2AGAA

De-ubiquitinating function of ataxin-3: insights from the solution structure of the josephin domain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
190
structure length
190
Chain Sequence
GPLGSMESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIRVQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Deubiquitinating function of ataxin-3: insights from the solution structure of the Josephin domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Machado-Joseph disease protein 1
total genus 40
structure length 190
sequence length 190
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02099 Josephin Josephin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2agaA02
3.90.70.40 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2agaA01
4A5UB 4YHHO 1X59A 1IBMO 1HNZO 5LMUO 1FYJA 4JI7O 3R66A 4DR3O 3OTOO 1XNQO 1XNRO 4DR2O 1DK1A 2UXDO 3SDLA 2VQEO 4DUZO 4DR6O 3T1YO 1XEQA 4LF9O 4OPAA 1HNXO 4JI4O 1N32O 4OPHA 4JV5O 1N34O 4OX9O 2DJVA 1AB3A 2UU9O 4DR1O 4JI6O 5IWAO 3RT3C 4NXMO 4DR4O 1IBKO 2HHHO 3J81N 1FKAO 1YZBA 1A32A 1D2DA 4X62O 5BR8O 5LMNO 3JAMN 2UUCO 1HR0O 1HNWO 4X64O 5BY1A 4X65O 4DV4O 1IBLO 4LF5O 2AGAA 3O65A 2F4VO 1R1BA 5IT9N 4DV7O 5FLXN 2UXBO 2ZKOA 4DV0O 2JRIA 4AQYO 5H5NA 1I94O 1NS1A 4B3TO 4DV2O 1J5EO 1XMOO 4DR5O 4GKJO 4LFBO 1R6TA 2E5LO 3F5TA 2UUAO 4DUYO 4YY3O 1N33O 4B3MO 2Z0AA 2ZM6O 4B3SO 4DR7O 5LL6Y 4LF4O 4K0KO 4LFAO 4JI0O 4X66O 4LF8O 4DV1O 1KUQA 4DV5O 4LF7O 1AILA 4JYAO 2UXCO 1N36O 2FKXA 3T1HO 2VQFO 2N74A 4GKKO 4KHPO 1XMQO 2DOSA 4JI1O 1F7YA 3J80N 4B3RO 4JI8O 3M8AA 4JI3O 5A2QN 2LW7A 1G1XB 4NXNO 4LF6O 4JI2O 4LFCO 3J7AU 1FJGO 4DV3O 5BXZA 4DV6O 4JI5O 2UUBO
chains in the Genus database with same CATH superfamily
1BQ0A 2NQGA 3L70H 4Q8GA 5EZYA 4JTCB 3SPIA 5B5EZ 2AUZA 1KYOF 4LF7B 4JI1B 1F4NA 2K1EA 2IJKA 5BR8B 1Z5WA 4I05A 1OCZB 4MM3B 3K8UA 1K92A 1TLOA 2JGDB 2F43G 3DXRB 3ZNHA 2V1DA 4Z1VA 2VQEO 1PD3A 2IJJA 3SPGA 1FJGB 4LF9O 4BQVA 8PCHA 3AG2C 3ZN1A 4FFBA 4JV5O 1HNZB 4K8ZA 1RSOB 1Y76A 2PNSA 1COWG 4LBEC 4UVAA 2QM8A 1MOFA 4O4HB 5IYDO 5EC1C 1SESA 1XL6A 2JTCA 2PREA 3DXRA 2JVDA 3H9VA 3PRMA 1AU3A 1WB8A 2ZE7A 1EWMA 3JAWA 2VQEB 3ZHUA 3LSUA 2FT2A 9PAPA 3RYIA 1K73W 1SNKA 2AUXA 3PJSK 3VBBA 3HKDA 5LMNO 2Q7HA 5KHHA 1ME3A 4R3DA 1QVFU 5CMUA 4DUZB 3CH2X 2HEPA 4DV1B 4I0XB 1M5IA 1OHHG 3K58A 3GVMA 4N21A 5LP6B 3CJHA 5JH7B 1TU6A 4JGSA 5JQGA 4H37A 2PGGA 3M99A 4IT5A 1XMOO 3OW2U 1TL9A 1R6TA 4GCZA 4P30A 1NU1H 4B3MO 3IC7A 3OMAB 1YCIA 2M6YA 4DV1O 1AI4A 3OVZA 1GMGA 3B09A 3KKYA 1N36O 2FKXA 1R3IC 1K9MW 1RPOA 5JH7A 4DK0A 2DOSA 3KCXA 3E8HA 4IHJA 3F7VC 2V4DA 1XHXA 1L8DA 2ZDIC 2RNBA 4GUAA 1SQFA 1GTOA 4XR7A 5L3CA 3HKEB 3ABMC 1MZFA 3AG3B 5JCOA 4B3MB 5IYZB 1QMYA 1F23A 6PADA 3OD4A 3M7MX 4O4JA 2DJFB 2IPPB 3IOQA 1VQ5V 2CGNA 3FYIB 2PADA 2R9FA 2E01A 2H94A 3CC4V 3CB2A 1W0KG 4LCUC 4ZHQB 3N2KA 1AU0A 2ZR2A 5KUKA 3E2EA 4RUEA 1Y4HA 3BC3A 2IJHA 3KFQA 4X62B 3L9DA 4ICGA 5H2FZ 3QNEA 4HWYA 1RP3B 2Q69A 2IW5A 2EJ7A 4DW0A 3ZHSA 2Y4UA 1JJOA 2E5LB 1AVMA 3BPMA 1G4YB 4UCOA 4FVMA 3FB5C 1M1KW 3QJ3A 3RVXA 3CXHF 4X62O 1CB5A 4JYYA 2DZZA 2HJDA 1HR0O 1KMIZ 5B1AC 2EILC 2P4VA 4BSQA 2NR5A 3RWRD 3G6BA 4QGPA 1H2NA 3BPFA 1F51A 3ZRXA 4BS5A 1UKFA 3ML0A 1EZVH 1K7DA 2IU3A 1K4DC 2NLJC 3SJCC 4W5CA 2HVJC 2AIMA 2YXLA 5D5PA 3IUTA 3OR7C 4PA6A 2BCCH 3MHSA 3OMIB 2AHYA 2KKWA 1VJVA 2XAQA 4E4EA 1SA0A 2PZSA 1K4CC 2Q4PA 4UVCA 2RCVA 3B21A 1OCCC 5LHGA 1BZKA 3O1GA 4PDVA 4CS4A 5GONB 4FPPA 4IIJB 2B9ZA 2OT5A 3DC6A 4I07A 1NZ6A 1VQPV 2RMKB 2BSKB 2LP7A 3ZHQA 4OX9B 3T4ZA 1G1XB 3N4CA 1S3JA 2YJBA 5J2TB 3OF9A 3TK1A 4AXLA 1AU4A 4P6EA 1EWLA 1LUWA 3Q4HA 1TVKB 4MSWC 1K97A 3AG3C 4WURA 4OELA 3L73H 5IDJA 3SYCA 2Z84A 1R3LC 3CCMV 5L3GA 1VEWA 5GTIZ 4O2BA 1IXBA 4Q8HA 4MVQA 2DCAA 1ZAUA 3CX5F 2FE8A 4JZGA 3B77A 3D3IA 4YJ2A 4OPAA 1ATKA 1O9GA 3KSEA 1VIBA 3Q4HB 1B6QA 2ZNJA 1ZL8A 3OT7A 2KG7B 4AXMA 3JCZA 4DR5B 1GO3F 5KAIZ 5J94A 3LFYA 1IBKO 4WBNB 2OCCB 2OTLV 4D8EA 4W5BA 1D2DA 5CA1B 1F2BA 4LF9B 2AHZA 1VQ8V 1PNLA 1IWDA 3OQCA 2HJFC 1KFXL 1YDXA 2HP8A 1PM9A 2LFRA 1MSWD 2CK3G 4DV7O 3T1HB 2G7YA 2Z3YA 1YIJV 1QHTA 2G8EA 4NYKA 5KA5A 5LA6A 5KLVH 1GCBA 2CDYA 3SPJA 2UUAO 1VQ6V 2EIKC 1WNSA 1YTFD 5CHVA 3OGCC 1IBMB 1VF6A 1P7GA 1Q90D 4CS3A 2J7QC 2L6LA 2QWPB 4CH5A 4P16A 4YIOA 4FZ1A 4JZ2A 5L3BA 5B1BB 3ICXA 3SR2C 5LMUB 5EZYB 2YIBD 3RFRA 3MHHC 4OW0A 2K9PA 3HB3B 1B04A 5BZBA 1B3QA 4R8CA 4D7SA 1H2GA 3BVOA 4MSXA 1PNKA 1QXPA 1YHQV 4FIPC 3ZHRA 5BMVA 4U3JA 5FNVA 4MZSA 4FFBB 3E22B 1N34B 5LMUO 1MA1A 4A5UA 5LP6C 4J9ZB 2CIOA 4IYIA 1ROPA 4HXDB 4DR4B 5EYPA 1XNRO 3QO7A 4X8AA 5EZSA 3IGAC 1PPPA 4DUZO 4B3RB 2ZQMA 2B5UA 1XEQA 3OFNG 3AG1B 1ENVA 4PA4A 3PW3A 1N34O 4O4IA 1NH2D 5LGUA 1YI2V 5EIBC 4KLBA 4BS6A 4I0XA 5LOVB 2BTQB 1R73A 1FH0A 4BR6A 3CCLV 2FB5A 3CJHB 2A7WA 2DW4A 5E6JA 1CJLA 1R6NA 5BR8O 4KP4A 3BWKA 2QWOB 3IFUA 4QNHB 4QH6A 5JVDB 2PF4E 3JAKA 1U96A 4LWSB 3ZRSA 4GLXA 4EB6B 1NQCA 1AECA 2AYNA 3CRRA 5DN6G 2QEXV 1QVGU 1J5EO 2B1IA 5KO3A 2Y69C 3F5TA 1T5EA 2ITDC 2DC7A 2GDSA 3CRMA 4TSFG 2XAFA 5IYZA 5LL6Y 1KU9A 3CCVV 4UCUA 2EULA 1WA8A 1VF5B 1NVPD 4ZI7B 1AILA 3OUFA 4DV6B 2ZR3A 4GX0A 4ZKIA 2CE4A 4F6EA 2RQ6A 4O4JB 3JYCA 5KMGA 2FMLA 4MT8A 3MTVA 2EZPA 3AI8A 4DW1A 3VQYA 3RNVA 2GUZA 4I9WA 1GN6A 3OEEG 1XBLA 1Y67A 1E1QG 3B40A 2UXDB 5CHTA 4J80A 2QTOA 2ZIOA 4BW9A 1CPJA 2QKCA 2RJZA 1CXZB 1KP2A 4G54A 3HHAA 4FZ0A 4JI5O 5IY5B 5IJ0B 4GT1A 2JGUA 5CA0B 2YXYA 3HD3A 3WG7B 3H1JH 4X6JA 3FB6C 1SS3A 2UXDO 3W7XA 1MHWA 2XU4A 1R6KA 3PHUA 4WFBV 4JI5B 2P7TC 4X6HA 4OPHA 5CA0A 3W7UA 3KKUA 4M0WA 4BOQA 3QG5A 1AB3A 1L0NH 3BOWA 3JASB 3OF8A 1BQIA 4ZIBA 3ZX6A 2G6DA 3I3TA 3TXQA 3FX7A 2Q6AA 4EEQA 3CYOA 4OVZB 2QDOA 3NHEA 2CTWA 1NT2B 3LDCA 3F75A 3RW0A 2AVWA 1N0NA 1IBLO 1PXVA 3CBJA 2PUSA 1SA0B 3D36C 3E8BA 3IC9A 3ZCCA 3PSEA 2WPDG 3W30A 1R1BA 5IYBO 1HWYA 5IT9N 4LP8A 3UO2A 3N2GA 1VQ7V 4L87A 1Y6XA 5JWPA 2ARYA 1FS0G 1N0JA 5H5NA 1WP8A 1QNMA 2JJ2G 4IL6Z 1YITV 4XDJA 4HAMA 3UO3A 2EIJC 2EJRA 3H1IH 2WA4A 1L0LH 2DN9A 3B79A 2Z5UA 3ZRWB 4LF4O 4NTWA 1AR5A 4LF7O 1SQXH 1US6A 4DMXA 3L74H 4UXNA 1KECA 1AYWA 2YJ9A 3G67A 3FAVB 1XMQO 1TVKA 4ZUXU 1BHBA 5CBGA 1H2LA 4XZXA 5D5QA 2YJ2A 3V6CA 1N33B 4IGGA 1Q6HA 4IP3A 4J9YB 1P49A 2WAMA 2R9IA 5BXZA 2ZD9A 3ABKB 1U9VA 5C8YA 2ZE8A 2L35A 1DF4A 1X59A 3D3QA 1IBKB 4LH6A 3DF0A 1YT7A 1I08A 3RYFA 3APQA 1ZL8B 1YXBA 2KG7A 4RNAA 2GHYA 4J7ZA 1S72V 2QJ1A 1M57B 1NTZH 3SJBC 3RVVA 2GSMB 4K35A 5C8YB 1HDJA 4BWAA 5GW7A 1N32O 4I55B 5DECA 1Q7YW 4PA3A 3CD6V 4Q6GA 3RT3C 4MVRA 4WFEA 5FPRA 2JEXA 4DR4O 4FM1A 2X6AA 1MEGA 4YYVA 3LNNA 1BGOA 1QR9A 3K57A 2PI5A 1NJIW 4FK5C 2UUCO 1HNWO 4YYUA 3ZMSA 4EFEA 2P6JA 1N36B 5IJ9B 3UQ8A 1H2MA 4O4LB 1MNGA 4GZRB 2MK3A 3U10A 4BIZA 2FUDA 4K7CA 5B66Z 1QLEB 3T1YB 4H13B 2EIMC 5DM6V 3CBKA 1NVPB 1TUBB 4AQYO 3G71V 1NPZA 2ODMA 3FD9A 1F2AA 2CUGA 2JS5A 3E8FA 3QO5A 3G80A 2PY5A 3FB8C 1Q6IA 4LF5B 1KUQA 1FXHA 1OV9A 1WPXA 4P9OA 2E03A 3KWBX 2JDIG 2F23A 7PCKA 3JALA 1GH6A 3FFQA 4LR3A 4FLTA 2WWWA 2Q5ZA 2YUAA 4X20A 4JI8O 1WJZA 5EYPB 1EF7A 2Y6EA 3ABLC 2XOKG 3CRAA 1PV0A 4JI2O 2CH7B 1KKCA 1E79G 2A0LA 5B3SC 4FIPA 3P3NA 1SERA 4YIPA 2UUBO 1MG1A 1HNZO 1NTMH 4XDLA 3R65A 2PYJA 3OE7G 5JJJB 5EC2C 5KHJA 4YV8A 1K3BB 2FTKA 1S76D 1VARA 4NVPA 1BCCH 3CC7V 2A79B 3K24A 1Y74A 2QKAA 2CH7A 2H3OA 3K79A 5C93A 4PI3A 2FL4A 3F5VA 4TWKA 3IFXA 3K5NA 4WFHA 2Y48A 3MDSA 2DJVA 4LWSA 2F7DA 5ITZB 4O4HA 3TMPA 3UT5B 3AK1A 3ZN0A 2LGWA 5L3DA 4PA9A 1JMKC 3J81N 3RYIB 2DYSC 1H8EG 1FKAO 4P2ZA 3BAAA 4B3TB 4YJ3A 1NKDA 4GX2A 2PBHA 4BIOA 4DV4O 3HKBB 2R9CA 3MP2A 2PTMA 4GUNA 4CDDB 2AGAA 1PVJA 3UT5A 3CP1A 4X6IA 4BAYA 2O57A 1ZCMA 2YJ8A 3M99B 3B8MA 3P30A 4LNUA 2LJ2A 1GM7A 3RN4A 3WXFA 4LFCB 4UCVA 2E00A 5H6RA 4DUYO 4D8BA 1JJ2U 2Q7EA 3QO8A 1HW7A 3HKBA 1FD9A 2HHNA 4B3SO 4DR7O 1SETA 2JJ1G 3MJ5A 4LF6B 5CVOB 4MS2A 3HKCA 5IY5C 4QJFB 1Q43A 4LH7A 2OTJV 1A6RA 4XDKA 4X1IB 3RYCB 1H2KA 2EX3A 5FL7G 4YYQA 3ASOB 1CV8A 3ZMTA 2ADPA 4ZOLA 4D8IA 5K1PA 4F4LA 4DR3B 3AG7A 5CBHA 1QBZA 4JI0B 3ZMZA 3HKCB 4DV3O 2DZYA 5EIBD 3TETA 4HNAB 3SYPA 4MW3A 1DLBA 3RYCA 3NXSA 4JI7O 4QBBA 1POPA 4NXMB 4DR3O 1BMFG 4RKXA 4XUIA 3JASA 4TUYB 3VOUA 3ZJZA 4FLVA 4CH6A 2IU0A 1DF5A 2V7QG 4X1YB 1IX9A 1EN5A 2XHBA 5HFLA 4WFAV 3PHXA 3AG4C 2OCCC 4DRXA 3UCSC 3GWOA 4NXMO 2DYRC 3WXEA 3N2GB 2ETNA 3CCUV 3CCSV 5JJNB 4UUJC 2G38A 2BU3A 3CE2A 4X1YA 1TGOA 3PRPA 2Q9LA 3HKDB 4YY3B 1Q8IA 1ZX3A 5E1AC 4DRXB 1LUVA 1KFUL 4CDEB 1GKFA 3AG1C 2WSSG 2ZDIA 3ZEDA 3OISA 1AJPA 1TA8A 1EWOA 4FMTA 1OCCB 3T4DA 2R72A 4JI3B 2WBFX 3BCNA 4JYBA 3W7TA 2ZE5A 2WA3A 4UFZA 3K5MA 4MVZA 2AYOA 3OEHG 2QKSA 3DSQA 4I04A 3STLC 2E02A 4B08A 2EINB 1JA8A 4MVUA 1XNRB 1MIRA 3H6SA 2OULA 4JI1O 4I9QA 2YJCA 4G28B 1SRYA 3APOA 3JD0A 3K9MA 1I5YA 3QTCA 5H6QA 1MEMA 1OCOB 3D36A 2EILB 1H8HG 2JK5C 2OWOA 3TJTA 4Q20A 4NXNO 4X66B 2OP3A 2F66C 2W6JG 4CC6A 4CZZA 2QE7G 4I4TB 4X88A 3H7DA 3ETGA 3KWZA 3B4SA 1NR1A 1XHZA 1H38A 1QQCA 2XT9A 1HUCB 3JCUZ 2P22C 4OGQB 3JATB 5E79Z 1KC8W 5F02A 3H1HH 2HD5A 4Z2WA 2F4VB 1M93A 4I4TA 2UUBB 3CEIA 3I5DA 4PV1B 3HHIA 4JI6O 3LDDA 3OGIB 5LGNA 1U9WA 1Z2GA 1WN7A 2YI8A 3JATA 2EIJB 1S5JA 2R9OA 1JQPA 1Y66A 1ZSPA 2F95B 1IVSA 1PBHA 1KQSU 5J9PC 2PI4A 1YK7A 3W7SA 4X65O 1K33A 4U3FH 4GKKB 1AR4A 3KW9A 2WLIA 3EFFK 1K3EA 1NTKH 1SQGA 5LYJB 4H0LB 1UPGA 3QF7A 1Q86W 2UZJA 1S77D 1PNMA 1FXVA 1GN2A 3JALB 3S3WA 4PELA 2KSDA 2HG5C 1BP4A 2O6XA 4PI0A 3K3WA 3VQVA 3JARB 4B3TO 5J2UA 3ZBHA 1MABG 1Y4MA 4JI2B 5KX5A 5KHGA 1Y08A 1SP4B 1AYVA 1BHAA 4CBCA 2WLLB 5B1NA 4YYSA 2Z0AA 4X65B 2AU1A 1VQMV 1NR7A 2DQ0A 1DEUA 3E1ZB 1V55B 1D5NA 2WLIB 4DV5O 3GB7C 3SGIA 2ZT9B 5LYJA 5B3SB 2UXCO 3LDEA 1O9HA 4JPRA 4RQEA 4JYCA 1KXRA 1F7YA 1I94B 2QR4A 3H8CA 1QLEC 3B2EE 4O2AA 3P5VA 4KUMA 1XOUA 3CMEV 3DTUB 3E35A 3IAYA 3JD4A 1CVZA 1PIPA 2BSKA 4L8JA 2BTWA 1Y74B 4DV2B 3ETDA 1O0EA 5FNVB 2Q0OC 5IWAB 4W4LA 3QSDA 4CC5A 5J2TA 2EINC 1JQ0A 2OZ2A 3AK2A 2ZM6B 3C3TA 1VQ4V 4MVOA 4Z1MG 3BCCH 5ITZA 4HYOA 2JGDA 1AR1B 2C0YA 3ASNC 2D2CB 1DK1A 2X0LA 4QRXA 2QTSA 3SDLA 3TXSA 2BTWB 1R3JC 5EBWC 1U9XA 5B1AB 1E1RG 2CTPA 4BIUA 1QU7A 3SJAC 3WU2Z 2X6CA 4X64B 1TUEB 4O4IB 1RSOA 1Y76B 1HNXO 1PKXA 2YIBA 3C90A 1KHPA 2NNUA 2UU9O 3MHSC 3FKSG 2YC0A 2E76B 3MD0A 3JD1A 3ZUAA 3KG2A 4E2LA 3PT2A 3U0ZA 1K34A 3GWKC 4MTXA 5AG2A 5CA1A 3D8CA 4X64O 2E74B 4UV9A 4PDMA 1AIMA 3BA8A 2W0FC 3CC2V 2YDEA 3RGBA 2DC8A 1JFFA 2C2AA 5LP6A 2VQFB 4N8WA 3S3QA 1FXKA 5JQGB 4X1IA 2AW9A 4IYHA 2QM4A 2IBIA 4YXWG 4MTFA 4N23A 4PADA 1GRJA 4ZOLB 1OCZC 1EWPA 3A8TA 5IE9A 1AP5A 1IURA 2FO5A 3X2QB 3K9SA 1CPYA 1MS6A 1V54B 4JI7B 4CZWA 1JFFB 2MW2B 1BE3H 1AROP 2YI9A 3AG2B 4HNAA 4D7TA 2UXBB 1BQZA 4CS2A 4BPVA 2HH5A 2W6IG 4TV8A 5CVMA 2DMXA 4WA6A 2GUZB 2GV9A 4DR6B 2GTAA 4RF1A 2B1GA 3VQWA 2ADQB 2AZ2A 3CRQA 3V6EA 2Q68A 4HZ3A 3SYAA 2E75B 2IH3C 4DUYB 3TNXA 3B8NA 2XAGA 4GX1A 4JI4B 4B3SB 2IH1C 4MTGA 3CCRV 1NH2B 1K5SA 2DE0X 1FYJA 4LF8B 5JCOC 3N2KB 1CSBB 1F4MA 3E22A 2XU1A 1N4CA 4RUFA 4FM2A 3CCQV 4JTDB 2XAJA 1URFA 1VQNV 1GN3A 5CA3A 1XMQB 2YSUB 2DCDA 2XTAA 2XAHA 4UVBA 1GLOA 3T1YO 5JH3A 1Q6UA 1XUQA 3ERVA 1M9NA 3ZMVA 5CN0A 3WB1A 2QGNA 2FYEA 2H7JA 3SYOA 1AYUA 4AI8A 1MDWA 1W0JG 5LOVA 1AJNA 1OCRC 4RWUA 2HHHO 4TQDA 1PPDA 2GFOA 3WFVA 3O9OA 2DYSB 1FFTB 3CCEV 4FFKA 1WB7A 1FAFA 1V9PA 4NTXA 1Q82W 2UUAB 1YVWA 3TGUH 4J41A 5CVNB 3E9SA 4I7ZB 3LSQA 5K1XA 1UJWB 1AJQA 4KHPB 1UFIA 3BPZA 2UXXA 2ACTA 3JAKB 3O65A 2HR3A 3ASOC 5FLXN 1YEWA 2JEUA 2B1MA 4QRVA 2LGQA 1B06A 2Q0AA 3BRCA 3CSXA 4X9QA 2P90A 1VP7A 1V54C 3E89A 4FM0A 2IBZH 3A0HZ 3ZRWA 4D6TH 2JQFR 1NQTA 1N33O 3ABMB 2AXTZ 5JZEA 3JD2A 1WA8B 1ZTEA 2QA4V 2P86A 4MVMA 4DV7B 3T1HO 4DO2A 2N74A 2PYLA 2N05A 4IIJA 3T1CA 2CAZC 4I50A 5CB4B 3DC5A 4JI3O 1M56B 2ZXWB 3A0BZ 1PADA 1AI5A 4CDCB 5DEDA 4DV5B 1SZXA 2BOCC 1W2BU 1XI1A 3RYHB 4TT3G 3LNMB 2DQ3A 4F6RB 1EZJA 3FB7C 3PHWA 4RY2A 1I0HA 3MAQA 1PPJH 5IYCO 5CB4A 3K59A 3IEJA 1XNQO 4PDRA 2ATKC 2R9NA 2XNDG 1NB3A 1YK8A 4O2BB 4FK5A 3THOA 4EKWA 2R9AA 4PI2A 1GK9A 4YJ2B 1NBMG 1PP9H 4QE7A 1HNWB 1EN4A 5LGTA 1ZLZA 4F6RA 1P84F 1U97A 1RFYA 1EM1A 3K06A 4DR1O 3BY6A 2Y5BA 4CH4A 1BGYH 1PCIA 2CTRA 2H8PC 4CDFB 3UM7A 1G6UA 3SJQC 4K8XA 1FFXA 1YZBA 5IJ9A 4OVZA 1SQQH 1PE6A 3ABLB 1ICFA 2WLLA 5B1OA 1QDQA 2M7WA 2X7RB 4LFAB 4OEMA 1Q81W 3K5LA 2UU9B 2B1NA 4DXWA 2YIAA 1L1FA 1BS3A 4R7CA 1YF2A 3QVNA 3ZRVA 2BOBC 4JV5B 2R9RB 3BY4A 3IMAA 1GM8A 5LA6B 2P5OA 2OIGA 2NQIA 4DV2O 1NI8A 3CH3X 4JI8B 1HR0B 1W59A 2YS8A 4JTAB 2XU3A 2FYUH 2Y4TA 5A9GA 2ZM6O 3K5OA 3CS5A 2ZNIA 4LFAO 4J42A 4DYLA 1LNQA 3L71H 2VS0A 2YXHA 2D3OW 2VQFO 2AS8A 4YHHB 4WCEV 3G6EV 3EXAA 2JIZG 5JA7A 2ZCEA 3JSLA 1M56C 4AILC 4MZOA 2VRZA 1J5EB 1GM9A 2P4KA 4ZTBA 5EBLC 2GTSA 2DCCA 3TRKA 3OTFA 1HNXB 3K04A 1XDCA 2KB1A 3LUTB 1CTEA 4LFCO 4U3JB 2Y69B 4DV6O 3OR6C 1SQVH 4A5UB 4YHHO 2IJIA 2Q7GA 2J7QA 3ZHVA 1DF0A 3N3KA 1THZA 2DJGB 3N27A 3PN1A 1PPNA 3STZC 1MSDA 4C7UA 5JJEB 3NR7A 4UCRA 1AU2A 2WLJA 1ORQC 1IZ3A 1MZEA 4ABMA 4EFBA 2BE3A 3E8GA 4ZBMA 1SQPH 4JI4O 4G2KA 3EVKA 1K8AW 2BTQA 4MI7A 4U7NA 1JR9A 4R50A 4FLYA 1S5HC 4K3AA 4DV0B 2CB5A 5KA6A 4BOPA 4WBNA 1WAZA 1YSCA 5KAFZ 4N4ZA 4KXRA 5PADA 2P0RA 1PPOA 4TOIA 5L3EA 3ZS8C 1AI7A 5JVDA 2YIDA 5CBFA 1N8RW 3CCJV 1BY8A 2A06H 2HVKC 3S3RA 4EB6A 3RVWA 4YVAA 2GHUA 3BHPA 1U9QX 1I7FA 4JYAB 5KUMA 1S4VA 2LO1A 4NR1A 3U8EA 2P06A 4DV0O 3C3SA 4G27B 4MW8A 4TV8B 1J95A 5KHIA 5B1BC 3WB0A 3MORA 1YTFB 3ABTA 4NXNB 3P5WA 2QSAA 3P5XA 4GKJO 2LW1A 1JCHA 2E5LO 3K0GA 1I5XA 1KP3A 2BDLA 4TV9A 1X4TA 3DGEA 1SZTA 1EFRG 4I5SA 4LF8O 4WFFA 3OAAG 1CEZA 4DV3B 1F2CA 4AHCA 3H8BA 4JYAO 4MVSA 2Q67A 4FJCA 4BOZA 1YVBA 3K03A 1F29A 1DGSA 1XILA 2ITCC 2E3CA 4B7EA 4WF9V 2HLDG 4TV9B 1KHQA 4LF4B 2BDZA 3A2FA 3ZMUA 3RBZA 4YYWA 2F93B 1BL8A 2YEVA 1KB9F 4JI6B 3HPLC 3EHBB 1Q6KA 3L72H 3MTNA 1XL4A 3OMNB 3ABKC 1N32B 2OYQA 5BMVB 3OVXA 2OCHA 1JVMA 2ZXWC 3JSNA 3R66A 4P9PA 2AZ0A 4X1KB 3AEIA 4DR2O 3AG4B 1WPBA 4X89A 2UXNA 3C0RA 2X6BA 3I56V 4CH3A 2YEVB 2VHFA 3I06A 4PP2E 2UUCB 3BBAA 3KX1A 2JQGR 2BTOA 2R70A 2DCBA 2R6NA 1VF7A 2KQXA 3WG7C 2FQ9A 2YICA 5FPWA 4DR2B 4NTYA 2QWRB 1RM1B 3CPWU 1A32A 1OZ0A 3W31A 1KD1W 3CWBH 2RDCA 4GX5A 1STFE 1Z5VA 5LHIA 5EZQA 4YJ3B 1YJ9V 1S0VA 4FLZA 4LF5O 2XUMA 1M90W 4P6GA 1BT8A 2F4VO 4NB5A 1SC5B 3KCYA 4UB8Z 2ZKOA 4REZA 3WXGA 2HXZA 3JAWB 1NS1A 3F7YC 5EBMC 1PL4A 4DR5O 4J11A 4KL1A 1AP6A 4I50B 3C9EA 4IUMA 1WLEA 4BOUA 2ARHA 3SYQA 2Q73A 2G8JA 4TQFA 2ZE6A 1MMMA 4K0KO 3ZIAG 4X66O 3PBHA 4U7OA 4PDLA 1X9YA 2W0XA 2Q8VA 4ZI7A 3RYHA 1IXMA 4GKKO 5LXTA 5KMGB 3RVZA 4B3RO 4PP1A 3FYEB 3M8AA 5EF4A 1Q5OA 1ZUQA 4FLUA 3CXCU 4FJCC 1PL0A 1IBMO 5LXTB 5IJ0A 1ME4A 4IHJB 1QLNA 1OJHA 3LXSA 1SF9A 2DYRB 1XQ8A 2WLHA 1YALA 2UXCB 3UKMA 4FLWA 2VWJA 3HKEA 3CMAV 1VSNA 4PA7A 3MHHA 2HFEC 3U11A 4JAUA 4TUYA 5LBQA 1K5QA 2FRAA 2WLKA 1ITOA 1FFXB 1QCEA 2Y0IA 4DK1A 3IHPA 1P4RA 5LMNB 3QT4A 2EBOA 4GYCB 3RVYA 4PJ0Z 4UCTA 2ILMA 1XREA 4NKGB 3O0UA 1RM1C 2QWNB 4ZHQA 5IWAO 3GCBA 2RN9A 2LFSA 3BFRA 4R6ZA 3USVA 1LR1A 4UV8A 3WB2A 4UB6Z 3OM3B 1JX9A 1VQKV 2CGOA 2NN4A 2XASA 5L3FA 1XMOB 4O4LA 5HFMA 3JAMN 1S5LZ 4YYRA 5BY1A 3OUSA 1D5AA 1CP9A 3VQXA 2VHSA 3K08A 1WP7A 1H2SB 1TUBA 4J7KA 1NLJA 3BABA 2JRIA 4DMYA 4WFGA 3I55V 1TAEA 5KX5B 4DR1B 2Y0PA 1GN4A 1I94O 3CRCA 1OCRB 2QWQB 4HBNA 4H33A 1ZIVA 1EN6A 2JS3A 1EBOA 4DV4B 3G4SV 4LC1A 4QPJA 1IBLB 4JI0O 1IDSA 4XBFA 4MTOA 3TCUA 1AI6A 3N3GA 3BEHA 4J10A 4O2AB 3FAVA 2P67A 3S3XA 1P7BA 1JOYA 2WLNA 4H44B 3OTOB 3H89A 1V55C 1VMGA 1R3KC 3P32A 4PD4F 1HP8A 4DR7B 2LW7A 4LF6O 2F1GA 2N04A 3CHXA 3HR0A 1VQLV 2F1MA 4JAAA 3J7AU 1NB5A 1FPOA 4RAIA 2CTQA 4W4KA 5GONA 1YJWV 3KZIZ 4JF3A 4RO2A 2NQDB 2EIMB 2VWKA 4BW5A 1SKVA 3RYFB 3T2MA 4QE9A 3OTOO 5FPOA 4W4UA 4J7JA 3H1KH 4RF0A 5H9CA 4DR6O 3D6SA 5GTHZ 1GAXA 3ETQA 1KKDA 3K0DA 1FXKC 3SPHA 1Q3EA 1M57C 4OX9O 4FLXA 3ASNB 1CS8A 4I55A 4UCSA 2A9HA 3X2QC 2IM9A 1DTOA 3LSSA 1VQ9V 1SQBH 2WLMA 2EIKB 4GKJB 1KBHA 3E86A 2XU5A 1U5IA 3AK3A 3ZHTA 5TISZ 5A24A 3ABUA 1QR8A 3BB7A 3PNRA 1CQDA 2OIEA 1M4UA 1GMYA 2HKOA 2LQTA 5LHHA 4B7KA 1G8MA 3E83A 3H01A 1M6DA 2DC9A 4QRGA 1VQOV 3H1LH 4N79A 1YJNV 3SPCA 1XKGA 3IJ4A 1FXKB 2EZOA 3L75H 2UXBO 4PT5A 4OXSA 3P3PA 4LNUB 4PHZA 2ATOA 2NQAA 3HWNA 3K9AA 2FTDA 4KFMA 5EK0A 4QIWF 4LFBO 3JARA 4RQFA 5J2UB 1DKIA 2HHHB 5F2VO 1GECE 4YY3O 2QM7A 3ETEA 2FRQA 1VF6C 3W7WA 2DC6A 2R9MA 5EGWA 2A3QA 1BSMA 5KHKA 2DWEC 2ZINA 1THEA 2GBOA 4ASUG 1XNQB 4KHPO 4QPKA 4AQYB 3BA9A 3JD3A 3J80N 3P5UA 1OCOC 4JASA 4LFBB 3PDFA 2HWKA 2ZIMA 3IV2A 4X1KA 4BOSA 4X20B 1JPXA 5A2QN 1ZWIC 3F5WC 1QOLA 4K0KB 2DWDC 3A0RA 1FJGO 1NL6A 2P7UA 5K16A 4JAVA 1RPRA
chains in the Genus database with same CATH topology
4A5UB 4YHHO 1X59A 1IBMO 1HNZO 5LMUO 1FYJA 4A5UA 2J7QA 4JI7O 3PHWA 3R66A 4RNAA 4DR3O 4WURA 4RKXA 3OTOO 4HXDB 4MM3B 1XNQO 1XNRO 4DR2O 1DK1A 2Z84A 3ZNHA 2UXDO 3C0RA 3SDLA 5EZSA 2VQEO 2BTWB 4RF0A 4DUZO 4DR6O 3T1YO 3PHUA 1XEQA 4LF9O 3BBAA 2FE8A 4OPAA 1HNXO 4JI4O 1N32O 3PHXA 4OPHA 4JV5O 4M0WA 1N34O 4OX9O 2DJVA 4BOQA 1AB3A 2UU9O 4DR1O 4MI7A 3TMPA 4JI6O 5IWAO 3RT3C 4NXMO 4DR4O 1IBKO 2JTCA 4BOPA 2HHHO 3PRMA 3J81N 4D8EA 1FKAO 1YZBA 1A32A 2BU3A 3W31A 3PT2A 1D2DA 3BB7A 4OVZB 5E6JA 4X62O 5BR8O 5LMNO 3PRPA 4OVZA 3JAMN 2UUCO 1HR0O 1HNWO 3IFUA 5EZQA 4R3DA 4X64O 5BY1A 4X65O 4DV4O 3E9SA 3OQCA 3MP2A 1IBLO 4LF5O 3W30A 2AGAA 1PVJA 3O65A 2F4VO 3PSEA 1R1BA 1UKFA 5IT9N 4DV7O 5FLXN 2UXBO 4PT5A 4REZA 2UZJA 2ZKOA 4DV0O 3BY4A 2JRIA 4AQYO 5H5NA 1I94O 1NS1A 4B3TO 4DV2O 1J5EO 5KO3A 1XMOO 4DR5O 4GKJO 4LFBO 1R6TA 2E5LO 3F5TA 2UUAO 4DUYO 1DKIA 4IUMA 4D8BA 4YY3O 4BOUA 1N33O 4B3MO 2Z0AA 2ZM6O 4B3SO 4DR7O 5LL6Y 4LF4O 4K0KO 4LFAO 3MJ5A 4JI0O 4X66O 4LF8O 4DV1O 1KUQA 2J7QC 4DV5O 4LF7O 1AILA 5JZEA 4P16A 4JYAO 2UXCO 3B21A 1N36O 2FKXA 3T1HO 2VQFO 4BOZA 2N74A 4GKKO 4KHPO 3MTVA 1XMQO 2DOSA 4JI1O 4OW0A 1F7YA 3J80N 4B3RO 3RNVA 4D8IA 4GUAA 4RF1A 4XZXA 2HWKA 4JI8O 4ZTBA 4BOSA 3TRKA 3M8AA 4JI3O 5A2QN 4IP3A 2LW7A 1G1XB 2BTWA 4NXNO 4LF6O 4JI2O 4LFCO 3J7AU 1FJGO 4DV3O 5BXZA 4DV6O 4JI5O 2UUBO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A5U B;  4YHH O;  1X59 A;  1IBM O;  1HNZ O;  5LMU O;  1FYJ A;  4JI7 O;  3R66 A;  4DR3 O;  3OTO O;  1XNQ O;  1XNR O;  4DR2 O;  1DK1 A;  2UXD O;  3SDL A;  2VQE O;  4DUZ O;  4DR6 O;  3T1Y O;  1XEQ A;  4LF9 O;  4OPA A;  1HNX O;  4JI4 O;  1N32 O;  4OPH A;  4JV5 O;  1N34 O;  4OX9 O;  2DJV A;  1AB3 A;  2UU9 O;  4DR1 O;  4JI6 O;  5IWA O;  3RT3 C;  4NXM O;  4DR4 O;  1IBK O;  2HHH O;  3J81 N;  1FKA O;  1YZB A;  1A32 A;  1D2D A;  4X62 O;  5BR8 O;  5LMN O;  3JAM N;  2UUC O;  1HR0 O;  1HNW O;  4X64 O;  5BY1 A;  4X65 O;  4DV4 O;  1IBL O;  4LF5 O;  2AGA A;  3O65 A;  2F4V O;  1R1B A;  5IT9 N;  4DV7 O;  5FLX N;  2UXB O;  2ZKO A;  4DV0 O;  2JRI A;  4AQY O;  5H5N A;  1I94 O;  1NS1 A;  4B3T O;  4DV2 O;  1J5E O;  1XMO O;  4DR5 O;  4GKJ O;  4LFB O;  1R6T A;  2E5L O;  3F5T A;  2UUA O;  4DUY O;  4YY3 O;  1N33 O;  4B3M O;  2Z0A A;  2ZM6 O;  4B3S O;  4DR7 O;  5LL6 Y;  4LF4 O;  4K0K O;  4LFA O;  4JI0 O;  4X66 O;  4LF8 O;  4DV1 O;  1KUQ A;  4DV5 O;  4LF7 O;  1AIL A;  4JYA O;  2UXC O;  1N36 O;  2FKX A;  3T1H O;  2VQF O;  2N74 A;  4GKK O;  4KHP O;  1XMQ O;  2DOS A;  4JI1 O;  1F7Y A;  3J80 N;  4B3R O;  4JI8 O;  3M8A A;  4JI3 O;  5A2Q N;  2LW7 A;  1G1X B;  4NXN O;  4LF6 O;  4JI2 O;  4LFC O;  3J7A U;  1FJG O;  4DV3 O;  5BXZ A;  4DV6 O;  4JI5 O;  2UUB O; 
#chains in the Genus database with same CATH topology
 1BQ0 A;  2NQG A;  3L70 H;  4Q8G A;  5EZY A;  4JTC B;  3SPI A;  5B5E Z;  2AUZ A;  1KYO F;  4LF7 B;  4JI1 B;  1F4N A;  2K1E A;  2IJK A;  5BR8 B;  1Z5W A;  4I05 A;  1OCZ B;  4MM3 B;  3K8U A;  1K92 A;  1TLO A;  2JGD B;  2F43 G;  3DXR B;  3ZNH A;  2V1D A;  4Z1V A;  2VQE O;  1PD3 A;  2IJJ A;  3SPG A;  1FJG B;  4LF9 O;  4BQV A;  8PCH A;  3AG2 C;  3ZN1 A;  4FFB A;  4JV5 O;  1HNZ B;  4K8Z A;  1RSO B;  1Y76 A;  2PNS A;  1COW G;  4LBE C;  4UVA A;  2QM8 A;  1MOF A;  4O4H B;  5IYD O;  5EC1 C;  1SES A;  1XL6 A;  2JTC A;  2PRE A;  3DXR A;  2JVD A;  3H9V A;  3PRM A;  1AU3 A;  1WB8 A;  2ZE7 A;  1EWM A;  3JAW A;  2VQE B;  3ZHU A;  3LSU A;  2FT2 A;  9PAP A;  3RYI A;  1K73 W;  1SNK A;  2AUX A;  3PJS K;  3VBB A;  3HKD A;  5LMN O;  2Q7H A;  5KHH A;  1ME3 A;  4R3D A;  1QVF U;  5CMU A;  4DUZ B;  3CH2 X;  2HEP A;  4DV1 B;  4I0X B;  1M5I A;  1OHH G;  3K58 A;  3GVM A;  4N21 A;  5LP6 B;  3CJH A;  5JH7 B;  1TU6 A;  4JGS A;  5JQG A;  4H37 A;  2PGG A;  3M99 A;  4IT5 A;  1XMO O;  3OW2 U;  1TL9 A;  1R6T A;  4GCZ A;  4P30 A;  1NU1 H;  4B3M O;  3IC7 A;  3OMA B;  1YCI A;  2M6Y A;  4DV1 O;  1AI4 A;  3OVZ A;  1GMG A;  3B09 A;  3KKY A;  1N36 O;  2FKX A;  1R3I C;  1K9M W;  1RPO A;  5JH7 A;  4DK0 A;  2DOS A;  3KCX A;  3E8H A;  4IHJ A;  3F7V C;  2V4D A;  1XHX A;  1L8D A;  2ZDI C;  2RNB A;  4GUA A;  1SQF A;  1GTO A;  4XR7 A;  5L3C A;  3HKE B;  3ABM C;  1MZF A;  3AG3 B;  5JCO A;  4B3M B;  5IYZ B;  1QMY A;  1F23 A;  6PAD A;  3OD4 A;  3M7M X;  4O4J A;  2DJF B;  2IPP B;  3IOQ A;  1VQ5 V;  2CGN A;  3FYI B;  2PAD A;  2R9F A;  2E01 A;  2H94 A;  3CC4 V;  3CB2 A;  1W0K G;  4LCU C;  4ZHQ B;  3N2K A;  1AU0 A;  2ZR2 A;  5KUK A;  3E2E A;  4RUE A;  1Y4H A;  3BC3 A;  2IJH A;  3KFQ A;  4X62 B;  3L9D A;  4ICG A;  5H2F Z;  3QNE A;  4HWY A;  1RP3 B;  2Q69 A;  2IW5 A;  2EJ7 A;  4DW0 A;  3ZHS A;  2Y4U A;  1JJO A;  2E5L B;  1AVM A;  3BPM A;  1G4Y B;  4UCO A;  4FVM A;  3FB5 C;  1M1K W;  3QJ3 A;  3RVX A;  3CXH F;  4X62 O;  1CB5 A;  4JYY A;  2DZZ A;  2HJD A;  1HR0 O;  1KMI Z;  5B1A C;  2EIL C;  2P4V A;  4BSQ A;  2NR5 A;  3RWR D;  3G6B A;  4QGP A;  1H2N A;  3BPF A;  1F51 A;  3ZRX A;  4BS5 A;  1UKF A;  3ML0 A;  1EZV H;  1K7D A;  2IU3 A;  1K4D C;  2NLJ C;  3SJC C;  4W5C A;  2HVJ C;  2AIM A;  2YXL A;  5D5P A;  3IUT A;  3OR7 C;  4PA6 A;  2BCC H;  3MHS A;  3OMI B;  2AHY A;  2KKW A;  1VJV A;  2XAQ A;  4E4E A;  1SA0 A;  2PZS A;  1K4C C;  2Q4P A;  4UVC A;  2RCV A;  3B21 A;  1OCC C;  5LHG A;  1BZK A;  3O1G A;  4PDV A;  4CS4 A;  5GON B;  4FPP A;  4IIJ B;  2B9Z A;  2OT5 A;  3DC6 A;  4I07 A;  1NZ6 A;  1VQP V;  2RMK B;  2BSK B;  2LP7 A;  3ZHQ A;  4OX9 B;  3T4Z A;  1G1X B;  3N4C A;  1S3J A;  2YJB A;  5J2T B;  3OF9 A;  3TK1 A;  4AXL A;  1AU4 A;  4P6E A;  1EWL A;  1LUW A;  3Q4H A;  1TVK B;  4MSW C;  1K97 A;  3AG3 C;  4WUR A;  4OEL A;  3L73 H;  5IDJ A;  3SYC A;  2Z84 A;  1R3L C;  3CCM V;  5L3G A;  1VEW A;  5GTI Z;  4O2B A;  1IXB A;  4Q8H A;  4MVQ A;  2DCA A;  1ZAU A;  3CX5 F;  2FE8 A;  4JZG A;  3B77 A;  3D3I A;  4YJ2 A;  4OPA A;  1ATK A;  1O9G A;  3KSE A;  1VIB A;  3Q4H B;  1B6Q A;  2ZNJ A;  1ZL8 A;  3OT7 A;  2KG7 B;  4AXM A;  3JCZ A;  4DR5 B;  1GO3 F;  5KAI Z;  5J94 A;  3LFY A;  1IBK O;  4WBN B;  2OCC B;  2OTL V;  4D8E A;  4W5B A;  1D2D A;  5CA1 B;  1F2B A;  4LF9 B;  2AHZ A;  1VQ8 V;  1PNL A;  1IWD A;  3OQC A;  2HJF C;  1KFX L;  1YDX A;  2HP8 A;  1PM9 A;  2LFR A;  1MSW D;  2CK3 G;  4DV7 O;  3T1H B;  2G7Y A;  2Z3Y A;  1YIJ V;  1QHT A;  2G8E A;  4NYK A;  5KA5 A;  5LA6 A;  5KLV H;  1GCB A;  2CDY A;  3SPJ A;  2UUA O;  1VQ6 V;  2EIK C;  1WNS A;  1YTF D;  5CHV A;  3OGC C;  1IBM B;  1VF6 A;  1P7G A;  1Q90 D;  4CS3 A;  2J7Q C;  2L6L A;  2QWP B;  4CH5 A;  4P16 A;  4YIO A;  4FZ1 A;  4JZ2 A;  5L3B A;  5B1B B;  3ICX A;  3SR2 C;  5LMU B;  5EZY B;  2YIB D;  3RFR A;  3MHH C;  4OW0 A;  2K9P A;  3HB3 B;  1B04 A;  5BZB A;  1B3Q A;  4R8C A;  4D7S A;  1H2G A;  3BVO A;  4MSX A;  1PNK A;  1QXP A;  1YHQ V;  4FIP C;  3ZHR A;  5BMV A;  4U3J A;  5FNV A;  4MZS A;  4FFB B;  3E22 B;  1N34 B;  5LMU O;  1MA1 A;  4A5U A;  5LP6 C;  4J9Z B;  2CIO A;  4IYI A;  1ROP A;  4HXD B;  4DR4 B;  5EYP A;  1XNR O;  3QO7 A;  4X8A A;  5EZS A;  3IGA C;  1PPP A;  4DUZ O;  4B3R B;  2ZQM A;  2B5U A;  1XEQ A;  3OFN G;  3AG1 B;  1ENV A;  4PA4 A;  3PW3 A;  1N34 O;  4O4I A;  1NH2 D;  5LGU A;  1YI2 V;  5EIB C;  4KLB A;  4BS6 A;  4I0X A;  5LOV B;  2BTQ B;  1R73 A;  1FH0 A;  4BR6 A;  3CCL V;  2FB5 A;  3CJH B;  2A7W A;  2DW4 A;  5E6J A;  1CJL A;  1R6N A;  5BR8 O;  4KP4 A;  3BWK A;  2QWO B;  3IFU A;  4QNH B;  4QH6 A;  5JVD B;  2PF4 E;  3JAK A;  1U96 A;  4LWS B;  3ZRS A;  4GLX A;  4EB6 B;  1NQC A;  1AEC A;  2AYN A;  3CRR A;  5DN6 G;  2QEX V;  1QVG U;  1J5E O;  2B1I A;  5KO3 A;  2Y69 C;  3F5T A;  1T5E A;  2ITD C;  2DC7 A;  2GDS A;  3CRM A;  4TSF G;  2XAF A;  5IYZ A;  5LL6 Y;  1KU9 A;  3CCV V;  4UCU A;  2EUL A;  1WA8 A;  1VF5 B;  1NVP D;  4ZI7 B;  1AIL A;  3OUF A;  4DV6 B;  2ZR3 A;  4GX0 A;  4ZKI A;  2CE4 A;  4F6E A;  2RQ6 A;  4O4J B;  3JYC A;  5KMG A;  2FML A;  4MT8 A;  3MTV A;  2EZP A;  3AI8 A;  4DW1 A;  3VQY A;  3RNV A;  2GUZ A;  4I9W A;  1GN6 A;  3OEE G;  1XBL A;  1Y67 A;  1E1Q G;  3B40 A;  2UXD B;  5CHT A;  4J80 A;  2QTO A;  2ZIO A;  4BW9 A;  1CPJ A;  2QKC A;  2RJZ A;  1CXZ B;  1KP2 A;  4G54 A;  3HHA A;  4FZ0 A;  4JI5 O;  5IY5 B;  5IJ0 B;  4GT1 A;  2JGU A;  5CA0 B;  2YXY A;  3HD3 A;  3WG7 B;  3H1J H;  4X6J A;  3FB6 C;  1SS3 A;  2UXD O;  3W7X A;  1MHW A;  2XU4 A;  1R6K A;  3PHU A;  4WFB V;  4JI5 B;  2P7T C;  4X6H A;  4OPH A;  5CA0 A;  3W7U A;  3KKU A;  4M0W A;  4BOQ A;  3QG5 A;  1AB3 A;  1L0N H;  3BOW A;  3JAS B;  3OF8 A;  1BQI A;  4ZIB A;  3ZX6 A;  2G6D A;  3I3T A;  3TXQ A;  3FX7 A;  2Q6A A;  4EEQ A;  3CYO A;  4OVZ B;  2QDO A;  3NHE A;  2CTW A;  1NT2 B;  3LDC A;  3F75 A;  3RW0 A;  2AVW A;  1N0N A;  1IBL O;  1PXV A;  3CBJ A;  2PUS A;  1SA0 B;  3D36 C;  3E8B A;  3IC9 A;  3ZCC A;  3PSE A;  2WPD G;  3W30 A;  1R1B A;  5IYB O;  1HWY A;  5IT9 N;  4LP8 A;  3UO2 A;  3N2G A;  1VQ7 V;  4L87 A;  1Y6X A;  5JWP A;  2ARY A;  1FS0 G;  1N0J A;  5H5N A;  1WP8 A;  1QNM A;  2JJ2 G;  4IL6 Z;  1YIT V;  4XDJ A;  4HAM A;  3UO3 A;  2EIJ C;  2EJR A;  3H1I H;  2WA4 A;  1L0L H;  2DN9 A;  3B79 A;  2Z5U A;  3ZRW B;  4LF4 O;  4NTW A;  1AR5 A;  4LF7 O;  1SQX H;  1US6 A;  4DMX A;  3L74 H;  4UXN A;  1KEC A;  1AYW A;  2YJ9 A;  3G67 A;  3FAV B;  1XMQ O;  1TVK A;  4ZUX U;  1BHB A;  5CBG A;  1H2L A;  4XZX A;  5D5Q A;  2YJ2 A;  3V6C A;  1N33 B;  4IGG A;  1Q6H A;  4IP3 A;  4J9Y B;  1P49 A;  2WAM A;  2R9I A;  5BXZ A;  2ZD9 A;  3ABK B;  1U9V A;  5C8Y A;  2ZE8 A;  2L35 A;  1DF4 A;  1X59 A;  3D3Q A;  1IBK B;  4LH6 A;  3DF0 A;  1YT7 A;  1I08 A;  3RYF A;  3APQ A;  1ZL8 B;  1YXB A;  2KG7 A;  4RNA A;  2GHY A;  4J7Z A;  1S72 V;  2QJ1 A;  1M57 B;  1NTZ H;  3SJB C;  3RVV A;  2GSM B;  4K35 A;  5C8Y B;  1HDJ A;  4BWA A;  5GW7 A;  1N32 O;  4I55 B;  5DEC A;  1Q7Y W;  4PA3 A;  3CD6 V;  4Q6G A;  3RT3 C;  4MVR A;  4WFE A;  5FPR A;  2JEX A;  4DR4 O;  4FM1 A;  2X6A A;  1MEG A;  4YYV A;  3LNN A;  1BGO A;  1QR9 A;  3K57 A;  2PI5 A;  1NJI W;  4FK5 C;  2UUC O;  1HNW O;  4YYU A;  3ZMS A;  4EFE A;  2P6J A;  1N36 B;  5IJ9 B;  3UQ8 A;  1H2M A;  4O4L B;  1MNG A;  4GZR B;  2MK3 A;  3U10 A;  4BIZ A;  2FUD A;  4K7C A;  5B66 Z;  1QLE B;  3T1Y B;  4H13 B;  2EIM C;  5DM6 V;  3CBK A;  1NVP B;  1TUB B;  4AQY O;  3G71 V;  1NPZ A;  2ODM A;  3FD9 A;  1F2A A;  2CUG A;  2JS5 A;  3E8F A;  3QO5 A;  3G80 A;  2PY5 A;  3FB8 C;  1Q6I A;  4LF5 B;  1KUQ A;  1FXH A;  1OV9 A;  1WPX A;  4P9O A;  2E03 A;  3KWB X;  2JDI G;  2F23 A;  7PCK A;  3JAL A;  1GH6 A;  3FFQ A;  4LR3 A;  4FLT A;  2WWW A;  2Q5Z A;  2YUA A;  4X20 A;  4JI8 O;  1WJZ A;  5EYP B;  1EF7 A;  2Y6E A;  3ABL C;  2XOK G;  3CRA A;  1PV0 A;  4JI2 O;  2CH7 B;  1KKC A;  1E79 G;  2A0L A;  5B3S C;  4FIP A;  3P3N A;  1SER A;  4YIP A;  2UUB O;  1MG1 A;  1HNZ O;  1NTM H;  4XDL A;  3R65 A;  2PYJ A;  3OE7 G;  5JJJ B;  5EC2 C;  5KHJ A;  4YV8 A;  1K3B B;  2FTK A;  1S76 D;  1VAR A;  4NVP A;  1BCC H;  3CC7 V;  2A79 B;  3K24 A;  1Y74 A;  2QKA A;  2CH7 A;  2H3O A;  3K79 A;  5C93 A;  4PI3 A;  2FL4 A;  3F5V A;  4TWK A;  3IFX A;  3K5N A;  4WFH A;  2Y48 A;  3MDS A;  2DJV A;  4LWS A;  2F7D A;  5ITZ B;  4O4H A;  3TMP A;  3UT5 B;  3AK1 A;  3ZN0 A;  2LGW A;  5L3D A;  4PA9 A;  1JMK C;  3J81 N;  3RYI B;  2DYS C;  1H8E G;  1FKA O;  4P2Z A;  3BAA A;  4B3T B;  4YJ3 A;  1NKD A;  4GX2 A;  2PBH A;  4BIO A;  4DV4 O;  3HKB B;  2R9C A;  3MP2 A;  2PTM A;  4GUN A;  4CDD B;  2AGA A;  1PVJ A;  3UT5 A;  3CP1 A;  4X6I A;  4BAY A;  2O57 A;  1ZCM A;  2YJ8 A;  3M99 B;  3B8M A;  3P30 A;  4LNU A;  2LJ2 A;  1GM7 A;  3RN4 A;  3WXF A;  4LFC B;  4UCV A;  2E00 A;  5H6R A;  4DUY O;  4D8B A;  1JJ2 U;  2Q7E A;  3QO8 A;  1HW7 A;  3HKB A;  1FD9 A;  2HHN A;  4B3S O;  4DR7 O;  1SET A;  2JJ1 G;  3MJ5 A;  4LF6 B;  5CVO B;  4MS2 A;  3HKC A;  5IY5 C;  4QJF B;  1Q43 A;  4LH7 A;  2OTJ V;  1A6R A;  4XDK A;  4X1I B;  3RYC B;  1H2K A;  2EX3 A;  5FL7 G;  4YYQ A;  3ASO B;  1CV8 A;  3ZMT A;  2ADP A;  4ZOL A;  4D8I A;  5K1P A;  4F4L A;  4DR3 B;  3AG7 A;  5CBH A;  1QBZ A;  4JI0 B;  3ZMZ A;  3HKC B;  4DV3 O;  2DZY A;  5EIB D;  3TET A;  4HNA B;  3SYP A;  4MW3 A;  1DLB A;  3RYC A;  3NXS A;  4JI7 O;  4QBB A;  1POP A;  4NXM B;  4DR3 O;  1BMF G;  4RKX A;  4XUI A;  3JAS A;  4TUY B;  3VOU A;  3ZJZ A;  4FLV A;  4CH6 A;  2IU0 A;  1DF5 A;  2V7Q G;  4X1Y B;  1IX9 A;  1EN5 A;  2XHB A;  5HFL A;  4WFA V;  3PHX A;  3AG4 C;  2OCC C;  4DRX A;  3UCS C;  3GWO A;  4NXM O;  2DYR C;  3WXE A;  3N2G B;  2ETN A;  3CCU V;  3CCS V;  5JJN B;  4UUJ C;  2G38 A;  2BU3 A;  3CE2 A;  4X1Y A;  1TGO A;  3PRP A;  2Q9L A;  3HKD B;  4YY3 B;  1Q8I A;  1ZX3 A;  5E1A C;  4DRX B;  1LUV A;  1KFU L;  4CDE B;  1GKF A;  3AG1 C;  2WSS G;  2ZDI A;  3ZED A;  3OIS A;  1AJP A;  1TA8 A;  1EWO A;  4FMT A;  1OCC B;  3T4D A;  2R72 A;  4JI3 B;  2WBF X;  3BCN A;  4JYB A;  3W7T A;  2ZE5 A;  2WA3 A;  4UFZ A;  3K5M A;  4MVZ A;  2AYO A;  3OEH G;  2QKS A;  3DSQ A;  4I04 A;  3STL C;  2E02 A;  4B08 A;  2EIN B;  1JA8 A;  4MVU A;  1XNR B;  1MIR A;  3H6S A;  2OUL A;  4JI1 O;  4I9Q A;  2YJC A;  4G28 B;  1SRY A;  3APO A;  3JD0 A;  3K9M A;  1I5Y A;  3QTC A;  5H6Q A;  1MEM A;  1OCO B;  3D36 A;  2EIL B;  1H8H G;  2JK5 C;  2OWO A;  3TJT A;  4Q20 A;  4NXN O;  4X66 B;  2OP3 A;  2F66 C;  2W6J G;  4CC6 A;  4CZZ A;  2QE7 G;  4I4T B;  4X88 A;  3H7D A;  3ETG A;  3KWZ A;  3B4S A;  1NR1 A;  1XHZ A;  1H38 A;  1QQC A;  2XT9 A;  1HUC B;  3JCU Z;  2P22 C;  4OGQ B;  3JAT B;  5E79 Z;  1KC8 W;  5F02 A;  3H1H H;  2HD5 A;  4Z2W A;  2F4V B;  1M93 A;  4I4T A;  2UUB B;  3CEI A;  3I5D A;  4PV1 B;  3HHI A;  4JI6 O;  3LDD A;  3OGI B;  5LGN A;  1U9W A;  1Z2G A;  1WN7 A;  2YI8 A;  3JAT A;  2EIJ B;  1S5J A;  2R9O A;  1JQP A;  1Y66 A;  1ZSP A;  2F95 B;  1IVS A;  1PBH A;  1KQS U;  5J9P C;  2PI4 A;  1YK7 A;  3W7S A;  4X65 O;  1K33 A;  4U3F H;  4GKK B;  1AR4 A;  3KW9 A;  2WLI A;  3EFF K;  1K3E A;  1NTK H;  1SQG A;  5LYJ B;  4H0L B;  1UPG A;  3QF7 A;  1Q86 W;  2UZJ A;  1S77 D;  1PNM A;  1FXV A;  1GN2 A;  3JAL B;  3S3W A;  4PEL A;  2KSD A;  2HG5 C;  1BP4 A;  2O6X A;  4PI0 A;  3K3W A;  3VQV A;  3JAR B;  4B3T O;  5J2U A;  3ZBH A;  1MAB G;  1Y4M A;  4JI2 B;  5KX5 A;  5KHG A;  1Y08 A;  1SP4 B;  1AYV A;  1BHA A;  4CBC A;  2WLL B;  5B1N A;  4YYS A;  2Z0A A;  4X65 B;  2AU1 A;  1VQM V;  1NR7 A;  2DQ0 A;  1DEU A;  3E1Z B;  1V55 B;  1D5N A;  2WLI B;  4DV5 O;  3GB7 C;  3SGI A;  2ZT9 B;  5LYJ A;  5B3S B;  2UXC O;  3LDE A;  1O9H A;  4JPR A;  4RQE A;  4JYC A;  1KXR A;  1F7Y A;  1I94 B;  2QR4 A;  3H8C A;  1QLE C;  3B2E E;  4O2A A;  3P5V A;  4KUM A;  1XOU A;  3CME V;  3DTU B;  3E35 A;  3IAY A;  3JD4 A;  1CVZ A;  1PIP A;  2BSK A;  4L8J A;  2BTW A;  1Y74 B;  4DV2 B;  3ETD A;  1O0E A;  5FNV B;  2Q0O C;  5IWA B;  4W4L A;  3QSD A;  4CC5 A;  5J2T A;  2EIN C;  1JQ0 A;  2OZ2 A;  3AK2 A;  2ZM6 B;  3C3T A;  1VQ4 V;  4MVO A;  4Z1M G;  3BCC H;  5ITZ A;  4HYO A;  2JGD A;  1AR1 B;  2C0Y A;  3ASN C;  2D2C B;  1DK1 A;  2X0L A;  4QRX A;  2QTS A;  3SDL A;  3TXS A;  2BTW B;  1R3J C;  5EBW C;  1U9X A;  5B1A B;  1E1R G;  2CTP A;  4BIU A;  1QU7 A;  3SJA C;  3WU2 Z;  2X6C A;  4X64 B;  1TUE B;  4O4I B;  1RSO A;  1Y76 B;  1HNX O;  1PKX A;  2YIB A;  3C90 A;  1KHP A;  2NNU A;  2UU9 O;  3MHS C;  3FKS G;  2YC0 A;  2E76 B;  3MD0 A;  3JD1 A;  3ZUA A;  3KG2 A;  4E2L A;  3PT2 A;  3U0Z A;  1K34 A;  3GWK C;  4MTX A;  5AG2 A;  5CA1 A;  3D8C A;  4X64 O;  2E74 B;  4UV9 A;  4PDM A;  1AIM A;  3BA8 A;  2W0F C;  3CC2 V;  2YDE A;  3RGB A;  2DC8 A;  1JFF A;  2C2A A;  5LP6 A;  2VQF B;  4N8W A;  3S3Q A;  1FXK A;  5JQG B;  4X1I A;  2AW9 A;  4IYH A;  2QM4 A;  2IBI A;  4YXW G;  4MTF A;  4N23 A;  4PAD A;  1GRJ A;  4ZOL B;  1OCZ C;  1EWP A;  3A8T A;  5IE9 A;  1AP5 A;  1IUR A;  2FO5 A;  3X2Q B;  3K9S A;  1CPY A;  1MS6 A;  1V54 B;  4JI7 B;  4CZW A;  1JFF B;  2MW2 B;  1BE3 H;  1ARO P;  2YI9 A;  3AG2 B;  4HNA A;  4D7T A;  2UXB B;  1BQZ A;  4CS2 A;  4BPV A;  2HH5 A;  2W6I G;  4TV8 A;  5CVM A;  2DMX A;  4WA6 A;  2GUZ B;  2GV9 A;  4DR6 B;  2GTA A;  4RF1 A;  2B1G A;  3VQW A;  2ADQ B;  2AZ2 A;  3CRQ A;  3V6E A;  2Q68 A;  4HZ3 A;  3SYA A;  2E75 B;  2IH3 C;  4DUY B;  3TNX A;  3B8N A;  2XAG A;  4GX1 A;  4JI4 B;  4B3S B;  2IH1 C;  4MTG A;  3CCR V;  1NH2 B;  1K5S A;  2DE0 X;  1FYJ A;  4LF8 B;  5JCO C;  3N2K B;  1CSB B;  1F4M A;  3E22 A;  2XU1 A;  1N4C A;  4RUF A;  4FM2 A;  3CCQ V;  4JTD B;  2XAJ A;  1URF A;  1VQN V;  1GN3 A;  5CA3 A;  1XMQ B;  2YSU B;  2DCD A;  2XTA A;  2XAH A;  4UVB A;  1GLO A;  3T1Y O;  5JH3 A;  1Q6U A;  1XUQ A;  3ERV A;  1M9N A;  3ZMV A;  5CN0 A;  3WB1 A;  2QGN A;  2FYE A;  2H7J A;  3SYO A;  1AYU A;  4AI8 A;  1MDW A;  1W0J G;  5LOV A;  1AJN A;  1OCR C;  4RWU A;  2HHH O;  4TQD A;  1PPD A;  2GFO A;  3WFV A;  3O9O A;  2DYS B;  1FFT B;  3CCE V;  4FFK A;  1WB7 A;  1FAF A;  1V9P A;  4NTX A;  1Q82 W;  2UUA B;  1YVW A;  3TGU H;  4J41 A;  5CVN B;  3E9S A;  4I7Z B;  3LSQ A;  5K1X A;  1UJW B;  1AJQ A;  4KHP B;  1UFI A;  3BPZ A;  2UXX A;  2ACT A;  3JAK B;  3O65 A;  2HR3 A;  3ASO C;  5FLX N;  1YEW A;  2JEU A;  2B1M A;  4QRV A;  2LGQ A;  1B06 A;  2Q0A A;  3BRC A;  3CSX A;  4X9Q A;  2P90 A;  1VP7 A;  1V54 C;  3E89 A;  4FM0 A;  2IBZ H;  3A0H Z;  3ZRW A;  4D6T H;  2JQF R;  1NQT A;  1N33 O;  3ABM B;  2AXT Z;  5JZE A;  3JD2 A;  1WA8 B;  1ZTE A;  2QA4 V;  2P86 A;  4MVM A;  4DV7 B;  3T1H O;  4DO2 A;  2N74 A;  2PYL A;  2N05 A;  4IIJ A;  3T1C A;  2CAZ C;  4I50 A;  5CB4 B;  3DC5 A;  4JI3 O;  1M56 B;  2ZXW B;  3A0B Z;  1PAD A;  1AI5 A;  4CDC B;  5DED A;  4DV5 B;  1SZX A;  2BOC C;  1W2B U;  1XI1 A;  3RYH B;  4TT3 G;  3LNM B;  2DQ3 A;  4F6R B;  1EZJ A;  3FB7 C;  3PHW A;  4RY2 A;  1I0H A;  3MAQ A;  1PPJ H;  5IYC O;  5CB4 A;  3K59 A;  3IEJ A;  1XNQ O;  4PDR A;  2ATK C;  2R9N A;  2XND G;  1NB3 A;  1YK8 A;  4O2B B;  4FK5 A;  3THO A;  4EKW A;  2R9A A;  4PI2 A;  1GK9 A;  4YJ2 B;  1NBM G;  1PP9 H;  4QE7 A;  1HNW B;  1EN4 A;  5LGT A;  1ZLZ A;  4F6R A;  1P84 F;  1U97 A;  1RFY A;  1EM1 A;  3K06 A;  4DR1 O;  3BY6 A;  2Y5B A;  4CH4 A;  1BGY H;  1PCI A;  2CTR A;  2H8P C;  4CDF B;  3UM7 A;  1G6U A;  3SJQ C;  4K8X A;  1FFX A;  1YZB A;  5IJ9 A;  4OVZ A;  1SQQ H;  1PE6 A;  3ABL B;  1ICF A;  2WLL A;  5B1O A;  1QDQ A;  2M7W A;  2X7R B;  4LFA B;  4OEM A;  1Q81 W;  3K5L A;  2UU9 B;  2B1N A;  4DXW A;  2YIA A;  1L1F A;  1BS3 A;  4R7C A;  1YF2 A;  3QVN A;  3ZRV A;  2BOB C;  4JV5 B;  2R9R B;  3BY4 A;  3IMA A;  1GM8 A;  5LA6 B;  2P5O A;  2OIG A;  2NQI A;  4DV2 O;  1NI8 A;  3CH3 X;  4JI8 B;  1HR0 B;  1W59 A;  2YS8 A;  4JTA B;  2XU3 A;  2FYU H;  2Y4T A;  5A9G A;  2ZM6 O;  3K5O A;  3CS5 A;  2ZNI A;  4LFA O;  4J42 A;  4DYL A;  1LNQ A;  3L71 H;  2VS0 A;  2YXH A;  2D3O W;  2VQF O;  2AS8 A;  4YHH B;  4WCE V;  3G6E V;  3EXA A;  2JIZ G;  5JA7 A;  2ZCE A;  3JSL A;  1M56 C;  4AIL C;  4MZO A;  2VRZ A;  1J5E B;  1GM9 A;  2P4K A;  4ZTB A;  5EBL C;  2GTS A;  2DCC A;  3TRK A;  3OTF A;  1HNX B;  3K04 A;  1XDC A;  2KB1 A;  3LUT B;  1CTE A;  4LFC O;  4U3J B;  2Y69 B;  4DV6 O;  3OR6 C;  1SQV H;  4A5U B;  4YHH O;  2IJI A;  2Q7G A;  2J7Q A;  3ZHV A;  1DF0 A;  3N3K A;  1THZ A;  2DJG B;  3N27 A;  3PN1 A;  1PPN A;  3STZ C;  1MSD A;  4C7U A;  5JJE B;  3NR7 A;  4UCR A;  1AU2 A;  2WLJ A;  1ORQ C;  1IZ3 A;  1MZE A;  4ABM A;  4EFB A;  2BE3 A;  3E8G A;  4ZBM A;  1SQP H;  4JI4 O;  4G2K A;  3EVK A;  1K8A W;  2BTQ A;  4MI7 A;  4U7N A;  1JR9 A;  4R50 A;  4FLY A;  1S5H C;  4K3A A;  4DV0 B;  2CB5 A;  5KA6 A;  4BOP A;  4WBN A;  1WAZ A;  1YSC A;  5KAF Z;  4N4Z A;  4KXR A;  5PAD A;  2P0R A;  1PPO A;  4TOI A;  5L3E A;  3ZS8 C;  1AI7 A;  5JVD A;  2YID A;  5CBF A;  1N8R W;  3CCJ V;  1BY8 A;  2A06 H;  2HVK C;  3S3R A;  4EB6 A;  3RVW A;  4YVA A;  2GHU A;  3BHP A;  1U9Q X;  1I7F A;  4JYA B;  5KUM A;  1S4V A;  2LO1 A;  4NR1 A;  3U8E A;  2P06 A;  4DV0 O;  3C3S A;  4G27 B;  4MW8 A;  4TV8 B;  1J95 A;  5KHI A;  5B1B C;  3WB0 A;  3MOR A;  1YTF B;  3ABT A;  4NXN B;  3P5W A;  2QSA A;  3P5X A;  4GKJ O;  2LW1 A;  1JCH A;  2E5L O;  3K0G A;  1I5X A;  1KP3 A;  2BDL A;  4TV9 A;  1X4T A;  3DGE A;  1SZT A;  1EFR G;  4I5S A;  4LF8 O;  4WFF A;  3OAA G;  1CEZ A;  4DV3 B;  1F2C A;  4AHC A;  3H8B A;  4JYA O;  4MVS A;  2Q67 A;  4FJC A;  4BOZ A;  1YVB A;  3K03 A;  1F29 A;  1DGS A;  1XIL A;  2ITC C;  2E3C A;  4B7E A;  4WF9 V;  2HLD G;  4TV9 B;  1KHQ A;  4LF4 B;  2BDZ A;  3A2F A;  3ZMU A;  3RBZ A;  4YYW A;  2F93 B;  1BL8 A;  2YEV A;  1KB9 F;  4JI6 B;  3HPL C;  3EHB B;  1Q6K A;  3L72 H;  3MTN A;  1XL4 A;  3OMN B;  3ABK C;  1N32 B;  2OYQ A;  5BMV B;  3OVX A;  2OCH A;  1JVM A;  2ZXW C;  3JSN A;  3R66 A;  4P9P A;  2AZ0 A;  4X1K B;  3AEI A;  4DR2 O;  3AG4 B;  1WPB A;  4X89 A;  2UXN A;  3C0R A;  2X6B A;  3I56 V;  4CH3 A;  2YEV B;  2VHF A;  3I06 A;  4PP2 E;  2UUC B;  3BBA A;  3KX1 A;  2JQG R;  2BTO A;  2R70 A;  2DCB A;  2R6N A;  1VF7 A;  2KQX A;  3WG7 C;  2FQ9 A;  2YIC A;  5FPW A;  4DR2 B;  4NTY A;  2QWR B;  1RM1 B;  3CPW U;  1A32 A;  1OZ0 A;  3W31 A;  1KD1 W;  3CWB H;  2RDC A;  4GX5 A;  1STF E;  1Z5V A;  5LHI A;  5EZQ A;  4YJ3 B;  1YJ9 V;  1S0V A;  4FLZ A;  4LF5 O;  2XUM A;  1M90 W;  4P6G A;  1BT8 A;  2F4V O;  4NB5 A;  1SC5 B;  3KCY A;  4UB8 Z;  2ZKO A;  4REZ A;  3WXG A;  2HXZ A;  3JAW B;  1NS1 A;  3F7Y C;  5EBM C;  1PL4 A;  4DR5 O;  4J11 A;  4KL1 A;  1AP6 A;  4I50 B;  3C9E A;  4IUM A;  1WLE A;  4BOU A;  2ARH A;  3SYQ A;  2Q73 A;  2G8J A;  4TQF A;  2ZE6 A;  1MMM A;  4K0K O;  3ZIA G;  4X66 O;  3PBH A;  4U7O A;  4PDL A;  1X9Y A;  2W0X A;  2Q8V A;  4ZI7 A;  3RYH A;  1IXM A;  4GKK O;  5LXT A;  5KMG B;  3RVZ A;  4B3R O;  4PP1 A;  3FYE B;  3M8A A;  5EF4 A;  1Q5O A;  1ZUQ A;  4FLU A;  3CXC U;  4FJC C;  1PL0 A;  1IBM O;  5LXT B;  5IJ0 A;  1ME4 A;  4IHJ B;  1QLN A;  1OJH A;  3LXS A;  1SF9 A;  2DYR B;  1XQ8 A;  2WLH A;  1YAL A;  2UXC B;  3UKM A;  4FLW A;  2VWJ A;  3HKE A;  3CMA V;  1VSN A;  4PA7 A;  3MHH A;  2HFE C;  3U11 A;  4JAU A;  4TUY A;  5LBQ A;  1K5Q A;  2FRA A;  2WLK A;  1ITO A;  1FFX B;  1QCE A;  2Y0I A;  4DK1 A;  3IHP A;  1P4R A;  5LMN B;  3QT4 A;  2EBO A;  4GYC B;  3RVY A;  4PJ0 Z;  4UCT A;  2ILM A;  1XRE A;  4NKG B;  3O0U A;  1RM1 C;  2QWN B;  4ZHQ A;  5IWA O;  3GCB A;  2RN9 A;  2LFS A;  3BFR A;  4R6Z A;  3USV A;  1LR1 A;  4UV8 A;  3WB2 A;  4UB6 Z;  3OM3 B;  1JX9 A;  1VQK V;  2CGO A;  2NN4 A;  2XAS A;  5L3F A;  1XMO B;  4O4L A;  5HFM A;  3JAM N;  1S5L Z;  4YYR A;  5BY1 A;  3OUS A;  1D5A A;  1CP9 A;  3VQX A;  2VHS A;  3K08 A;  1WP7 A;  1H2S B;  1TUB A;  4J7K A;  1NLJ A;  3BAB A;  2JRI A;  4DMY A;  4WFG A;  3I55 V;  1TAE A;  5KX5 B;  4DR1 B;  2Y0P A;  1GN4 A;  1I94 O;  3CRC A;  1OCR B;  2QWQ B;  4HBN A;  4H33 A;  1ZIV A;  1EN6 A;  2JS3 A;  1EBO A;  4DV4 B;  3G4S V;  4LC1 A;  4QPJ A;  1IBL B;  4JI0 O;  1IDS A;  4XBF A;  4MTO A;  3TCU A;  1AI6 A;  3N3G A;  3BEH A;  4J10 A;  4O2A B;  3FAV A;  2P67 A;  3S3X A;  1P7B A;  1JOY A;  2WLN A;  4H44 B;  3OTO B;  3H89 A;  1V55 C;  1VMG A;  1R3K C;  3P32 A;  4PD4 F;  1HP8 A;  4DR7 B;  2LW7 A;  4LF6 O;  2F1G A;  2N04 A;  3CHX A;  3HR0 A;  1VQL V;  2F1M A;  4JAA A;  3J7A U;  1NB5 A;  1FPO A;  4RAI A;  2CTQ A;  4W4K A;  5GON A;  1YJW V;  3KZI Z;  4JF3 A;  4RO2 A;  2NQD B;  2EIM B;  2VWK A;  4BW5 A;  1SKV A;  3RYF B;  3T2M A;  4QE9 A;  3OTO O;  5FPO A;  4W4U A;  4J7J A;  3H1K H;  4RF0 A;  5H9C A;  4DR6 O;  3D6S A;  5GTH Z;  1GAX A;  3ETQ A;  1KKD A;  3K0D A;  1FXK C;  3SPH A;  1Q3E A;  1M57 C;  4OX9 O;  4FLX A;  3ASN B;  1CS8 A;  4I55 A;  4UCS A;  2A9H A;  3X2Q C;  2IM9 A;  1DTO A;  3LSS A;  1VQ9 V;  1SQB H;  2WLM A;  2EIK B;  4GKJ B;  1KBH A;  3E86 A;  2XU5 A;  1U5I A;  3AK3 A;  3ZHT A;  5TIS Z;  5A24 A;  3ABU A;  1QR8 A;  3BB7 A;  3PNR A;  1CQD A;  2OIE A;  1M4U A;  1GMY A;  2HKO A;  2LQT A;  5LHH A;  4B7K A;  1G8M A;  3E83 A;  3H01 A;  1M6D A;  2DC9 A;  4QRG A;  1VQO V;  3H1L H;  4N79 A;  1YJN V;  3SPC A;  1XKG A;  3IJ4 A;  1FXK B;  2EZO A;  3L75 H;  2UXB O;  4PT5 A;  4OXS A;  3P3P A;  4LNU B;  4PHZ A;  2ATO A;  2NQA A;  3HWN A;  3K9A A;  2FTD A;  4KFM A;  5EK0 A;  4QIW F;  4LFB O;  3JAR A;  4RQF A;  5J2U B;  1DKI A;  2HHH B;  5F2V O;  1GEC E;  4YY3 O;  2QM7 A;  3ETE A;  2FRQ A;  1VF6 C;  3W7W A;  2DC6 A;  2R9M A;  5EGW A;  2A3Q A;  1BSM A;  5KHK A;  2DWE C;  2ZIN A;  1THE A;  2GBO A;  4ASU G;  1XNQ B;  4KHP O;  4QPK A;  4AQY B;  3BA9 A;  3JD3 A;  3J80 N;  3P5U A;  1OCO C;  4JAS A;  4LFB B;  3PDF A;  2HWK A;  2ZIM A;  3IV2 A;  4X1K A;  4BOS A;  4X20 B;  1JPX A;  5A2Q N;  1ZWI C;  3F5W C;  1QOL A;  4K0K B;  2DWD C;  3A0R A;  1FJG O;  1NL6 A;  2P7U A;  5K16 A;  4JAV A;  1RPR A; 
#chains in the Genus database with same CATH homology
 4A5U B;  4YHH O;  1X59 A;  1IBM O;  1HNZ O;  5LMU O;  1FYJ A;  4A5U A;  2J7Q A;  4JI7 O;  3PHW A;  3R66 A;  4RNA A;  4DR3 O;  4WUR A;  4RKX A;  3OTO O;  4HXD B;  4MM3 B;  1XNQ O;  1XNR O;  4DR2 O;  1DK1 A;  2Z84 A;  3ZNH A;  2UXD O;  3C0R A;  3SDL A;  5EZS A;  2VQE O;  2BTW B;  4RF0 A;  4DUZ O;  4DR6 O;  3T1Y O;  3PHU A;  1XEQ A;  4LF9 O;  3BBA A;  2FE8 A;  4OPA A;  1HNX O;  4JI4 O;  1N32 O;  3PHX A;  4OPH A;  4JV5 O;  4M0W A;  1N34 O;  4OX9 O;  2DJV A;  4BOQ A;  1AB3 A;  2UU9 O;  4DR1 O;  4MI7 A;  3TMP A;  4JI6 O;  5IWA O;  3RT3 C;  4NXM O;  4DR4 O;  1IBK O;  2JTC A;  4BOP A;  2HHH O;  3PRM A;  3J81 N;  4D8E A;  1FKA O;  1YZB A;  1A32 A;  2BU3 A;  3W31 A;  3PT2 A;  1D2D A;  3BB7 A;  4OVZ B;  5E6J A;  4X62 O;  5BR8 O;  5LMN O;  3PRP A;  4OVZ A;  3JAM N;  2UUC O;  1HR0 O;  1HNW O;  3IFU A;  5EZQ A;  4R3D A;  4X64 O;  5BY1 A;  4X65 O;  4DV4 O;  3E9S A;  3OQC A;  3MP2 A;  1IBL O;  4LF5 O;  3W30 A;  2AGA A;  1PVJ A;  3O65 A;  2F4V O;  3PSE A;  1R1B A;  1UKF A;  5IT9 N;  4DV7 O;  5FLX N;  2UXB O;  4PT5 A;  4REZ A;  2UZJ A;  2ZKO A;  4DV0 O;  3BY4 A;  2JRI A;  4AQY O;  5H5N A;  1I94 O;  1NS1 A;  4B3T O;  4DV2 O;  1J5E O;  5KO3 A;  1XMO O;  4DR5 O;  4GKJ O;  4LFB O;  1R6T A;  2E5L O;  3F5T A;  2UUA O;  4DUY O;  1DKI A;  4IUM A;  4D8B A;  4YY3 O;  4BOU A;  1N33 O;  4B3M O;  2Z0A A;  2ZM6 O;  4B3S O;  4DR7 O;  5LL6 Y;  4LF4 O;  4K0K O;  4LFA O;  3MJ5 A;  4JI0 O;  4X66 O;  4LF8 O;  4DV1 O;  1KUQ A;  2J7Q C;  4DV5 O;  4LF7 O;  1AIL A;  5JZE A;  4P16 A;  4JYA O;  2UXC O;  3B21 A;  1N36 O;  2FKX A;  3T1H O;  2VQF O;  4BOZ A;  2N74 A;  4GKK O;  4KHP O;  3MTV A;  1XMQ O;  2DOS A;  4JI1 O;  4OW0 A;  1F7Y A;  3J80 N;  4B3R O;  3RNV A;  4D8I A;  4GUA A;  4RF1 A;  4XZX A;  2HWK A;  4JI8 O;  4ZTB A;  4BOS A;  3TRK A;  3M8A A;  4JI3 O;  5A2Q N;  4IP3 A;  2LW7 A;  1G1X B;  2BTW A;  4NXN O;  4LF6 O;  4JI2 O;  4LFC O;  3J7A U;  1FJG O;  4DV3 O;  5BXZ A;  4DV6 O;  4JI5 O;  2UUB O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...