KHQA 1KP2A 5HFMA 1IDSA 5JJEB 1J5EB 3RYFB 2E00A 3U0ZA 3RN4A 3NXSA 1CS8A 4ZI7A 2FUDA 3CSXA 1XOUA 2XT9A 4ZBMA 4W4UA 1AJNA 3KWZA 4D7TA 1AJPA 5EZSA 1PP9H 4P16A 3AG4B 3CE2A 2QM8A 1EN4A 1MSWD 4GX2A 3H6SA 2AZ0A 1BQIA 1ZWIC 1AIMA 1S0VA 2OT5A 5LGUA 3HR0A 3K04A 2JGDB 3FX7A 3B21A 4D8EA 4MW3A 3D6SA 1K33A 1KFXL 1OCCB 2Q7GA 1EM1A 3SJQC 2ZR3A 1DGSA 4FZ1A 4ZHQA 2NQDB 2F95B 3MHHA 5L3CA 2ADQB 3ZHSA 2WLLB 3SYQA 5CA1A 1YHQV 3H1HH 2ZXWB 2GBOA 1NBMG 1W0KG 3OM3B 4GUAA 2QR4A 2V7QG 2WWWA 3JCUZ 3RYHA 3BCCH 4X1IA 2VRZA 4IYIA 3EHBB 4FLZA 1W59A 1AU4A 5CVMA 1Z5WA 1XDCA 5H5NA 1FYJA 4P2ZA 4BIUA 4BOSA 4X64O 5L3FA 4A5UB 4X6HA 3JSLA 5KUKA 3QT4A 4IP3A 2G38A 3P30A 4JI0B 5JCOC 3I55V 3UM7A 4FM0A 3FB5C 4HWYA 2VS0A 1VF5B 5JCOA 4WFFA 2FL4A 1JJOA 1PPNA 1RPRA 2QWQB 4BQVA 1Q7YW 1NTKH 2DE0X 4AI8A 4PDLA 3U8EA 2LP7A 1KC8W 4TV8A 3K59A 1JJ2U 4XR7A 3CJHA 1JPXA 4TV9B 4P6EA 3BEHA 4BOZA 2E01A 4XUIA 1KMIZ 4MW8A 5J9PC 1H2SB 5H2FZ 1PPOA 4BW5A 1LR1A 2JQFR 4FVMA 1YI2V 2FRQA 4CDDB 1TUEB 4NKGB 4OVZB 2JS3A 3E8BA 3AK2A 1WPBA 5CA3A 5LMNB 3TXQA 4RF1A 4RF0A 3CCLV 3R66A 3B40A 3JALA 3GCBA 1U9VA 4J42A 4IYHA 3CRRA 4K8XA 2XTAA 1QVFU 1YVBA 5IYCO 1V54B 2HR3A 4GCZA 5IYDO 3RYIA 4FFKA 3RW0A 1NR1A 1D5NA 4JI8O 3S3QA 3MHHC 1CXZB 4R3DA 3ZEDA 2BDLA 1IWDA 1OJHA 4EEQA 3G67A 5LHGA 5J2UA 4BSQA 5JQGB 2NQGA 2HHHB 2HXZA 4LH7A 1U9WA 3LDDA 4LF8B 1K34A 1QLNA 2WBFX 4C7UA 3AG2B 3K0GA 3ZJZA 2OCCC 2QTOA 4X8AA 2HHHO 1NJIW 4PT5A 2ZR2A 1ME4A 3AG3C 4Q8GA 2E02A 4DK1A 5HFLA 4W4LA 5J94A 4CDCB 3SPJA 2AYNA 4W5BA 3E8GA 3BABA 3CC2V 5EYPA 3IOQA 2OP3A 5JH3A 2AUXA 1ZAUA 1NB3A 5BR8O 2BU3A 1IXBA 1M4UA 2UXBO 4FLWA 3ETGA 2IJIA 3OUFA 1NQTA 4OELA 4CZWA 4LF7B 1NU1H 3OMIB 4UCRA 4UB8Z 1HNZB 2UUBB 1CVZA 2FKXA 1I5XA 4Z1MG 2FT2A 3AG1B 1RM1B 3D3QA 2P90A 2CTPA 5B1AC 1XMQB 1R6NA 1OCOB 3CCQV 3W30A 5B1BC 2HEPA 5E1AC 5CBFA 4B3MB 2QKAA 4MI7A 4TQFA 3ABKB 1QCEA 1HNZO 4TV8B 3OMNB 1VEWA 4QNHB 5PADA 1G8MA 2CDYA 1WLEA 2V1DA 4JAVA 3F5VA 2BOBC 1OCZC 1EZJA 1HWYA 2H8PC 2ACTA 1XUQA 5A24A 3ZRWA 3ASNC 5GONA 5IT9N 1A32A 2DC9A 1SKVA 2XAFA 3T4ZA
chains in the Genus database with same CATH topology
3MJ5A 4JI8O 1HNXO 1R6TA 5EZQA 4OPAA 4AQYO 1YZBA 5E6JA 2DJVA 4XZXA 3T1HO 2JRIA 4KHPO 2UUBO 4R3DA 3PRPA 3J81N 5BXZA 4DR5O 2N74A 4JI1O 5BY1A 3PT2A 4JYAO 4LF7O 1XNQO 4RKXA 3PHUA 4BOPA 4GUAA 4GKKO 4LF6O 2UUCO 4B3SO 4JV5O 3SDLA 4DV3O 2UXDO 4DV1O 4DUZO 3PHXA 5FLXN 4DR2O 3PHWA 4BOQA 1HNWO 4DV2O 5LMNO 3MTVA 5KO3A 5A2QN 2J7QC 3O65A 5H5NA 5LL6Y 4LF5O 1FYJA 4LF4O 3OTOO 3TRKA 3C0RA 4DV0O 3J7AU 4D8BA 4BOSA 2J7QA 4JI2O 4JI3O 4X64O 1XNRO 2AGAA 4A5UB 4DR1O 1I94O 2HHHO 4DR7O 4PT5A 4IP3A 1DK1A 4DR6O 3J80N 4REZA 1J5EO 3W31A 2VQEO 3OQCA 4X65O 3BB7A 2DOSA 3MP2A 3PRMA 1R1BA 2UZJA 4DV6O 4LF9O 4IUMA 1XEQA 4K0KO 1UKFA 5BR8O 2Z84A 2F4VO 2BU3A 3JAMN 3RT3C 4DV5O 4LFCO 4DUYO 2UXBO 2Z0AA 3E9SA 1XMQO 2ZM6O 4JI0O 3IFUA 4A5UA 4JI7O 2ZKOA 4YHHO 3F5TA 4B3TO 4NXNO 4LF8O 4JI6O 4BOZA 2FKXA 1N34O 2BTWA 1D2DA 3TMPA 1IBLO 1FKAO 5LMUO 2UU9O 4OX9O 4X66O 1G1XB 1KUQA 4OW0A 5EZSA 4YY3O 1N36O 4OPHA 3ZNHA 1IBMO 4P16A 4M0WA 4JI4O 3T1YO 2HWKA 3W30A 3BY4A 3M8AA 1IBKO 4LFAO 4B3RO 4OVZB 2LW7A 1AILA 4MI7A 4OVZA 1F7YA 1HNZO 1N32O 2E5LO 1XMOO 4NXMO 4MM3B 4RF1A 4RF0A 3R66A 3RNVA 4LFBO 1PVJA 2UUAO 4GKJO 4D8IA 4X62O 4JI5O 2FE8A 3B21A 2UXCO 4RNAA 4ZTBA 1HR0O 2BTWB 4D8EA 5JZEA 2JTCA 3PSEA 1N33O 1FJGO 1DKIA 4DR3O 1X59A 4B3MO 1AB3A 4DR4O 5IT9N 4DV7O 4HXDB 1NS1A 4BOUA 2VQFO 1A32A 5IWAO 4DV4O 3BBAA 4WURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 O;  1HNX O;  1R6T A;  4OPA A;  4AQY O;  1YZB A;  2DJV A;  3T1H O;  2JRI A;  4KHP O;  2UUB O;  3J81 N;  5BXZ A;  4DR5 O;  2N74 A;  4JI1 O;  5BY1 A;  4JYA O;  4LF7 O;  1XNQ O;  4GKK O;  4LF6 O;  2UUC O;  4B3S O;  4JV5 O;  3SDL A;  4DV3 O;  2UXD O;  4DV1 O;  4DUZ O;  5FLX N;  4DR2 O;  1HNW O;  4DV2 O;  5LMN O;  5A2Q N;  3O65 A;  5H5N A;  5LL6 Y;  4LF5 O;  1FYJ A;  4LF4 O;  3OTO O;  4DV0 O;  3J7A U;  4JI2 O;  4JI3 O;  4X64 O;  1XNR O;  2AGA A;  4A5U B;  4DR1 O;  1I94 O;  2HHH O;  4DR7 O;  1DK1 A;  4DR6 O;  3J80 N;  1J5E O;  2VQE O;  4X65 O;  2DOS A;  1R1B A;  4DV6 O;  4LF9 O;  1XEQ A;  4K0K O;  5BR8 O;  2F4V O;  3JAM N;  3RT3 C;  4DV5 O;  4LFC O;  4DUY O;  2UXB O;  2Z0A A;  1XMQ O;  2ZM6 O;  4JI0 O;  4JI7 O;  2ZKO A;  4YHH O;  3F5T A;  4B3T O;  4NXN O;  4LF8 O;  4JI6 O;  2FKX A;  1N34 O;  1D2D A;  1IBL O;  1FKA O;  5LMU O;  2UU9 O;  4OX9 O;  4X66 O;  1G1X B;  1KUQ A;  4YY3 O;  1N36 O;  4OPH A;  1IBM O;  4JI4 O;  3T1Y O;  3M8A A;  1IBK O;  4LFA O;  4B3R O;  2LW7 A;  1AIL A;  1F7Y A;  1HNZ O;  1N32 O;  2E5L O;  1XMO O;  4NXM O;  3R66 A;  4LFB O;  2UUA O;  4GKJ O;  4X62 O;  4JI5 O;  2UXC O;  1HR0 O;  1N33 O;  1FJG O;  4DR3 O;  1X59 A;  4B3M O;  1AB3 A;  4DR4 O;  5IT9 N;  4DV7 O;  1NS1 A;  2VQF O;  1A32 A;  5IWA O;  4DV4 O; 
#chains in the Genus database with same CATH topology
 1V55 B;  4RUE A;  1Q8I A;  3W7W A;  3KZI Z;  5LXT A;  4DV2 B;  5K16 A;  1MZF A;  4H13 B;  1AJQ A;  4X9Q A;  3X2Q B;  4I4T A;  5BXZ A;  3EFF K;  1SQV H;  4YJ3 A;  5E79 Z;  2QSA A;  2R9N A;  2W0F C;  5B66 Z;  4J7Z A;  1PPJ H;  3ETE A;  3O9O A;  1BCC H;  4LF6 O;  1VF6 A;  3DSQ A;  1NTM H;  4PDV A;  4DUZ O;  3OF8 A;  4AIL C;  4JYB A;  1GKF A;  4DV6 B;  2A7W A;  3ERV A;  3L74 H;  1M56 C;  4JI4 B;  4UUJ C;  3ZHR A;  5IY5 B;  2LFR A;  4JI2 O;  1V55 C;  3PDF A;  4P9P A;  2IBZ H;  3P5X A;  1TA8 A;  2Q4P A;  4YYR A;  1YDX A;  3SJB C;  5CN0 A;  2JIZ G;  2YXY A;  4Q20 A;  1K97 A;  4OEM A;  5JWP A;  2B1M A;  6PAD A;  1VQM V;  5FPR A;  3W7T A;  4EB6 B;  1N8R W;  2O6X A;  3RYC B;  3JAS B;  4LF9 O;  4DV0 B;  2QGN A;  3ZHT A;  1YK8 A;  4XDJ A;  1WP8 A;  1KKD A;  2AS8 A;  1VQ6 V;  4YYW A;  5CMU A;  1OCO C;  2EIM B;  2CTW A;  4U7N A;  1THZ A;  1VQO V;  5LBQ A;  3K5O A;  3JD0 A;  4MSX A;  5CB4 A;  3CX5 F;  3H8B A;  5CBG A;  3VQX A;  2IBI A;  1NH2 B;  3E35 A;  2ZM6 B;  2CB5 A;  2UXD B;  3LXS A;  4WFB V;  1Y4M A;  2LW7 A;  5LXT B;  2NQI A;  3FYI B;  1WJZ A;  3ZHV A;  3WB0 A;  4CC6 A;  2HHN A;  1AI4 A;  1HNX B;  2ZT9 B;  2MW2 B;  3IC9 A;  5LMU B;  3ZRV A;  1S5L Z;  1VQ8 V;  4EB6 A;  1KU9 A;  4JI1 B;  3OR6 C;  3T1C A;  5DM6 V;  1YTF D;  2PNS A;  4DV7 O;  4DV4 O;  1VP7 A;  1EWM A;  4J41 A;  3MJ5 A;  1HNX O;  3NHE A;  2AW9 A;  2BE3 A;  4AQY O;  1YF2 A;  3ABL C;  2Y48 A;  3LDE A;  1TUB B;  4PEL A;  3ABK C;  2YIA A;  4LR3 A;  1Q82 W;  1I5Y A;  4UXN A;  4DXW A;  1M90 W;  2P4V A;  2Y4T A;  3MD0 A;  5BY1 A;  3PT2 A;  3BY6 A;  4JYC A;  1Q6I A;  5KHG A;  2DJF B;  2G6D A;  4QRG A;  1U97 A;  4GKK O;  2QWP B;  5K1P A;  1AP6 A;  3AG1 C;  4LNU A;  5FLX N;  1RM1 C;  3PHW A;  1GO3 F;  3UT5 A;  4YV8 A;  2Q68 A;  2BDZ A;  2HH5 A;  2BTO A;  2V4D A;  3OTO O;  1KFU L;  3N2K A;  1U5I A;  4CBC A;  1ZTE A;  4CH5 A;  4ICG A;  3BPM A;  5JA7 A;  1NZ6 A;  2DC8 A;  1EN5 A;  1VIB A;  2DYR C;  1SF9 A;  1SQP H;  1PCI A;  5EGW A;  4X65 O;  5KA5 A;  4YXW G;  5LGN A;  1WPX A;  5GTI Z;  4G2K A;  2OIE A;  3KKU A;  1PAD A;  4G27 B;  4TUY B;  4BW9 A;  1YJN V;  1BGY H;  4KL1 A;  1K7D A;  3IC7 A;  4CS4 A;  2L35 A;  1Y74 B;  4BS6 A;  4LFA B;  2ZCE A;  4X65 B;  3SYA A;  4DK0 A;  2UUC B;  1AYW A;  2IU0 A;  2XU5 A;  4BR6 A;  2PI5 A;  1D2D A;  2DCA A;  2R72 A;  5L3E A;  4DMX A;  2QWR B;  3A0R A;  1ZX3 A;  2GTA A;  5D5P A;  4JYY A;  4LFA O;  1BGO A;  3HWN A;  1CTE A;  3BWK A;  4LC1 A;  3O0U A;  4FIP C;  1VSN A;  3TK1 A;  4JZ2 A;  1PVJ A;  2W0X A;  1RP3 B;  3TNX A;  4PA6 A;  4MTX A;  3CS5 A;  3WU2 Z;  1HR0 O;  1I94 B;  5JZE A;  1US6 A;  2FO5 A;  3OGC C;  1JFF B;  3BAA A;  1KHP A;  2P5O A;  4DYL A;  3WG7 C;  1AI5 A;  5H9C A;  5J2T A;  3AG2 C;  4FJC C;  5FNV A;  2ZIM A;  3RVV A;  3N27 A;  1KD1 W;  2PI4 A;  4YYU A;  1LNQ A;  1PNM A;  3K79 A;  1F4M A;  4AHC A;  1XKG A;  3PHU A;  1OCZ B;  4J7J A;  5KHI A;  4DV3 O;  3F5W C;  5EC2 C;  3M99 B;  4DV1 O;  2JK5 C;  1E79 G;  4QJF B;  3QSD A;  1PXV A;  5LMN O;  3VOU A;  1QLE B;  3HKB B;  2GV9 A;  2JDI G;  1FXK C;  1N36 B;  3HPL C;  3H89 A;  4NTX A;  1IBM B;  5ITZ B;  3D8C A;  5ITZ A;  1MEM A;  3J7A U;  1TVK B;  2J7Q A;  2ARY A;  2C0Y A;  1Y6X A;  1CQD A;  4DV1 B;  3MHS C;  1WP7 A;  5BMV A;  4I0X A;  5KLV H;  3MP2 A;  1NTZ H;  2CH7 A;  1B6Q A;  3L70 H;  1JMK C;  1HDJ A;  2PAD A;  3I3T A;  3JAK A;  2YEV A;  4O2B A;  2KQX A;  5LHI A;  2Z0A A;  3N2K B;  1GH6 A;  5CBH A;  1M1K W;  5KMG B;  1GM9 A;  4X1Y A;  2ITC C;  2E74 B;  1OCC C;  4J9Z B;  5B3S B;  5F2V O;  4JI6 O;  4B08 A;  1QBZ A;  2YUA A;  2Q7H A;  4NYK A;  3A2F A;  4GZR B;  5CB4 B;  3P5W A;  2UUA B;  1PL0 A;  4PD4 F;  1KUQ A;  1AI6 A;  2CAZ C;  4RAI A;  3CRQ A;  4YY3 O;  5GON B;  5A9G A;  2L6L A;  3JD2 A;  4ZUX U;  2Q6A A;  2WLJ A;  1BP4 A;  3CBJ A;  2GSM B;  2JEU A;  4DR3 B;  2B1I A;  2YI9 A;  3TXS A;  2Q8V A;  3QO5 A;  2X6B A;  5GW7 A;  3G6B A;  2IJH A;  3W7U A;  4N79 A;  2UUA O;  1XHZ A;  5LOV A;  4D8I A;  3L73 H;  2HLD G;  1S4V A;  3FD9 A;  2Q5Z A;  2FE8 A;  2XU3 A;  2PUS A;  4XDK A;  2KB1 A;  2LQT A;  2EIM C;  4DR3 O;  1MZE A;  3K9A A;  2DYR B;  3ZN0 A;  2XAH A;  2YEV B;  3M99 A;  4I05 A;  3H1J H;  3K03 A;  4ZKI A;  4J9Y B;  5EZY B;  5EZQ A;  4MSW C;  2DJV A;  2F23 A;  2JRI A;  2UUB O;  4DV5 B;  2OUL A;  2CTQ A;  4LF4 B;  4O2A A;  4O4H B;  1H8H G;  1YTF B;  4NVP A;  3LSS A;  4B3T B;  1M6D A;  1KXR A;  1PPD A;  4I07 A;  3ZUA A;  5B5E Z;  3K24 A;  1R73 A;  3WB2 A;  3DXR A;  4D6T H;  4RO2 A;  4LF4 O;  3OR7 C;  3DGE A;  1P7G A;  2PYJ A;  2PRE A;  2ZE6 A;  3U10 A;  2QWO B;  4K7C A;  3ABT A;  3USV A;  2RJZ A;  2EIN C;  2EIL B;  2BCC H;  4B3S B;  4PDR A;  1L1F A;  1SZX A;  4R50 A;  2VQE O;  4U3F H;  1Y67 A;  2KKW A;  3JAR A;  3K0D A;  3H8C A;  1GN3 A;  4I50 B;  3F75 A;  1GK9 A;  3CP1 A;  3KG2 A;  2X7R B;  2F4V O;  4F6R B;  2ATK C;  2PTM A;  4YVA A;  1Q5O A;  2R9I A;  2AZ2 A;  3E9S A;  4X6J A;  1XMQ O;  1F51 A;  4N4Z A;  3ZS8 C;  4KLB A;  4UV8 A;  4ZOL A;  4PA4 A;  2EJ7 A;  1UFI A;  4H44 B;  5B1A B;  1QR9 A;  1PM9 A;  3IMA A;  1VQ4 V;  2YIB D;  1AYU A;  1XL4 A;  3DTU B;  1GLO A;  1SNK A;  4U3J A;  3RVX A;  2FYU H;  5JVD A;  4JI4 O;  1EN6 A;  3M8A A;  4HZ3 A;  3HKB A;  3C9E A;  4J11 A;  4X88 A;  4B3R O;  2PF4 E;  4X20 B;  3RGB A;  3N3G A;  1QHT A;  4QGP A;  4R7C A;  1N0J A;  3B09 A;  2PGG A;  2VWK A;  3K57 A;  5KUM A;  1MDW A;  2QKS A;  4YYV A;  4DR7 B;  4GX0 A;  2R6N A;  4F6E A;  3PSE A;  1DKI A;  3SYC A;  1CPJ A;  3H9V A;  5JH7 A;  4DR4 O;  3OEE G;  1NS1 A;  1GMG A;  3OAA G;  1YJW V;  4BOU A;  1N32 B;  1FFT B;  1N4C A;  1WAZ A;  4Q6G A;  1H2L A;  2OIG A;  1VF7 A;  2FTD A;  4K8Z A;  3KX1 A;  4NXN B;  2IH1 C;  2F66 C;  4O4I B;  3I56 V;  2KG7 B;  2GHY A;  5IJ0 B;  1MOF A;  4JI2 B;  4JYA O;  4DR4 B;  2GUZ B;  5CA0 B;  4PA3 A;  3E8H A;  3OW2 U;  1JQP A;  1B3Q A;  2PBH A;  4L87 A;  2UXD O;  3E22 A;  3JD4 A;  1NVP D;  1N0N A;  3BCN A;  4Z2W A;  1S76 D;  2E5L B;  1NH2 D;  2YJ9 A;  2DW4 A;  1SA0 A;  3IJ4 A;  4DV0 O;  2QWN B;  4FLU A;  3CCS V;  2NNU A;  1AYV A;  3SPH A;  2YXH A;  1COW G;  1QNM A;  3B8M A;  3JD3 A;  4P6G A;  2G7Y A;  4GT1 A;  4DR6 O;  3HKD A;  2JS5 A;  4Z1V A;  2OTL V;  4REZ A;  1FH0 A;  3NR7 A;  2XOK G;  2A0L A;  4DV7 B;  1FXV A;  1K92 A;  2DOS A;  3CME V;  3HKE A;  3SJC C;  5IJ9 B;  2YDE A;  3DF0 A;  1Q3E A;  3QJ3 A;  3OEH G;  4HNA A;  1DF4 A;  3JAM N;  2AVW A;  4X20 A;  3APQ A;  4FK5 C;  4FLX A;  4DUY O;  2IU3 A;  1YIT V;  2P6J A;  1XIL A;  2ZM6 O;  4JI7 O;  1K73 W;  3CCU V;  1AU3 A;  5GTH Z;  1HUC B;  1EZV H;  3TCU A;  2BTW A;  1ZLZ A;  5EBM C;  5LMU O;  4OX9 O;  2ZNI A;  1AP5 A;  3OTO B;  2OCC B;  3VQV A;  4FLV A;  1F2B A;  4JV5 B;  3PJS K;  3ABM B;  1J95 A;  3FKS G;  1VQN V;  4OVZ A;  1Q6H A;  2K1E A;  3BA9 A;  1M9N A;  5FNV B;  2KG7 A;  4LFB O;  4X62 O;  4TQD A;  1YJ9 V;  1OV9 A;  2Q73 A;  3ZMZ A;  3GVM A;  1ENV A;  2P7U A;  4PI3 A;  3U11 A;  1IVS A;  4QH6 A;  2A79 B;  3E22 B;  4HXD B;  2LFS A;  4GKK B;  1AR5 A;  9PAP A;  1Q43 A;  5LHH A;  3T1H O;  2Y0P A;  4KHP O;  1FXK B;  2F7D A;  4BPV A;  3OT7 A;  2WLI B;  2ZD9 A;  2N74 A;  1IUR A;  1YVW A;  4NB5 A;  3UKM A;  5JQG A;  2O57 A;  1Y76 B;  2W6I G;  3L72 H;  1AI7 A;  1S77 D;  1GN6 A;  2P67 A;  3ZRW B;  4DR2 O;  3ZIA G;  3O1G A;  2Q67 A;  3T1H B;  4KHP B;  4WFH A;  4RQF A;  4HNA B;  3O65 A;  5IYZ A;  3CRC A;  3OVZ A;  4WFE A;  5CA1 B;  1XNR O;  2MK3 A;  2P22 C;  2AGA A;  1I94 O;  1GCB A;  2JJ2 G;  4I4T B;  1XHX A;  2BTQ B;  1BHA A;  4QE9 A;  4IGG A;  3OQC A;  1SET A;  3KCY A;  4PI0 A;  3G80 A;  2ILM A;  1IX9 A;  1R1B A;  2UZJ A;  2WA4 A;  1M57 C;  3RYI B;  2UU9 B;  3ZRS A;  1MAB G;  2F43 G;  1ITO A;  1URF A;  2H3O A;  4WFG A;  3P5U A;  2W6J G;  2RNB A;  1P49 A;  3OMA B;  3BVO A;  1LUV A;  4A5U A;  1IBK B;  4I7Z B;  4TOI A;  1SS3 A;  4DV3 B;  2QKC A;  1GRJ A;  2UU9 O;  3MOR A;  1W0J G;  1N36 O;  1HR0 B;  3ZNH A;  1IBM O;  4I5S A;  1PPP A;  2NLJ C;  5JVD B;  4QBB A;  2YI8 A;  5L3D A;  3AK3 A;  4GYC B;  2QJ1 A;  4MVU A;  1IBK O;  1F7Y A;  1D5A A;  3CRM A;  2B5U A;  5LP6 B;  2NQA A;  3AI8 A;  1FXK A;  3BA8 A;  4QE7 A;  4FK5 A;  3G4S V;  5IYB O;  2ZNJ A;  4FZ0 A;  2X0L A;  1W2B U;  4YIP A;  1SRY A;  2YJC A;  4GLX A;  1S3J A;  2AHZ A;  1YK7 A;  1YXB A;  2P06 A;  2K9P A;  2YIB A;  4J7K A;  4DMY A;  4B7K A;  2R9O A;  1R6T A;  3JD1 A;  2IJJ A;  2QA4 V;  4XZX A;  5KX5 B;  2ZQM A;  3STZ C;  3ABU A;  3LDC A;  1O0E A;  1K4C C;  4G28 B;  5FL7 G;  2H7J A;  4X1K A;  4N21 A;  3ICX A;  3CEI A;  2Q7E A;  4KXR A;  1FAF A;  3CCR V;  4PJ0 Z;  4DRX A;  4JPR A;  4WBN A;  4IT5 A;  4BOP A;  2ITD C;  2GFO A;  3RBZ A;  5IY5 C;  3CHX A;  5D5Q A;  4P9O A;  3F7Y C;  1BQZ A;  4MT8 A;  4O4L A;  2ZDI C;  1BL8 A;  3UQ8 A;  1K8A W;  5C8Y A;  1L0L H;  3ABL B;  5LL6 Y;  1K5S A;  3CPW U;  4LF5 O;  1GMY A;  3JSN A;  3TRK A;  1OZ0 A;  2RMK B;  3ABM C;  1QVG U;  1CEZ A;  1Q6U A;  3RYF A;  2YJ8 A;  3JAL B;  3WXF A;  1PV0 A;  1E1R G;  4GX1 A;  2NR5 A;  4UCS A;  1UJW B;  3UO2 A;  4JI6 B;  3HD3 A;  1U96 A;  2FML A;  5IJ9 A;  3H01 A;  2CIO A;  4LF5 B;  2E03 A;  1PBH A;  2D2C B;  4KP4 A;  1XQ8 A;  4UCV A;  1UKF A;  2AUZ A;  1PD3 A;  1SQF A;  4DV5 O;  1JQ0 A;  3BOW A;  1Y66 A;  4PV1 B;  2XU4 A;  3CH3 X;  2RQ6 A;  2WLK A;  4TSF G;  4PHZ A;  2WLM A;  3AG7 A;  3ETD A;  4ABM A;  3K06 A;  5FPW A;  2QEX V;  1TLO A;  3CWB H;  1STF E;  4B3T O;  3OUS A;  4FLY A;  4LF8 O;  5J2U B;  4YJ3 B;  4K3A A;  1CP9 A;  3BC3 A;  3ML0 A;  3CC7 V;  4FFB A;  3H7D A;  1P84 F;  1X4T A;  3GWO A;  3BPF A;  3Q4H A;  3T1Y O;  1RFY A;  4FJC A;  1FS0 G;  3Q4H B;  2LJ2 A;  3N4C A;  1AIL A;  5BZB A;  3L75 H;  1U9X A;  2Y6E A;  4CDE B;  2OTJ V;  3RVZ A;  3S3X A;  2VQE B;  1ME3 A;  3RNV A;  2EJR A;  4MS2 A;  2UXC O;  4UV9 A;  1NLJ A;  2QM7 A;  1YAL A;  2UXB B;  3SPG A;  3W7S A;  2A9H A;  3BBA A;  4MZO A;  3ZCC A;  3FFQ A;  4UB6 Z;  1AEC A;  3TJT A;  2EZO A;  2HKO A;  4PDM A;  4IIJ A;  5E6J A;  3L71 H;  3S3W A;  4JI5 B;  1JOY A;  5LYJ A;  4X89 A;  1WB8 A;  4JGS A;  1MG1 A;  3FYE B;  3KWB X;  3A0B Z;  1I7F A;  3K9S A;  2EIL C;  2EIN B;  4DR1 B;  2Z3Y A;  4FFB B;  1JR9 A;  2EZP A;  4LP8 A;  1WA8 B;  4B3S O;  3IGA C;  1G6U A;  1JVM A;  4RY2 A;  4DO2 A;  2GHU A;  1QU7 A;  3UT5 B;  3D3I A;  3MTV A;  2R9R B;  4LCU C;  2J7Q C;  2EIJ B;  5TIS Z;  2CGN A;  2EIK B;  3APO A;  2F4V B;  1ZCM A;  4DR1 O;  3B77 A;  1GM8 A;  1KB9 F;  4X1K B;  3ASN B;  3B79 A;  4NTW A;  2PY5 A;  3W31 A;  2AIM A;  4O4J B;  3E1Z B;  2X6A A;  2IH3 C;  2IM9 A;  3LSU A;  1NQC A;  4WCE V;  5FPO A;  3E83 A;  5CVO B;  3CCM V;  1DTO A;  2DQ0 A;  2YSU B;  3QO8 A;  3OGI B;  3SPI A;  3PBH A;  1KEC A;  4WA6 A;  4AXL A;  3LUT B;  2UXX A;  4B3R B;  3I06 A;  1NPZ A;  1V54 C;  4I04 A;  2Y4U A;  3WXG A;  1FD9 A;  1OCR B;  1YEW A;  3ZHQ A;  1BQ0 A;  3F7V C;  4DUZ B;  1GTO A;  1CJL A;  4DRX B;  4I0X B;  1YCI A;  1G1X B;  1ZL8 A;  4BAY A;  3SYP A;  4YIO A;  3CC4 V;  3I5D A;  4HAM A;  1M56 B;  2PZS A;  4FM2 A;  3QO7 A;  1AU2 A;  4BS5 A;  1N32 O;  1R3J C;  1H8E G;  3M7M X;  1S72 V;  4GKJ O;  2WPD G;  4X66 B;  2XND G;  2F93 B;  3GB7 C;  1FPO A;  1VQP V;  4MTO A;  1WA8 A;  1R3I C;  1FJG O;  4CH3 A;  1PNL A;  3AK1 A;  4JYA B;  1VQK V;  4I55 B;  3KCX A;  1JX9 A;  3C3S A;  4DUY B;  3SYO A;  1BS3 A;  3HKC A;  2YXL A;  5IWA O;  1H2G A;  2WLH A;  1ZUQ A;  4JI7 B;  2JVD A;  4GKJ B;  4UFZ A;  1YZB A;  5CVN B;  3CBK A;  4NR1 A;  1N33 B;  1FJG B;  2OZ2 A;  1Z5V A;  4FM1 A;  4LF7 O;  4RKX A;  2Q0A A;  2QDO A;  3OTF A;  4X1I B;  3RYH B;  4PA9 A;  1AVM A;  1TAE A;  4TUY A;  3LSQ A;  3SPC A;  3CD6 V;  2B1N A;  3K08 A;  1SC5 B;  1QQC A;  3MTN A;  1GAX A;  2LGQ A;  1TL9 A;  1CB5 A;  4HBN A;  4ZIB A;  1XMO B;  3ZHU A;  3IV2 A;  1I08 A;  3VBB A;  3JAS A;  4UCU A;  1SQB H;  1K3B B;  4IUM A;  3WG7 B;  4OX9 B;  1QOL A;  1NL6 A;  2XAG A;  4J10 A;  3ZN1 A;  2OCH A;  4XDL A;  3PNR A;  3ZMS A;  3G71 V;  4CC5 A;  4RWU A;  2JGD A;  1EWO A;  3JAW B;  2LGW A;  4JZG A;  5EBL C;  4NXM B;  3V6E A;  4IHJ A;  3JCZ A;  1ARO P;  4DR2 B;  3MDS A;  1MA1 A;  3AEI A;  1OCR C;  2E3C A;  2DCD A;  4F4L A;  4LFC B;  4I50 A;  4JTA B;  4JF3 A;  4OXS A;  3BY4 A;  2CTR A;  1ROP A;  3K3W A;  5KHH A;  1OHH G;  2XU1 A;  3UCS C;  4JTC B;  4NXM O;  2BSK A;  4WF9 V;  3P5V A;  2HVJ C;  2HG5 C;  1DF5 A;  3K5L A;  5EIB D;  8PCH A;  3K58 A;  3DC6 A;  2CH7 B;  1YT7 A;  1MS6 A;  1K3E A;  4R6Z A;  1X59 A;  3RVW A;  3L9D A;  4LWS B;  3BFR A;  3BPZ A;  2Y5B A;  4OGQ B;  4LF9 B;  2DJG B;  3C3T A;  4PAD A;  1POP A;  5IE9 A;  1Y74 A;  1E1Q G;  1T5E A;  2X6C A;  1XNR B;  5LA6 A;  5LA6 B;  2DWE C;  5JJJ B;  1RSO B;  2VQF B;  2E75 B;  2A3Q A;  3N3K A;  2ZXW C;  5KA6 A;  3PHX A;  5CHT A;  3KW9 A;  1NT2 B;  3CXC U;  1K4D C;  4JAA A;  4FMT A;  3DXR B;  3OVX A;  4QRV A;  2GDS A;  4JI3 O;  2G8E A;  4IL6 Z;  1ATK A;  5KHK A;  3CJH B;  4TV9 A;  1ICF A;  4W4K A;  4X1Y B;  2E76 B;  3V6C A;  5IJ0 A;  1XL6 A;  3K9M A;  3PW3 A;  5EYP B;  3WFV A;  1NR7 A;  4XBF A;  4Q8H A;  3IAY A;  3CXH F;  4N8W A;  1N34 B;  4YJ2 B;  5EF4 A;  3HKC B;  4JI3 B;  1BSM A;  5B1N A;  1SA0 B;  4GX5 A;  2AXT Z;  3FAV B;  3SGI A;  2FRA A;  2BSK B;  2ODM A;  3FAV A;  4QIW F;  1VQ5 V;  2KSD A;  2Y69 B;  3JYC A;  3GWK C;  1VJV A;  1N34 O;  1IBL O;  3ZRX A;  4YYQ A;  2RN9 A;  3H1K H;  1KKC A;  3K5M A;  4LNU B;  2NN4 A;  1Q81 W;  3ZMT A;  1VQ7 V;  5K1X A;  1YIJ V;  1CSB B;  4IIJ B;  2EBO A;  2CUG A;  3AG4 C;  2EUL A;  2XAS A;  3PN1 A;  1HNW B;  3H1I H;  4MM3 B;  2M6Y A;  1Q86 W;  2ZDI A;  5LYJ B;  4JTD B;  2YC0 A;  1IBL B;  4TT3 G;  1JA8 A;  2DYS B;  4H37 A;  4ZTB A;  3QTC A;  2ADP A;  3ZX6 A;  1VQL V;  4DR5 B;  1KQS U;  1RSO A;  2P7T C;  1GN2 A;  1ZIV A;  1DLB A;  1H2K A;  5H6Q A;  4CZZ A;  4R8C A;  1HNW O;  3EXA A;  2M7W A;  2RCV A;  4OPA A;  2LO1 A;  2AHY A;  1Q6K A;  2QTS A;  3J81 N;  1PIP A;  2WSS G;  1S5H C;  5LOV B;  2DMX A;  4DR5 O;  2IPP B;  1R6K A;  4W5C A;  3JAW A;  1XNQ O;  4O4J A;  1KBH A;  3SR2 C;  2DYS C;  1IZ3 A;  2Z5U A;  2UUC O;  4BIO A;  4J80 A;  3N2G B;  2YID A;  3CCV V;  3CCJ V;  5KO3 A;  1MHW A;  5A2Q N;  4F6R A;  3P3P A;  1DEU A;  2HD5 A;  2WLN A;  2HFE C;  3ZMU A;  3ASO C;  1LUW A;  2JEX A;  4PP2 E;  4D8B A;  1TUB A;  2UXC B;  1GN4 A;  1XNQ B;  3W7X A;  3KKY A;  4O4H A;  3K8U A;  1MMM A;  2CGO A;  3CRA A;  2ZIN A;  2G8J A;  1ZL8 B;  5BMV B;  3X2Q C;  2B9Z A;  3MAQ A;  2QM4 A;  2Q0O C;  1P7B A;  1XEQ A;  4K0K O;  1EWL A;  3RT3 C;  1NVP B;  3EVK A;  3CMA V;  1U9Q X;  5B1O A;  3UO3 A;  4D7S A;  3OFN G;  3T1Y B;  5B1B B;  4O4I A;  4MTG A;  4JI0 O;  1EBO A;  3IFU A;  1S5J A;  2ZE8 A;  3ASO B;  2EIK C;  3FB7 C;  3D36 C;  3P3N A;  3E86 A;  2YJ2 A;  3LFY A;  2Y0I A;  3JAR B;  4QRX A;  4K0K B;  1X9Y A;  1Q90 D;  1GM7 A;  1SZT A;  4OW0 A;  4OPH A;  3IFX A;  4K35 A;  4RUF A;  2AYO A;  4E4E A;  4ASU G;  1TVK A;  4JAU A;  2QE7 G;  1K9M W;  2P0R A;  1H38 A;  3VQW A;  2VWJ A;  3TGU H;  3HHI A;  1Y08 A;  1FFX B;  1EFR G;  4JI5 O;  1F4N A;  5EK0 A;  4X64 B;  3HHA A;  3IEJ A;  4I9W A;  4CH6 A;  1TU6 A;  5B3S C;  1UPG A;  1R3K C;  3HKE B;  2Y69 C;  1VAR A;  4U3J B;  2F1G A;  2R9F A;  3N2G A;  2D3O W;  1Z2G A;  4H0L B;  4O2B B;  5LGT A;  4YJ2 A;  2DC7 A;  2ZIO A;  4LWS A;  1MSD A;  1QXP A;  1MNG A;  4HYO A;  1H2M A;  5L3B A;  1PL4 A;  2DWD C;  2XHB A;  2A06 H;  1R3L C;  3CCE V;  3CH2 X;  4PI2 A;  4E2L A;  1FXH A;  3QG5 A;  3CB2 A;  2IJK A;  5DEC A;  5H6R A;  5KAF Z;  2R70 A;  4U7O A;  3RYC A;  4B7E A;  4BOQ A;  4CS3 A;  2PYL A;  3R65 A;  4YY3 B;  2YS8 A;  1F29 A;  5IYZ B;  2JGU A;  3QVN A;  1YSC A;  3H1L H;  4LBE C;  3CYO A;  4DR7 O;  1BT8 A;  1DK1 A;  3P32 A;  1CPY A;  4QPJ A;  3TET A;  4H33 A;  4IHJ B;  4KFM A;  1BZK A;  3FB6 C;  4EFB A;  1M57 B;  4CS2 A;  4FLT A;  3QNE A;  3FB8 C;  1L0N H;  3SJA C;  5IDJ A;  3ETQ A;  5LP6 C;  4L8J A;  4MVM A;  2ATO A;  3HB3 B;  4JI8 B;  2P86 A;  3F5T A;  1FFX A;  4FPP A;  4GUN A;  3OIS A;  5JJN B;  3D36 A;  1FKA O;  2ARH A;  2DC6 A;  5BR8 B;  4X66 O;  1SER A;  3E2E A;  1AR1 B;  2JJ1 G;  3G6E V;  4M0W A;  3LNN A;  2B1G A;  2HWK A;  1P4R A;  5L3G A;  3QF7 A;  1V9P A;  3JAT A;  4UVB A;  4BIZ A;  5IWA B;  1SQX H;  1XMO O;  4X6I A;  2BOC C;  2XAJ A;  4O2A B;  4RQE A;  4FIP A;  4UVA A;  7PCK A;  3LNM B;  4PA7 A;  4RNA A;  2BTW B;  4CDF B;  5C93 A;  1CV8 A;  1IXM A;  2JTC A;  1N33 O;  4MTF A;  2YIC A;  4B3M O;  1AB3 A;  1BE3 H;  4WUR A;  4MVZ A;  1SES A;  1NKD A;  1XBL A;  2P4K A;  3RWR D;  3A0H Z;  5DN6 G;  5J2T B;  1L8D A;  2FQ9 A;  2DCC A;  2FB5 A;  4UCO A;  1QLE C;  4ZOL B;  3PRP A;  4MVO A;  5KMG A;  3B2E E;  2RDC A;  1SP4 B;  3OD4 A;  1KYO F;  1F2C A;  5KAI Z;  1QR8 A;  2DQ3 A;  2R9A A;  4AXM A;  4JV5 O;  1BY8 A;  5F02 A;  2VHS A;  1AR4 A;  2GTS A;  2EIJ C;  5EBW C;  4DV2 O;  5EZY A;  4JAS A;  1TGO A;  2YJB A;  3IHP A;  3T4D A;  1WNS A;  4CH4 A;  2WLI A;  1XRE A;  3J80 N;  4MVR A;  1Y76 A;  3BB7 A;  5AG2 A;  1VQ9 V;  2JQG R;  3A8T A;  3KSE A;  2CE4 A;  3MHS A;  4DV6 O;  1ZSP A;  1HW7 A;  4G54 A;  3E89 A;  3RFR A;  1SQQ H;  2FTK A;  3JAT B;  4LFC O;  4I9Q A;  2OWO A;  2Q9L A;  3AG3 B;  3BRC A;  1HP8 A;  1GEC E;  5LP6 A;  1H2N A;  1MIR A;  2ZKO A;  4YHH O;  5DED A;  1BHB A;  4UCT A;  4NXN O;  1VF6 C;  2ZE7 A;  2AU1 A;  2EX3 A;  3S3R A;  4LH6 A;  2HVK C;  3TMP A;  1SQG A;  4MVQ A;  5KHJ A;  1F2A A;  4MZS A;  2OYQ A;  3OE7 G;  5CHV A;  2XAQ A;  1JFF A;  2CK3 G;  3DC5 A;  1ORQ C;  3K5N A;  4P30 A;  4O4L B;  4LF6 B;  1JCH A;  5C8Y B;  4ZHQ B;  1QDQ A;  1PE6 A;  4YHH B;  1F23 A;  1AU0 A;  2DN9 A;  1O9H A;  4KUM A;  4WFA V;  2E5L O;  1PNK A;  2F1M A;  4QPK A;  4ZI7 B;  2N04 A;  1MEG A;  1B06 A;  3C90 A;  1B04 A;  4DR6 B;  1DF0 A;  5CA0 A;  2DZY A;  3BHP A;  1Y4H A;  3VQY A;  2VHF A;  2Q69 A;  2IW5 A;  1A6R A;  3ZMV A;  2N05 A;  2ZE5 A;  2VQF O;  1RPO A;  1O9G A;  4DW1 A;  1EWP A;  1EF7 A;  4MVS A;  2XUM A;  3E8F A;  5EIB C;  2DCB A;  2C2A A;  3ZBH A;  4TWK A;  2WA3 A;  3HKD B;  4JI1 O;  4EFE A;  1WN7 A;  3IUT A;  4YYS A;  4DV4 B;  3B8N A;  1KP3 A;  2HJF C;  3JAK B;  3SDL A;  3WXE A;  1G4Y B;  4DW0 A;  1QMY A;  4I55 A;  4AQY B;  4NTY A;  1M5I A;  3KFQ A;  2HJD A;  1BMF G;  3C0R A;  1M93 A;  5EC1 C;  2LW1 A;  2WLL A;  3THO A;  2H94 A;  2WAM A;  3OF9 A;  5KX5 A;  2HP8 A;  3WB1 A;  2FYE A;  2R9M A;  4EKW A;  2UXN A;  2BTQ A;  1VMG A;  1I0H A;  1J5E O;  4LFB B;  2GUZ A;  4WBN B;  4PP1 A;  1PKX A;  3T2M A;  4X62 B;  1THE A;  1NB5 A;  1WB7 A;  3PRM A;  2R9C A;  2ETN A;  1NI8 A;  3B4S A;  5JH7 B;  2Z84 A;  4N23 A;  4BWA A;  1K5Q A;  4UVC A;  3RVY A;  3STL C;  1XI1 A;  2DZZ A;  1KHQ A;  1KP2 A;  5HFM A;  1IDS A;  5JJE B;  1J5E B;  3RYF B;  2E00 A;  3U0Z A;  3RN4 A;  3NXS A;  1CS8 A;  4ZI7 A;  2FUD A;  3CSX A;  1XOU A;  2XT9 A;  4ZBM A;  4W4U A;  1AJN A;  3KWZ A;  4D7T A;  1AJP A;  5EZS A;  1PP9 H;  4P16 A;  3AG4 B;  3CE2 A;  2QM8 A;  1EN4 A;  1MSW D;  4GX2 A;  3H6S A;  2AZ0 A;  1BQI A;  1ZWI C;  1AIM A;  1S0V A;  2OT5 A;  5LGU A;  3HR0 A;  3K04 A;  2JGD B;  3FX7 A;  3B21 A;  4D8E A;  4MW3 A;  3D6S A;  1K33 A;  1KFX L;  1OCC B;  2Q7G A;  1EM1 A;  3SJQ C;  2ZR3 A;  1DGS A;  4FZ1 A;  4ZHQ A;  2NQD B;  2F95 B;  3MHH A;  5L3C A;  2ADQ B;  3ZHS A;  2WLL B;  3SYQ A;  5CA1 A;  1YHQ V;  3H1H H;  2ZXW B;  2GBO A;  1NBM G;  1W0K G;  3OM3 B;  4GUA A;  2QR4 A;  2V7Q G;  2WWW A;  3JCU Z;  3RYH A;  3BCC H;  4X1I A;  2VRZ A;  4IYI A;  3EHB B;  4FLZ A;  1W59 A;  1AU4 A;  5CVM A;  1Z5W A;  1XDC A;  5H5N A;  1FYJ A;  4P2Z A;  4BIU A;  4BOS A;  4X64 O;  5L3F A;  4A5U B;  4X6H A;  3JSL A;  5KUK A;  3QT4 A;  4IP3 A;  2G38 A;  3P30 A;  4JI0 B;  5JCO C;  3I55 V;  3UM7 A;  4FM0 A;  3FB5 C;  4HWY A;  2VS0 A;  1VF5 B;  5JCO A;  4WFF A;  2FL4 A;  1JJO A;  1PPN A;  1RPR A;  2QWQ B;  4BQV A;  1Q7Y W;  1NTK H;  2DE0 X;  4AI8 A;  4PDL A;  3U8E A;  2LP7 A;  1KC8 W;  4TV8 A;  3K59 A;  1JJ2 U;  4XR7 A;  3CJH A;  1JPX A;  4TV9 B;  4P6E A;  3BEH A;  4BOZ A;  2E01 A;  4XUI A;  1KMI Z;  4MW8 A;  5J9P C;  1H2S B;  5H2F Z;  1PPO A;  4BW5 A;  1LR1 A;  2JQF R;  4FVM A;  1YI2 V;  2FRQ A;  4CDD B;  1TUE B;  4NKG B;  4OVZ B;  2JS3 A;  3E8B A;  3AK2 A;  1WPB A;  5CA3 A;  5LMN B;  3TXQ A;  4RF1 A;  4RF0 A;  3CCL V;  3R66 A;  3B40 A;  3JAL A;  3GCB A;  1U9V A;  4J42 A;  4IYH A;  3CRR A;  4K8X A;  2XTA A;  1QVF U;  1YVB A;  5IYC O;  1V54 B;  2HR3 A;  4GCZ A;  5IYD O;  3RYI A;  4FFK A;  3RW0 A;  1NR1 A;  1D5N A;  4JI8 O;  3S3Q A;  3MHH C;  1CXZ B;  4R3D A;  3ZED A;  2BDL A;  1IWD A;  1OJH A;  4EEQ A;  3G67 A;  5LHG A;  5J2U A;  4BSQ A;  5JQG B;  2NQG A;  2HHH B;  2HXZ A;  4LH7 A;  1U9W A;  3LDD A;  4LF8 B;  1K34 A;  1QLN A;  2WBF X;  4C7U A;  3AG2 B;  3K0G A;  3ZJZ A;  2OCC C;  2QTO A;  4X8A A;  2HHH O;  1NJI W;  4PT5 A;  2ZR2 A;  1ME4 A;  3AG3 C;  4Q8G A;  2E02 A;  4DK1 A;  5HFL A;  4W4L A;  5J94 A;  4CDC B;  3SPJ A;  2AYN A;  4W5B A;  3E8G A;  3BAB A;  3CC2 V;  5EYP A;  3IOQ A;  2OP3 A;  5JH3 A;  2AUX A;  1ZAU A;  1NB3 A;  5BR8 O;  2BU3 A;  1IXB A;  1M4U A;  2UXB O;  4FLW A;  3ETG A;  2IJI A;  3OUF A;  1NQT A;  4OEL A;  4CZW A;  4LF7 B;  1NU1 H;  3OMI B;  4UCR A;  4UB8 Z;  1HNZ B;  2UUB B;  1CVZ A;  2FKX A;  1I5X A;  4Z1M G;  2FT2 A;  3AG1 B;  1RM1 B;  3D3Q A;  2P90 A;  2CTP A;  5B1A C;  1XMQ B;  1R6N A;  1OCO B;  3CCQ V;  3W30 A;  5B1B C;  2HEP A;  5E1A C;  5CBF A;  4B3M B;  2QKA A;  4MI7 A;  4TQF A;  3ABK B;  1QCE A;  1HNZ O;  4TV8 B;  3OMN B;  1VEW A;  4QNH B;  5PAD A;  1G8M A;  2CDY A;  1WLE A;  2V1D A;  4JAV A;  3F5V A;  2BOB C;  1OCZ C;  1EZJ A;  1HWY A;  2H8P C;  2ACT A;  1XUQ A;  5A24 A;  3ZRW A;  3ASN C;  5GON A;  5IT9 N;  1A32 A;  2DC9 A;  1SKV A;  2XAF A;  3T4Z A; 
#chains in the Genus database with same CATH homology
 3MJ5 A;  4JI8 O;  1HNX O;  1R6T A;  5EZQ A;  4OPA A;  4AQY O;  1YZB A;  5E6J A;  2DJV A;  4XZX A;  3T1H O;  2JRI A;  4KHP O;  2UUB O;  4R3D A;  3PRP A;  3J81 N;  5BXZ A;  4DR5 O;  2N74 A;  4JI1 O;  5BY1 A;  3PT2 A;  4JYA O;  4LF7 O;  1XNQ O;  4RKX A;  3PHU A;  4BOP A;  4GUA A;  4GKK O;  4LF6 O;  2UUC O;  4B3S O;  4JV5 O;  3SDL A;  4DV3 O;  2UXD O;  4DV1 O;  4DUZ O;  3PHX A;  5FLX N;  4DR2 O;  3PHW A;  4BOQ A;  1HNW O;  4DV2 O;  5LMN O;  3MTV A;  5KO3 A;  5A2Q N;  2J7Q C;  3O65 A;  5H5N A;  5LL6 Y;  4LF5 O;  1FYJ A;  4LF4 O;  3OTO O;  3TRK A;  3C0R A;  4DV0 O;  3J7A U;  4D8B A;  4BOS A;  2J7Q A;  4JI2 O;  4JI3 O;  4X64 O;  1XNR O;  2AGA A;  4A5U B;  4DR1 O;  1I94 O;  2HHH O;  4DR7 O;  4PT5 A;  4IP3 A;  1DK1 A;  4DR6 O;  3J80 N;  4REZ A;  1J5E O;  3W31 A;  2VQE O;  3OQC A;  4X65 O;  3BB7 A;  2DOS A;  3MP2 A;  3PRM A;  1R1B A;  2UZJ A;  4DV6 O;  4LF9 O;  4IUM A;  1XEQ A;  4K0K O;  1UKF A;  5BR8 O;  2Z84 A;  2F4V O;  2BU3 A;  3JAM N;  3RT3 C;  4DV5 O;  4LFC O;  4DUY O;  2UXB O;  2Z0A A;  3E9S A;  1XMQ O;  2ZM6 O;  4JI0 O;  3IFU A;  4A5U A;  4JI7 O;  2ZKO A;  4YHH O;  3F5T A;  4B3T O;  4NXN O;  4LF8 O;  4JI6 O;  4BOZ A;  2FKX A;  1N34 O;  2BTW A;  1D2D A;  3TMP A;  1IBL O;  1FKA O;  5LMU O;  2UU9 O;  4OX9 O;  4X66 O;  1G1X B;  1KUQ A;  4OW0 A;  5EZS A;  4YY3 O;  1N36 O;  4OPH A;  3ZNH A;  1IBM O;  4P16 A;  4M0W A;  4JI4 O;  3T1Y O;  2HWK A;  3W30 A;  3BY4 A;  3M8A A;  1IBK O;  4LFA O;  4B3R O;  4OVZ B;  2LW7 A;  1AIL A;  4MI7 A;  4OVZ A;  1F7Y A;  1HNZ O;  1N32 O;  2E5L O;  1XMO O;  4NXM O;  4MM3 B;  4RF1 A;  4RF0 A;  3R66 A;  3RNV A;  4LFB O;  1PVJ A;  2UUA O;  4GKJ O;  4D8I A;  4X62 O;  4JI5 O;  2FE8 A;  3B21 A;  2UXC O;  4RNA A;  4ZTB A;  1HR0 O;  2BTW B;  4D8E A;  5JZE A;  2JTC A;  3PSE A;  1N33 O;  1FJG O;  1DKI A;  4DR3 O;  1X59 A;  4B3M O;  1AB3 A;  4DR4 O;  5IT9 N;  4DV7 O;  4HXD B;  1NS1 A;  4BOU A;  2VQF O;  1A32 A;  5IWA O;  4DV4 O;  3BBA A;  4WUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...