2AGJH

Crystal structure of a glycosylated fab from an igm cryoglobulin with properties of a natural proteolytic antibody
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
226
structure length
226
Chain Sequence
EVTLKESGPTLVKPTQTLTLTCTFSGFSLTTTGEGVGWIRQPPGKALEFLAFIYWNDAKRYNPSLQSRLTITKDASKKQVVLTLTNLDPVDTATYYCARTSGWDIEFEYWGQGTLVTVSSGSASAPTLFPLVSCENSSPSSTVAVGCLAQDFLPDSITFSWKYKNNSDISSTRGFPSVLRGGKYAATSQVLLPSKDVMQGTDEHVVCKVQHPNGNKEKDVPLPVVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Yvo Fab, Light Chain
publication title Crystal structure of a glycosylated Fab from an IgM cryoglobulin with properties of a natural proteolytic antibody
pubmed doi rcsb
molecule tags Immune system
total genus 38
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2agjH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2agjH02
5IB5A 15C8L 4FS0A 4JPWH 5KOMC 5IIEA 4U7SA 5D72H 1JPGB 1G0YR 4ODWA 1YEJL 1KIUA 5HHMD 1G9NC 3QFDB 1ZVHA 2BDNL 2HVJA 1HNFA 1YA5A 1VPOL 2QQKL 4LSPL 1A1NA 3QNZA 4FQCH 3DETD 4RMVA 3KXFB 4ODSL 4Q2ZB 3BMWA 1RZKH 2XYCA 3RX7A 3WS3B 1OM3L 4FTVB 3HLAA 5SWZD 3RBSA 1FNGA 1J0IA 2UZYB 5CJOH 3PE9A 4UT7L 1A6TA 5GGVL 2NXZD 5FEBA 3O41B 3I6GB 3NA9L 2EYRB 4F33B 4GUPA 4FQLH 3ULUL 4NKDB 2BY1A 4RRPG 1MRCH 2R2EA 1AIFA 3GUTB 1WWBX 2ZNWA 5FUOH 3BQUD 3S3JA 2P5EB 3QFJB 3TCLB 5DMKB 1RI8A 4P4KA 1WFTA 3PNWB 5I1GL 2RJMA 2GEEA 4AEFA 5J9PB 4LSSH 5I74B 4CW1B 5IW3A 5LXGH 1MLBA 1AGBA 1G9ML 1HQRA 4HH8A 4M7LH 4UOW1 3RP1A 2GFBB 4PGZA 1G0DA 1R3KA 2YOCA 5HPMA 1UKQA 3DHJA 3K4DA 1BM3L 5CIPA 2DI9A 5E2WH 1P1ZA 3QULB 1MFCL 2BOCB 5KW9H 4P5KA 5IESL 1Z5LB 1TNNA 5LCVH 1T20A 4MMZC 3I84A 3A67H 3EJYD 4U2ZA 3MBXL 4H26A 3FB7B 1FVEA 1RUAH 4JREB 2XG4A 1TDQA 2ADFH 1SEQL 3GMPB 4ZUTB 4GO6B 3FRUB 1G1YA 2DQHH 4ODHL 2J8UB 4P46B 3FFDA 3HRZB 2ICWA 1J05B 5I1CL 4WUUE 3SCMA 2Q3AA 2ZSVB 1A64A 5T3ZH 1CDHA 1KACB 4HS6A 4N0FA 2MCPL 5IQ7H 3BIBX 1P7QD 4UU9B 5LAXA 3V6ZA 5DUPH 3IRPX 4F57L 4NQEA 3GMLB 3PWNA 1QO3B 3BP4A 4TQEH 3FB5B 3MV8A 4GBXB 3RI5F 4Z7OF 5KZCD 2VQTA 4NZDA 2HFGH 3T2NH 3TYFB 1VEOA 2VXSL 3SDAB 2CJUH 5E6ZA 3V6BR 4GRMA 5D1ZC 4JKWA 4GRLA 3QIUA 4M1CD 2G5BB 2P1YA 3KYAA 4Y5VB 3D2UA 3KJ6L 2FJHB 3TNNB 1LE9A 3QG7H 5I66A 3T0DA 1RK0B 2H26A 3S5LA 1U91A 5CCKH 3QCTL 3T1FB 4S2SB 5C3TA 2FATL 3PGCB 4QRPA 1RZJL 1TVBA 3GSNL 4YUEL 1OP5H 2FR4B 3ESVF 4LKCA 4Z78B 1C08A 1FO0L 1OARL 2YD4A 2UZIH 5C07E 1GGTA 1T22A 1I75A 3T2QA 2EXWD 2WMPA 1EHXA 5JDSB 3GJEA 5DJAB 4NKOA 4RGMB 2MHAB 5AAWA 4NT6A 4NGHL 1MFAL 1HXYB 1NEZB 3C08L 4KPHH 4X6CE 5K59F 1ERNA 5TQ2L 3SPVB 4G8GE 2F53E 3IFLL 4P2OD 5BS0A 4P49A 4JM4L 3W2DH 3T4AA 2ED7A 3ULUD 4FQXD 4UI2A 2HKFH 3EDJA 3UZEA 3FT4A 2VR4A 1OSPH 4ZTOH 3QDJE 2AJ3A 1VKXA 1A4JB 3CJJA 4WI2A 1CFNB 4D9RD 5L88L 4ONFL 1SBSL 1OTTC 3D18A 1TPXB 3AXLA 4I0PA 3MX0A 4JKLA 4MXQC 1JHKH 3UBXI 3Q6FA 4RAUB 2FZ3B 4NQXA 3B3IB 2XFXB 1N0XL 5DEZA 2D31B 43C9A 5C0AB 4JFOA 12E8H 3PL6B 3VXMD 5IG7A 4J12A 1ORQB 3RWIA 1FORH 1I3RB 1LMKA 4Z7VA 1T1XB 4JGJA 3MRLA 5I71B 1SEBA 1NCBH 5DRXA 3EYOA 5DD6A 4HIJB 4H5SB 3NCFB 1WBZA 1Q9OA 3GI9L 1INQA 4NJ9L 3FT3A 1JGVH 2IAMB 1CLCA 4MQ7B 2Q7YB 4DTGL 4K8RH 3PJSA 1JGUL 5GS1C 5F71A 2WIIA 4KQ4H 1U58A 2R9HC 2NLJA 4R90H 3V5KA 2R2BB 1NCWH 3C2SA 1QSZA 4NC1C 1J8HD 3PHQA 4CVZB 4DAGL 4K7FB 1MCWM 5B39B 4JFDA 1UACL 4WFEE 5ANMA 4MX7B 3AAZB 5EDXA 5EO0B 4XBEH 2EYTB 3HZVA 5TFSH 2VXQH 4MWFA 4OLYH 4WI7A 4OTXL 4I9WE 1MJ7H 5KVMC 1U8NA 1VACB 3NIFE 3CFJA 2B4CH 5CWSB 3OGCB 5JTWA 3RNKB 3TVMD 3KYKL 4APQD 4XH2B 5D8JL 3RY6A 4U1HB 4ZD3L 3RTQB 5KG9B 4KVNH 3SE3A 2AJZB 1NKRA 2NY3B 1H0DA 1NGXA 3HNVH 4R8WH 5MEQA 3BHBB 4DUWA 2YPVH 4MD5B 2XN9D 1N5AB 3TO2A 1JWUB 2D0GA 3CK0L 1NGZA 5EC1A 1U0QA 3PHSA 5J12B 5HI5D 3M45A 4PJGE 3MFGB 3LOWA 3VGAB 1S5IL 1UT9A 5J1AA 3TJEL 1YY8B 3C60D 2YXFA 4BSWB 3QXDA 5L2JA 4HIHB 4OLXL 4XNXH 4HWEH 1U36A 1EJ6A 4HIEA 1OQXA 3N1QC 4JM2A 1CQKA 2HLFD 1JGDB 3ZDYE 1V3LA 4LP4A 1J11A 5EU6B 2K1MA 1EHNA 1X5IA 1LE5A 1JI1A 3LB6C 4MYWB 1EDQA 2DKSA 4ISVA 1P9MA 5E4EC 3IFOA 5I73B 2DQTH 3O6LH 2CLRB 3LSOB 1ZK9A 1E6OH 3P0VH 4L9LC 3S35X 4L4TD 5EZIL 4Z7VF 3SDDB 2EH8L 5JW4N 3UTPE 3D48R 5I1IH 1NBQA 2DYPB 3TO4C 3QQNA 4XHJC 1HINH 5KBNC 5LGJA 4NUGL 3CGTA 4HHAB 1G9NL 5B38B 1YECH 1K5NA 3JTSB 4XVTH 1A9BB 1BIIB 3NPSC 4WENB 2KH2B 3EOTL 2YHGA 3KPSE 3RU8L 4H25B 1GGBL 3VG0H 4AYFA 1MWAA 1KCRL 1M7XA 3QJHB 4PG9A 1OAXH 1JCKA 3EAKA 5K9OA 2F54E 4OLEA 1MIEH 4HZLA 1EA9C 3LH2L 2I5YL 4KK9D 4PJAB 4X9IA 5MHSD 5DD0H 5F7KC 4WUUA 3IS1X 3CDGB 5EO1B 4WY7H 4EN3A 4NKMA 2W91A 3U4BL 3TIEB 1Z9LA 3WJJC 2UWEE 4PB0L 2XWBB 1XR8B 4JHBA 5IB4B 1PLGH 1Z6JT 3VXOA 5IMLB 1U95B 4KV5F 3U7WL 5K93A 5IKCB 1IGIH 2EC8A 3VGBA 2ZG1A 5E8OB 3MUGA 4OT1H 1OAZH 1HI6A 4KKBC 3VXQA 5BXFB 1VFBA 2NQCA 5GS2H 3Q1SH 3FB8A 4LEXH 4KI5D 2SEBB 4YHKL 4LSRH 4QRRE 3ET9F 1FGNH 3FMGL 1MCPH 1X44A 1LO3L 4LPYA 4N8CH 4B5EA 5JORA 3MLWL 3FN9A 3HC0B 3W0WD 5FYJE 4WI6A 1KN4L 1MJUH 2NY1C 4X5XA 4DJMA 5DS8B 4DKAA 3K8LA 1S9WA 4GKSA 3DGGB 2FH8A 4XWGH 4KJQC 3LHPL 5EBGA 2OCFD 1Q94A 5L7XH 3EYFA 4NO2A 3QI9C 4YEEA 4Y4KA 2X89A 5DK0A 5C07A 1J1XL 4MNQE 3VU2A 3C5ZC 2FLRT 1NFDE 2YKLH 1OP3H 4Z76A 1HEZB 3P0GB 4JM2F 1UA6H 2WQRA 4X6CA 4G8GA 4KRNA 5D6DA 4K7PH 5IFHH 2F53A 1A3RL 4KDVA 3VGGA 3MLZL 5E03A 2XTJB 4OI9A 1ZSDB 5CEXA 4YHZH 4O2CB 3TYGH 3EUUA 2J2ZA 3OR6B 2I25N 2J6EH 3QDJA 3BAEL 1PEWA 3GBMH 3Q3GA 4AH2B 5ENWA 3MREB 4U1MA 1RUML 1T5WA 2FB4L 1C5CH 1GSMA 1VB9A 2YWYA 4L3AA 5DRZB 5D93B 1QKZH 2HKFL 1DP0A 1CU4H 1UM6H 1MCEA 32C2A 5FYKH 4BSJA 3VFOB 2EDTA 4XVUD 3LEXA 1L0XA 5JIHA 3KLAB 1Q9LA 3GHEH 4X4XB 3DMMA 3UBXA 4JGMA 2ATKA 1EZVY 3BYTA 1DEDA 3WN5A 3VXSD 1I3GH 1G7MB 4AG4L 4OIBA 4X98B 3ORJA 4NBYB 1ZANH 1F6LL 1KTDB 2JK5B 4G8EA 3O4LE 3GIVA 3O45A 1A14L 4UIMA 2CUMA 1E4XL 4MNHB 3L5XH 1N64H 5C08B 4DQOH 1T0NA 1OGAD 1H8SA 1F4HA 1JPTH 4KKNA 1U8QA 1F3JB 1UEYA 2FJFB 4U6XB 3BH9A 4RAHA 1QRND 3WLWC 5KVGH 1MCCA 3OMZA 1KJ2B 1HOCB 43CAA 2P8MB 1DEEA 3T1WA 2XPGB 5T3XE 4F2MB 2YK1L 1RVFH 5ERWA 5L0QB 2DQGH 2VSDA 4JZNB 3I9GH 1H3PH 2VE6B 2HFTA 4QRQA 1XF1A 5IVXB 3FAXA 2WNGA 4FQQA 5GJSL 3EGSB 3EO9L 1KG0A 1A22B 3O81A 4QRTA 4J23A 1FL6B 1Q72L 3W9EA 3GJFB 3LRSB 4N8VA 1XCQB 2YR3A 2ZOKA 4Z77A 2MKLC 4HMDA 3FCTA 5E2UH 3IAPA 1UVQB 2Z91A 5E8EA 1R5IA 4P4KC 5F1NA 5CD3B 5KSVA 3QUYB 2XWJB 4JFEB 4LU5L 4R4FH 4G9DB 3VD7A 4X6CF 1V3KA 3O11A 1DQJB 1B6DA 4P57B 5HDLA 1KGCD 5ADOH 4P59H 1F02I 3QWOA 1MF2H 2YD8A 4ZFOA 2VKXA 4PJGA 1XGYL 2LTQB 5GRUL 4YBLC 3H9SD 4Z9KB 3X13A 4RBPH 1Z3GH 3GBNH 2Y6SC 4FFYL 5DZNA 3F12B 4Y7MA 3W5MA 3BW9A 4KJWC 5KSBE 4RGOL 2Y06L 2A1WH 3MV7A 2GITA 4KTDH 3T8XA 3KLSA 5DQ9B 4LL9A 3U0TA 1T0PB 4OFPA 1CVSC 3RWDB 1RUKL 1MCLA 4PGDA 1W0WA 4XGZB 3MR9A 4P2CG 4ZOAA 1F6AB 1GZQA 4JFFE 1FFOB 3GSQB 4LCIL 4OZFB 5D1ZD 3WNPA 4OM1H 3FOLB 1WFNA 3SCMC 1WT5A 4HS8L 2C1PA 4WU7A 5I1HH 3EYSH 4K07A 5D2LB 4U1NB 2EKJA 5GS0C 3BKML 1BZ7B 2BC4B 4HKZB 1OSZA 3WIFA 5JO5A 1JGLL 3PQYB 2ARJB 3RA7H 3RHWK 4G43B 2E9WA 3VH8G 1TZHA 3WDIA 4F58L 1PD6A 4OF3A 2ICEB 4JRYE 2KL6A 3VJ6A 1YDPA 3KPSA 1YEDB 4JB9L 3VFTB 2JJTA 3V8OA 4GRLC 3QIUC 2KQMA 2RIKA 4K2UL 3U4EB 2F54A 5FUCE 3C5SB 1XF2B 4X6BA 4YE4L 4LDEB 3RX5A 4YDIL 2Z92B 3KPMB 4LSTL 4HBCH 2Q6WB 1B0RB 2UWEA 4OZHE 4M8QB 3BP5A 1FLTX 3LS5L 1YMHA 1JNNL 1N7MH 4MMXC 3O4OC 1KB5B 1QBLL 2HKHH 2GJ6E 3NIFF 4LIQE 4F9LC 1MUJA 1MAJA 1IEAB 1U8MA 4F15C 5A1AA 5IF0A 4PY8J 1OTTD 2C9AA 4NRYA 4QRRA 2PF6A 1ZLUK 4MXQD 2VN7A 1H3VA 4KRMB 4DVRL 3Q2CA 3SY0A 5A40E 1JTTA 6FABL 1OP9A 3W5NA 1Q9KA 3C09B 4M7KL 1QNZH 4MXVE 4QXTB 1FG9C 3TT1L 4WTZG 3MRNA 5DI8B 1RMFH 2V17H 1U2CA 3P9MA 4DKEL 4TNVF 4EQ3A 5F3HB 3DSFL 4PJGF 1DQQB 1T6WA 5JHDD 2QHRH 1KLUB 2EC9U 3WSQL 5FXCH 1A5FL 1MHCA 4FQJL 2LFGA 3ARGA 4PJHA 4I0PC 4UV7L 4MNQA 5IVNA 3QZWG 4R7NB 3S96B 1QLFB 4OF8A 4HG4J 3HZKA 1NFDA 2GSIA 3JV6A 4OJFL 5FHBL 4U6YB 3V0VB 3O6FA 5L7XL 1BFVH 5DFTA 3Q5OA 2HH0L 3ZDYF 3I6KB 1FN4B 2VH5L 3KYMB 4BYHA 2XZCH 3GSRA 3RDTB 3RWJA 3TA3B 3CSYA 4Z0XB 2P8LB 3C8KA 2R9HD 4OD3L 3N50A 2ZP0T 3OKDA 4XVJL 4KQ3L 4PRAB 2CKBA 1MREH 3DI2B 2P24B 3NFSL 1A6AB 1GAFL 4NBZB 4BUHA 4AT6A 1RZIB 4KVCH 2OR9H 3U9PL 4PJBB 4ZUUB 1B2WL 2FDBP 4PJ5B 3VFUA 2FHCA 2EDFA 4EXPX 3BX7C 3OJMB 2DJSA 3WDHA 1K2DB 4YFDB 3LDBB 3MZTA 3U2SB 2YD9A 5ICZA 4XPHH 1FFRA 4A2LA 4X7SL 3S37L 3NMEA 4E41D 5D2NE 4L3EE 5JOPE 1IQWH 4FP8L 4JKPH 2W0PA 3O9WB 2ZZUT 4O9HL 4LLMB 3TWCL 4S0SD 1NSNL 2Z0BA 3D0VB 3I02B 5A3ID 4PV8A 4PJIE 3MNWA 3OBAA 1FJ1B 1IT9L 4U1KA 2UWEF 4BK5A 4JHWL 1QP1A 4LASH 2X4SA 3THML 2VC2L 4UV4L 3TBSB 1T1YB 1XGTB 4DCQB 1JHLH 2N7AA 5EU4A 4JJHA 4JJ5A 1ZANL 1CDIA 1CFBA 1NL0L 1I8KB 5GGQH 1S3KH 4KKAC 5GRZA 3RY6C 2LABA 3JUYA 3H3BC 3L3IA 4EI5A 5ESVA 4XPAH 3SE3C 3FQNA 4G3YH 2E7LA 1M05B 4BFGA 4WI3A 4MS8D 4P2RE 1P69B 4PLJC 3L3JA 1IQDA 3U0PB 1XGQA 1Q0YL 5EU7E 3L3GA 3MOAL 1CVRA 2VL4A 3LB6D 4NZUL 5FYLL 3X17A 4M43H 1OT1A 1BZ9B 4H1LH 1LD9B 4LNVA 3HHRB 3V0WL 2Z93B 2FX7H 3IF1B 4PJHF 4OD2A 2OK0H 4PS4H 2X9YA 3DTXB 5F1IA 4JEGB 5TF1H 4NFBA 2YBRA 3T2PA 1JHTB 4HWBH 5C0NC 1M7DB 3PWPE 4XHJD 4NZRH 1NFDF 2I9LB 4JM2C 4WI8A 3F65A 1WBXA 4YDLB 1K8IB 5DLML 2FX9L 2DTML 4Z95H 4CN1A 3HZYA 4U1JB 5HHOD 5C8JA 4HC1H 4FOMA 2NNAB 5HHPA 4Y8DC 5DRNB 5FGCE 4KRPB 5ITBL 1YMMD 1FGVL 3BEWA 3BSZH 4ORGB 2JCCB 1R3HB 4H88L 4LLYA 1PZ5B 4IHOB 2OTWA 4PV9B 1OAUL 4IOIB 4WUKH 5KSBA 3OWEA 5DR5H 5IW1A 4NDMB 2EE9A 2QQQA 5FIEA 1PZUB 2R0WH 4UILL 1HIML 3VWJB 1I8IB 1DBAL 5CJQL 1I3UA 5KVEH 2DAVA 1D5IH 2UYLB 2A1WL 1JPSL 4U1LA 4QWWC 4IEFB 3BE1H 4PJ9A 3TT3L 4JFFA 4KKBD 4LCWE 2HVKB 2JF1A 4QGTA 4EN3C 4XP5H 3LKPB 3M1BB 1QA9B 4ZXBC 3PWVB 4MJID 5D9SB 2VNCA 3LD8C 4LVOC 4G6FB 3F7YB 1BF8A 2NY1D 5KSUB 3EYSL 1WZMA 4CVXB 2VDOL 1FG2B 1A7RH 5F9WC 1I7RB 1I7TA 1EHAA 1UQSA 4KJQD 3B8SA 4JRYA 4L1HA 5E1AB 1TVDA 1RULL 4LKXB 4XP9H 3UTTB 1J12A 1Z9SA 1UB5A 3C5JB 4MDIA 1MRDL 3QI9D 1QBMH 4K55A 1NMBH 3UX9B 2YA2A 1X5GA 2GTZA 2UUDK 5JW4M 1LVEA 2IQ9H 3HPLB 3RFZC 4M3JA 5I8EB 5CBEA 4HEPG 4FZEH 4XX1E 4OZHA 2D2OA 4HCRH 3MJGX 2DWEB 3MUJA 4HUXB 4H20L 4OFYA 3WNMA 4OCMC 3RIAF 1WCQA 3VGHA 2GJ6A 2F8VA 4L4JA 3HR6A 3ZO0A 4Y4KC 5D7SL 4JN2B 3OZ9H 1V7MH 3CC5A 4MJ2A 5EU5A 2VLRD 4CMHB 4PREA 3VFNA 2NW3A 3D69B 3E3QE 3RPIB 4K9EC 5D6DC 5GS0L 5FYLD 3P40A 4WCYL 2D03H 2YPKB 5JW4Q 3L3OB 2R15A 2IH3B 1QQDA 4Q97A 4WV1A 3IT8D 4XWOC 2Y36L 3FO9B 3KNBA 1EV2E 2QADC 4WI5A 5H37G 1F6FB 2VXVL 4UTBL 4L8SC 2J5LC 1CICA 3SDCB 5KSBF 2CSPA 3GIZH 2A9NH 4FQ1L 3VI3F 3MMEB 3DVGA 4JO3L 2EE2A 2QJDA 3CFKA 3OKMA 4RGNB 1NLDL 3U30B 3L9RB 3DMMC 2H3NA 4FFZL 3NZ8B 5DJYA 1E6JL 1RUPL 4GAYA 1R3IL 4N1HB 5I1KL 5A2LH 1HYRC 3GMNB 3WN5C 3WLWD 1KCVH 4NC2B 3GSVB 3REWB 4DVBA 5TDPA 1EGJA 3QDGE 5CJ5A 3GSWB 1GHFL 2V2TA 1GIGL 3O0RL 2BSTB 5EWIL 1NGYB 4ZOBA 3S88H 2B1HL 3E6FB 2X41A 4LAQL 1CFSA 3PG2A 1NC4A 2WBJA 1AR1C 4HK0A 4WTXA 5JW3H 1ZWIA 4HULB 2G9HB 1AD9B 2C1OB 3GMOB 4PP2A 1BGXL 1X5LA 2AVGA 2IALA 3GI8L 3QEQB 4RQQA 4JAMB 2ZCLH 1DQLL 5D2NA 4L3EA 4YFLI 4C56B 1FVCB 5E99L 5AD0B 4QRUB 3QHZH 3U7YL 4J3XA 1CXLA 2FSEB 1D5BA 4P4KD 5C6PB 5EOCJ 1P53A 2Y72A 5JPMB 5LGKA 2X4UA 4LHJB 5IFAH 3WBDA 4WRLA 4HIIA 1VSCA 4JFXB 3MLSH 3ES6B 4L8DB 2HJKB 5IV2B 1IAKB 4OZHF 5DHYB 1T7VA 2B2XH 3KLDA 4M7ZC 1IKFH 5EORH 4KZEL 3N1GC 3K0WA 3HE7A 1YYML 1H5BA 1XZ0A 1ES0A 4Q7DA 5I8OL 4X99A 4WEBL 2B5IC 1LNUA 3F7RA 3K2UL 3MROB 1XFPA 5FA4A 2DQFA 2Y6SD 1JHLL 2AJSL 2EDOA 4KJWD 3Q0HA 4DZBA 4QYOB 4JANA 5LWYL 2BOBA 5I75B 5ID0A 5K9KA 4NCDA 4P2RA 3VD3A 5JR1L 1P4LB 4CVUA 5I1AA 4LSQL 4F7MA 1WLHA 2AAVA 3L7FA 3CFDA 3QO1A 1K3ZA 5CJ8A 2DB8A 3MJ9A 3MJ8B 2VLJB 2HFEA 4UINL 1BIHA 8CGTA 3SCMD 3LN5B 4DGIL 2PTUA 5EFIB 3IAGC 5GS0D 5E70A 4NP4H 3PWPA 5DT1H 5H35B 4F8QA 4EEEA 4NQED 4X7EC 1ZLSH 3N85H 4R3SA 3VXTA 3FT2B 3MV8D 4UOJA 3KXFE 2Q87A 2AABH 5T1KA 1AXSA 5HHQA 3DBXB 3RZCB 4UT6L 1IFHL 4HXAL 2H32B 1G7HB 1A21A 1UWXK 3CCHB 1WT5C 4GRLD 3QIUD 2O93L 4BZ1H 3SJVA 3D2UD 3WXVL 5J11B 3UMTA 5I18H 3VFRB 2BJMH 3QHFH 4F7TB 5KJRH 3F6LA 5AG9A 3WFDH 4U0RC 4F80A 4NO3B 4JRXE 2DIAA 5CEYB 4N0UE 4J2XA 1IE5A 4PRNB 4QRPD 1TJHL 1TZGL 3MYJA 4RFOL 1VFAA 2Q76B 1FE8L 4X7FC 3G5XB 1QPPA 3MBEB 1MEXH 2QL1A 5BOPA 2HLAA 2JJTC 4JFQA 1NEUA 3A6CH 4NRZA 3D25A 4XP6L 1PX4A 4M62L 5TE7H 3MRKB 3CLFL 3LKQB 4PJ8A 3PDOA 1LO5A 3OPZH 3LMJL 4YPGA 3ROLB 2VMFA 4LCWA 2MSPA 2O5YH 4AL8L 4Z5RA 1K8DA 2OS7A 4LPWA 3PWUA 3O8XC 4LSVH 1F90L 3QUZA 3SO5A 1MFNA 4QT5A 3P4OB 4PJIF 4ODXA 2Z9TA 1IGFL 3S5LG 5BS0D 4TOYL 1JUFA 3MRIA 1NMCC 4G7VH 2A6KB 3K81A 1DBKH 5HJ3B 3HKFA 5I1DA 9CGTA 1RFDL 4G42B 1H8OA 4XPGH 1BLNA 3GHBL 3ARTA 3OTTA 1S5HB 5E8NB 1TNMA 4I0PD 3DURB 3B8YA 2VLME 4HGWB 2YPLB 2EDLA 4U1SA 1A7RL 4TULL 4WHYG 1T2XA 3AVEA 3MLVL 1SY6A 4A6YB 4TVPE 2BVTA 1LO4H 2PYEE 3OHXA 3AM8A 5CSZA 3WFZA 3EFDH 4DKFH 2FGWH 2DLHA 1U8HA 1E27B 3ARGC 4R96B 1N5YL 4RMWA 1MWAL 1U93B 5FK9B 2CLVB 3RIFF 1JV5A 1CT8A 2V5YA 4M6OL 2JTDA 3E8UL 3O3BB 5KN5A 3LKOA 3U36B 3O6FC 1CE6A 5B21A 5CSBA 3MTRA 4NNYB 5GJTL 4YHML 2OTUA 1EUUA 2NX5B 1HWHB 1IC7L 1QSFB 1Z0NA 1CDJA 3B9KB 3BKCH 5DVMA 3SGKA 4OM0L 3RL1A 4ZFZA 4GRWB 2J88H 5INCB 2IG2H 3MRJA 4G6JH 3EHBC 4EXKA 3DUUA 4NUJB 1QHPA 2XA8H 3EO1A 3K4AA 1KCUH 1R3JA 3U1SL 4KMTH 4UT9H 4JFDD 1UZ8B 1CFTB 1ZHLA 4YDJB 3IETA 1FNHA 1KFAH 2BVYA 4PB9L 5GHWH 1N59A 4GG8A 3CFBB 1X4XA 4J8RA 2A38A 2J8OA 5DUBB 1PQZA 2BK8A 4Y4HA 2J7LA 3HAEH 4M6NH 3B2VH 2HJLB 1NAKL 3WFEL 4KKAD 3QDGA 5ETUB 5I19L 4K3EH 5JHLL 3D3VB 2PO6A 3BD5A 2WLYA 4I5BA 1NANI 5F6IC 4EI6B 4YR6A 4PLJD 3TCXA 5HYJA 3ULSA 2BNUB 3RL2B 2AJVH 2FEEI 5CGTA 2VL5B 3BJLA 2I07B 4UDUA 1PSKL 4TTGA 4K9EL 5J8OA 2CO6B 3EOBB 3X12A 4WWID 1FSKC 1QOKA 3G5YA 4JFPA 3WLBB 4AMKL 4QHNB 4EI5C 5CZXC 3GKWL 1FLRH 1HSBA 1XGUA 2E7LC 1EXUA 3BZ4B 3NH7H 2HG5B 4KAQH 4MLIA 1G6RB 1MCIA 1ND0B 1YEHH 4MLSA 5C0ND 4WVRA 5C09A 4JM2D 4PGBA 4D8PB 3RVTC 1KPRB 3P11H 5E9DE 5MEOA 1D6VL 4BQ8A 4F7PB 4PPTA 5TGBB 4OCRL 1JZ6A 5IHUH 3E1F1 1S7RA 1I4FA 2EIBA 4KH2A 1KEGL 1CD1B 4QHUA 4OLUL 4E5XA 3TFKC 4M1DH 3MLTB 1A2YA 1RJZB 5FV1L 1JWMB 4NN7B 3Q5YA 3DX7B 1K85A 3B6SA 5E5RB 3QNXB 1I8MB 2AK4B 4LVNB 2ZCKH 1AC0A 5EOCH 5FCSH 2JB5L 1EHLH 2HRPH 2ZSWA 5TDOA 1OF2A 1RURH 2MNUA 2DQCL 4TN9A 5C0RH 1FRGH 2E6QA 3RVUC 4BFBD 1MJJA 1VADB 3OX8B 5T3XH 4W6WB 3GSOB 4QWWD 3FZUC 1INDL 3LEYL 2DL2A 3X11A 2YMXH 1NC2A 4WUUD 3L5HA 4LRIA 4X4YA 4GT7A 4EN3D 4OKVB 2CUIA 5IW6A 3L3HB 1DQDL 2WUCL 3RI5K 1JPGA 1NCCH 5AZ2L 1GPOH 1S7WB 3N0PB 2VO5A 3X3FL 3QFDA 4WJ5B 3HA0A 2F58H 1IILE 1KJ2H 5I76B 4I48B 3KXFA 1G7IB 3IJSA 4PJEE 5FDYA 1G7PB 4PJ9C 5C0CE 1PYWB 4MXWH 1I3VA 1OCWH 5MI0C 3GGWB 1ZLSL 3D5OF 3TH4T 5ITFB 3DARA 4QGYA 3UPRB 4D9LL 3MRPB 2KUTA 3I6GA 1MQKH 1RHFA 3P4NB 5IUSA 3MXVH 4IRJB 5CGYC 4F33A 5MEPB 1AR2A 3KG5A 4JRXA 5C71A 4O2EA 4YGVA 4N0UA 4R97C 1YEGL 5GGSY 5ISZB 2FJGA 2IFFH 1EBPA 3GJFH 5GGSA 4D94A 3TCLA 1KC5L 2C5DC 3BZEA 2IPKA 5DHXB 3PNWA 4KROB 1CR9H 1Q1JH 4AEIH 3RWFB 4CW1A 3UROR 2AJXL 1C7SA 4ZFOL 4Y4KD 2X89D 1LP9B 2CDFA 4M7LT 4R7DA 5C07D 1YNTB 3QT2A 3TBYB 3BP6B 4K3HA 4OZGE 3VDAA 2GQHA 3BPNB 4U1GB 1EERB 1MEXL 2YC1A 3UTSB 5SWQB 1KELH 3LQZB 1VGEH 5SWZB 3IDYC 2X44D 5EG6C 3K7UA 1YEEL 4YFLF 4G8GD 3ARXA 2F53D 4XCYB 4X9HA 3QULA 2BOCA 2NXZB 4LGSB 2DI8A 1FZMB 1YNKL 35C8H 2ZPKL 5DEFB 3QDJD 4XWOD 1KCSL 3GMPA 1KBGL 2QADD 4ZUTA 1IVLA 3G6DL 4YDKL 3FRUA 1OAQH 1KJVA 3QUMB 2J8UA 5ALCH 4P46A 4OGYL 4XNMB 2F15A 4S1SH 4O58H 2F8OA 2VABB 4XPGL 2F5AH 4OLVL 3BIAX 4HXBL 1XH3B 5E8DH 3BPCB 3FO2A 4OZFH 1CXEA 4I2XE 3DMMD 5EBMB 2Z8SA 5IMKA 1MAKA 4WV1C 4MA1C 3MRGB 1CG9A 1ZT4B 3IDXH 1FPTH 4Q0XL 1QO3A 3GMMA 3FB5A 1RIUL 4GFTB 4EUPG 4HMCA 3TYFA 1CICC 4M02A 5CP3H 4I18B 1A7QH 4BKLA 4HKBB 3L5WA 1S7TB 4JPVH 3NBNA 4ETQB 2G5BA 4LDOB 4Y5VA 4EDXB 3GB7A 3R06B 3OKEB 1NFIA 4MVBC 2P7TB 1S7QB 3PP4H 1AR1D 2AV7B 3TNNA 4N1EA 5HYQA 3QJFB 2XY1A 4R4BB 1FNEB 3T1FA 1IGMH 3CLEL 4QY8B 3EYUL 3PGCA 1P7KB 3UBXG 4ZYKA 1YJDC 4UB0H 2DM4A 2ZJSL 5IOPB 1VFMA 3MUHL 3S35H 4U6VL 3ZKMC 2FR4A 1DVFA 3ZTNL 1INEL 2VDNH 1ZHBB 4WFED 3BZDA 1OW0A 1P7QB 1RZGB 1R24A 4ETYA 1A47A 4MA8H 3ARDA 2WBJC 1KB5H 1DLFH 1FVDA 4ONGH 5BZWB 1CFVL 2XZZA 5CLTA 5FYJL 3CMOL 4I9WD 3IVKA 2ORBL 4PLKC 1BQUA 2A73B 1NEZA 4OFVA 5D2NC 1XF5B 4P9MH 3SN6N 3SPVA 2HRLA 5IGXH 2R4RL 3RNQB 1ACYL 3C6LC 4M7JH 1A7PH 3BO8B 4E42A 3BP7A 4XXCA 3WFBH 5KTEL 2Y5TA 1ZTXL 4OB5L 5DD1H 2E8YA 5CD5C 2X5PA 3BT2L 1H3TA 4XAWH 3HE7C 1H5BC 3B3IA 4P3WA 4ERSH 5IEHA 4WNQB 2D31A 1TJGH 3LY6A 2CKBL 2R1WB 1CIDA 1UH3A 4N8VG 4XP1H 1ORQA 2YWZA 2J8UF 3MV7D 1R0AH 1T1XA 2HYMA 4P2OB 4Z7NE 5EU7C 3MJ7B 4KHTH 5CJXA 5E9DA 1X5HA 4HIJA 3OAZK 1MFBH 4N68A 3MA7B 2IAMA 4OSUL 2FO1A 4G7YH 1QSEB 5GIRA 4ZNEE 3LEVH 4G9FB 4DZ8A 5F96H 4FQIL 4ODVH 1BAFH 3UTPD 3C9NA 4YFEA 3BXNB 5FOJA 4BH8B 1GH7A 3VFMB 4PJDB 4OGXL 3SQOL 1EIBA 1ADQH 1IEBB 5DTFB 4HUVB 4PY7B 3KYNB 1WSST 5TH2A 1TMCB 4QF1B 2OX5A 5DGQA 3TPKA 1AXTH 2FHFA 4FQ2L 1QFWM 3LQAL 4KTEH 4X9BA 3ULUE 3ECBA 1QVOB 5C0DB 3EOYG 4NSKB 3VXMB 4JKMA 4KUCF 3KPSD 4MX7A 3AAZA 4ZQKB 3DX6A 4YHIA 2F54D 2WZPD 4X9GA 4GW5B 1BREA 4NQCE 4L8CB 4TPRL 5I16A 5IVOA 1SMAA 4YIQB 3FONB 1CWVA 3OGCA 4YPJA 1NBZA 3T0EE 3QEHA 5IB1A 1FFPB 5T3XL 4QHKJ 4NRXB 4PLNC 5GSRB 1CF8H 3WFHB 4XH2A 4U1HA 5FFLA 5KG9A 4XTRC 2AJZA 5DJ0B 4JFEE 4XPTL 3DUSA 4LF3A 2GUOA 3H3PH 4PJEA 1J8HB 4PJ8C 1IGYB 1JWUA 3O3UN 4UMGA 4J3UA 5D7KE 4XCFH 4LLQB 2BHUA 3RQ3A 2QSCH 3DVIA 4P3CL 4QRRD 1CYGA 3QUZC 3IB4A 5HYSA 4M03A 4WWKA 2GJZB 5FYJD 4YHLL 3QXVA 5AYUL 3ESUF 1TZIA 1QFUL 1BQHG 4G6KL 4PRDB 2IPTH 3UJIH 4L3CA 1W2KT 5E08L 3RWCB 1ED3B 1W8NA 3RUGB 2R0KH 4YHPB 1JGDA 3HMWH 4APQB 3ARGD 2QSTA 3HC3H 2X9XA 2OI9C 4MNQD 1MCOL 4Y4FB 4OZGA 1IMHC 3HNTH 2CLRA 1J9CT 3GSNB 1VESA 3O6FD 5AWNL 3SDDA 3FQTB 4IRSA 4MB4A 3AM8C 1FO0B 2WW8A 4QCIA 4YQXL 4FXLA 4RWYH 4KMQA 5E2TH 1BJ1J 3ZT6A 1GC1C 5H94B 3EHBD 3P30L 1J1OL 1V7NL 3QIWA 4ZSOB 1JBJA 5JUEH 3JTSA 2Y1VA 3CFCH 1BIIA 1MHPH 3LPFA 4K3GA 2IMMA 4XCNB 4Z7UB 3U7AA 3UO1L 5B8CB 1JYVA 1KULA 3C60B 5EN2A 3V5HA 2B0SH 3H7BB 1A3LH 3QJHA 3STLA 4QHLB 2C3XA 1CL7H 3HI6L 3E3QC 1IL1B 3VFPB 4S11A 1T7XA 3KLHC 5I1LB 3SGKC 1F11B 4BZYA 4I2XA 4ORZC 1P5VA 3SOBH 3WEXA 2X1QA 3TIEA 3FQXA 4DN4H 4L4TB 3FN0H 1PKQE 1TJIH 4LCCB 4NWTL 5E7BA 5IMLA 1U95A 3EYQC 1CBVH 5DZLA 2E27L 2MFNA 4XMKL 1ZLWK 3RX8A 3QEGL 4ZO8A 2Q8AH 5ICYB 1W72B 4Z7WE 1MRFL 2PYFA 2VDKH 2V7NB 4IBLT 3BZFB 3MFFB 5IB3B 3OAYH 4C4KT 1HHHB 4Y4HC 5D96B 4DGVH 1TETL 3WUWB 1OAKH 4P48A 2D7TH 4PD4J 3HC0A 4PJEF 2V9QA 4GAGL 4RNRB 2CGRL 3OKNB 1U6AH 1Q9WB 4JRWA 4XC1H 1T66C 5DS8A 1OTSC 4YX2H 1QUNA 4LIQL 4EI5D 3DGGA 5CZXD 3O3DB 4D0DB 2YD1A 2PO6C 5LQBL 5HVFB 3G5ZB 5IHZB 2UZXB 1IGML 1WZ1H 1XF3A 5EZOH 4FXKA 2GY5A 2K7PA 4MA3B 2GAZB 3RVTD 3UTZB 1T5XA 2AV1B 1F42A 1T21B 5FYJU 4W4OA 3VE0B 4HQQL 1HEZA 3PV6B 2OL3A 4DOHB 3LKSB 1PGRB 2V9TA 1NCUA 1VFUA 2IMNA 4LPCA 2UY6A 3FJTA 3QG6B 3WL9B 3TFKD 2AERT 2PW2B 4OZGF 2VXTL 4EDWH 4POZC 3K1DA 4LFHG 5DVNA 3W0WB 3QDAA 5C92A 1D5XB 3DYMA 4TRPH 1DL7H 5C9JB 4FNLH 4MAUL 3MREA 2X7LB 1QR4A 4XPFL 3UAJC 2AS5M 3BGFC 2NXYB 4JFHE 5DRZA 5BV7H 1T2JA 3RVUD 3OL2A 2Z31A 4LQFH 1IGTA 4QRSB 3DV4B 3QUKA 4KI5E 3UYRL 3CVHA 3FZUD 3UJTH 1F4XH 3KLAA 2I60L 4X4XA 1ETZA 1EGJL 4ZS6C 1YJDL 4LBEA 3HCVA 5JQHC 3OKOB 1CDCA 3BKYH 5T5FH 5T5NF 4C57C 4PJXB 3VFWB 4EZMA 2CIIB 2W9DL 1T03H 4M1GL 3GM8A 4JG1H 2VRAA 4WO4C 5B22A 4D0CB 3DROB 2FLBT 3E2HB 1KTDA 2JK5A 2CH8A 2NY4C 1NDMB 4PJ9D 2ICES 4ZNEA 4JFFD 5GRWA 1P84K 3AROA 3VFVA 2BSRB 3BDYL 4LRIC 4HFUH 3A6OA 4UDTB 1IBGH 4J3SA 3KAAA 1XGRA 2ARWA 1RAMA 5E94A 3IDMB 1SBBA 5F7YC 4LPUA 1HOCA 1RJYB 1JFQL 2EDHA 4HUKB 3STZB 2JIXA 3FO0H 3D9AL 2PCPA 3MCKB 5DMIL 2ED8A 3VFGL 4JRYD 3F6IA 4JZNA 5DVKA 1MCHA 1Z9OA 3FRPA 3DSNA 5SX4I 3AFLA 3WE6B 3VXSB 2C4XA 5IVXA 5MERA 3MLXH 4DKDC 1YNLH 2EZ0C 2QKIA 1NUFA 4NQCA 4NO5A 4ZMAT 1L9MA 4N8PA 3LRSA 3T0EA 4KJYB 2OJZL 1RZ8B 5B3NA 1UVQA 4JG0H 4MAYA 4U0QB 4ZUSB 4IDJL 2W60A 4OFYD 1N6QL 5CD3A 2AQ3A 2F19L 2ZWLT 1JVKA 4P2QB 4JFEA 2XQBL 2GJ6D 2P5WE 5I74C 1F4WH 1CLOL 3MJ9L 4EIZC 1DQJA 4FXGB 4P5TA 3GO1H 2GCYA 3BN3B 2B1AL 1N8ZA 1XF4A 2W65B 1NGPH 3FQWB 2LE9A 4KKLC 4N0YH 3P0YH 1DBBL 3I2CH 5F70A 5E4IA 1FCGA 5DEGA 1SJXA 3F12A 3HR5A 3AU1B 3GSXA 4S1DC 5E00B 1EAPB 5HDQH 2CDEA 2P8PB 3UJJL 5EIVA 1R5VA 2Q86B 3LVEA 4J6RL 1DLHB 1NUNB 3JUZA 1BJ8A 4YXHL 3T3PE 3RWDA 4CDGC 2XNAB 4P46C 2YSSB 5DD5H 5DVOA 1CICD 3HZMA 3ZE1E 4K7PX 1AE6L 1MAMH 1MVUB 2G2RB 1A6VL 3SE9L 1TVHA 5TPWL 1UH2A 4Z7NF 2BRQA 5D2LA 4U1NA 1T0MA 1BZ7A 2BY3A 4MD0A 5DJZB 5ILTL 3ZT7A 4NQVB 3U46B 4YWGL 5HGHB 4G43A 4NIKB 1NKOA 4HPOH 3P4LA 3ZKMD 3VW3H 5BVJA 2YRZA 3VH8B 3VFTA 3UTTE 1K6QH 1UH4A 4PUBH 2NMSA 4Y5XA 2NCMA 3ULVH 3CZFB 4Y5VC 5BJTB 1QLEH 1J7VR 1NC4D 2UVFA 2WBJD 3C5SA 5EC2B 4UNVA 4HJ0C 4MJ6A 3H2WA 4NZTL 3MSPA 1KGCE 1VENA 1MHPL 1HYSC 1OPGH 5E0QA 1FZOB 3KPMA 2Q6WA 1CXFA 3IU4H 4RMQA 1BJ1H 5D1ZB 2A6DB 1B0RA 3MRMB 3NAAL 4L3ED 1PKQA 3MC0A 5IVXF 5JOPD 2QQLL 4IRZH 1DVFC 3QDME 5D7IE 5C0EB 4YZFE 2IBZX 5GGTH 4HD9A 1OW0C 2OJEA 3ARDC 4GW4B 1IJ9A 1ZGLM 1YEFH 4QOKB 4YK4C 4Z7WA 3QH3A 1ITBB 5K33A 2EDYA 5CD5D 2RQ8A 3P77B 1SY6L 2LAAA 3JVGA 1TQBB 2K9UA 3PP3H 4D9QE 3HE7D 3DRTA 5F7DB 5E7FA 3F58H 1WBYA 1F13A 1NGQL 5IB2B 4EKXA 1KN2L 4IDLA 4QXTA 4I77L 1VGKA 1GC1L 2P43B 2PXYA 3MXWH 1TITA 3OJ2C 1HHIA 3D39E 1AGCA 1OAKL 3GRWH 2OP4L 5F3HA 4XXCC 4YXLH 1KLUA 2W1NA 5HGGS 4P2RD 4QO1A 1ZVSB 1TPXC 2EDRA 4K3DH 4U7MA 4DW2H 4R4NC 3KPRE 1ZT7B 1EVTC 2VDRH 1GGUA 4MCZA 1FL5B 1QLFA 4LRNH 3TH2T 1WCBA 3BGAA 2E7CA 3V0VA 3HMXH 2VDML 5EZOL 4BQBA 3I3EA 2VITB 2H9GB 3AMKA 3IS0X 4Y16A 3I6KA 1FN4A 4IJ3B 5EBLB 5CEZH 1YC7A 5J4MA 3VMPA 3PWPD 1U8IB 4OZIE 2HT2C 4FABL 3K46A 4PRAA 2ZOLB 4GRWH 3VRIB 5TDNB 2GTWA 3MRRB 5K9JL 3ZLQC 5CJXC 5LVEA 4LQ1A 3DLQR 4N1CA 4CMMB 4GG6B 5D2LF 5FGRA 1BQLL 4EVNB 1NCAL 5T1KD 3LIZL 2IAMC 1MSPA 1RZIA 1WQVT 4OUOA 5HXMA 2HWZL 3NCJH 5FCUL 4PJ5A 3MA9H 5CP7A 4NNXA 1J88A 1M71B 2A77L 3EDFA 3SJVD 5I8KL 3EZ8A 5E5MA 2PN5A 5D6CB 4CN4A 2ZUYA 3CXHK 4ELKB 2J4WH 4Q74A 2AQ2A 5T1LA 3VXNB 5EUOE 5IEKB 4YXKH 1FZKB 3G6AB 4M00A 2WP3T 4DFIA 4OCYL 5BV7L 3IDIB 1QLRA 4BFIA 4C56E 5F89A 3HI5H 5H2BB 1IC5L 5JW5B 3IDJA 2AJYL 1KLGB 5GS1B 4XMLL 3WIIH 4RMTA 3I02A 3D0VA 5E6IB 4XTRD 5DVLA 4P9HH 2VXUL 5JHDE 3JV0A 4H0HB 4U1IA 4PJ8D 1P6AB 4LCWD 1KIQB 4JPKL 1MLCA 4G8IB 3QUZD 1AD0B 3KJ4C 2ZCHH 4XNYL 3V4UH 1I8KA 2E8ZA 4Z7WF 1U3HA 2Q8BL 3L1OH 1WIOA 2KZWA 2YUZA 1M05A 7FABH 3UC0L 4OCXL 1EO7A 1JNLH 4OZ4B 1L7IL 3BDBA 4UNTA 2CRIA 2DQIL 5F9DC 2LU7A 2C4FU 4I0KA 4DK3A 1XR9B 3VRJB 4NHUA 1EJOL 5DUMH 1FAIL 4WWKC 3VGAC 3KWWA 3O2DA 3RIAK 3FN3A 3IF1A 4U6TA 5BO1L 5HTSA 2EDKA 1YNLL 3T65B 1ZEAL 1M7DA 2FX8H 1QFWI 2I9LA 4E41E 1U8JA 1K8IA 1BBJA 2P5WA 3D1MC 1JTPA 3KR3L 1YQVL 3GK8H 1A7NL 4U1JA 1RJCA 4OFKA 2GSGB 2IGFL 4F37F 1AKJA 2NNAA 3JV4A 4X7TB 5F9OH 2WANA 1BEYL 3DNKA 2NTFB 3BKJL 3SDDC 1RHHA 3V6FB 4ONHB 1CI5A 4IRSC 3MGTB 3V5DA 3IFNL 5FDWA 1R3HA 1PZ5A 3KLHD 4L5FH 2AEQH 3E6HB 3KPQB 1IAOB 2X1OA 1BX2B 1ORSB 1OTUC 5DRWB 1L6ZA 3QIWC 3B9VA 2DLIA 4L9LB 3LN9A 4JCLA 4ODUB 5FO9A 1BD2E 1EFXA 5FUZL 3N06B 1U8LB 1KCLA 3HUJB 1I1FA 5GPRA 4RIRA 5FM5M 2JELL 3IXAB 3EYQD 2X9WA 3UTOA 2UYLA 2ADIB 2D7NA 1F8TL 1B90A 3V0AC 3BIKA 1EEZB 4TUKL 4UUJB 3NABL 4NN5B 4NCC2 2XI9A 2HVKA 3X3GH 5C0BB 5HHOB 4MJ4A 4JR9L 3V6OE 3LKPA 1JZ5A 5HGAA 4YHNB 1QA9A 4PJCE 1MFEL 5DJ6A 3QSKB 1I1RA 3QB7C 1CN4A 4Y4HD 5D9SA 1BJMA 2BRRL 5F7LB 1AJ7H 2D7OA 5L9DH 3U0WH 3QR2A 4Q9BA 1AGEA 1MAML 5IMOB 3MO1B 3DIFB 3NTCH 3JXAA 1T66D 1KSRA 4FG6C 1OTSD 3QDGD 3C2AH 4CVXA 3RZWA 2OSLB 3VDBA 2PO6D 4OD1H 5TE6L 5LBSH 2EKSA 3UTTA 1DUZA 2QQNH 3JWDC 5HYJD 4AEEA 1J0YA 4BQ9A 4ENEC 4DGYH 2ESVB 2R39A 2YPLE 1FFNB 3RKPA 4HWZB 3DX8B 5J56B 4HV8A 3MRFB 4DEPC 4ZUWA 5F6HJ 3QPXH 3RGVB 2CXGA 3RVWC 1NH6A 5GGRY 3NACL 4ZUVB 5GGRA 4HUXA 3QDMA 2X4OB 2X6MA 2VQ1A 4MJIB 2FGZA 4POZD 4NM8L 5C09D 2A83B 3MLRL 1CE1H 1JK8B 4HT1H 1HCFX 3OXRA 1WEJH 4JN2A 4S1RL 5C6TH 2H1PH 1AGFA 3UAJD 4OQTH 4W4OC 4LSUH 4GKNA 1PKOA 1LEGB 4TVPL 4YNYB 2AK1H 1MCWW 2BMKA 2VUYA 5EZLB 1U8OA 2AGJH 4J1UB 3QI9B 1MNUH 3MCLH 2YPKA 2JJSA 2XTJC 5EOTB 3L3OA 1C5DB 1IGJB 4ODTL 3WKML 5DC4B 3D39A 2P4AB 5BOZG 1RZFL 1HH6B 3NN8B 1EO8H 4YHYC 3SGEH 4ZS7H 4GMTL 3KPRA 5D93C 5KS9B 5KSAB 2Z31C 2FL5B 2R29H 4WO4D 4CU6A 5JXEA 1QBAA 1Q38A 2GW5A 2WWKT 2NY4D 3LKRB 1G7QB 3L5IA 1IGCH 1QEWB 1ZS8A 1NC2D 1C7TA 4ZOCA 4JPIA 3T3PF 3NFNB 4NWUH 1C1EL 2XG5A 4OZIA 4MNGB 3ZE1F 1OD7A 3GSVA 1LDPL 4JY4A 2V2XA 2PUQT 2DBJA 4DN3L 2ADJB 2H6PA 3D3VE 2EDBA 3BPLC 3KXFD 4UQ3A 1TTUA 2N7BA 1NGYA 3CH1B 1S8DA 1R3LB 3ME0A 1Y18B 3E6FA 3MODL 1FP5A 5GZOC 3EFFB 4OCNC 2DQDL 3SE8H 3JV5A 3F7VA 1FNSL 1I7UA 1I9JH 3J7HA 4LOUC 1I9RL 2GK2A 3AC0A 2EZ0D 3GMOA 2UY7A 5DURD 5EUOA 4KXZI 2C3VA 4RISL 4JRXD 4KDWA 1JN6B 4IMLA 4C56A 1NBYB 3JWOC 2H8PB 4QRUA 5LGHH 4V1DE 3L95B 1MOEA 1EMTL 2FSEA 4PR5B 1HCVA 5I1JH 5IIEB 1IAII 3PGFL 1HHJB 2DQJH 4ODWB 5IV2A 1UJ3A 3CH8A 2HVJB 1T2QL 1A1NB 5DHYA 3QNZB 3ISWA 4N9GA 4XMPL 5ESQA 4YBQD 4ZFGL 15C8H 1P4IL 5DHVA 1F2XK 4YZFF 1N0LA 1A4KA 2FEEL 2VOTA 4JFYB 3T0EC 4KKLD 3HLAB 1YEJH 1FNGB 3WNLA 2BDNH 4MAYC 2QQKH 1VPOH 3MNZB 4LSPH 4X6DE 1A6TB 3CSPA 5C2BL 4ODSH 4BUGA 2VN4A 1HXMA 1OM3H 2NTSP 4S1DD 4GUPB 2GK0A 1YPZB 2LAGB 4ZAKB 4EOWL 4UQ2A 2E3VA 1P4LA 2VZOA 2E9IA 4OIAA 1C16B 4P5TC 2F8XC 2VJXA 1LK3L 4UT7H 5GGVH 2PW1A 3S98A 3QHTC 4H8WL 1KCKA 3R1GL 2VLMD 4QNPE 7FABL 3NA9H 4P46D 3MJ8A 3CPLB 5J0BA 1KEML 2VLJA 3ULUH 4TSBH 3PDDA 1MY7A 2XZAL 4NC0B 1MLBB 1HQRB 4PJ7E 4TVPD 4NOFA 3QA3B 1R3KB 1TQCC 5HPMB 4OAWB 5D1XA 3RIFK 5I1GH 2AEWA 3WXWL 1PY9A 4YBLB 4XC3L 5CIPB 1G9MH 1UJTA 2GYSA 5JXAL 1JYWA 3KYOB 2OXHA 1P1ZB 4TUOB 3LAFA 1T20B 1BM3H 1KNOA 1UXSB 4IIQB 2H32A 4OZIF 1MCKA 5DJCB 3BPOB 2C7UA 5ABDE 3WHE1 4M9PA 5C2UB 1MFCH 4OV5B 5IESH 4F7TA 4HJ0D 1CGYA 1EEQA 1HYSD 2F9BT 4KUCD 4LLUB 1G7JB 1GXEA 3MBXH 1EEYA 2YD2A 2R56L 2RGSA 4XBPA 1BD2A 5SX5K 1SEQH 1DVFD 3G5XA 4HS6B 4ODHH 4N0FB 5DJXA 5EUOF 3ABZA 3ARDD 3LKQA 3PWNB 5T1DH 2XKSA 5I1CH 4HK3J 1BBDL 4PRBB 2DLFL 3AB0C 4HJJL 3V6OA 1PBYA 4PJCA 3UTSE 3RWEB 4KWUA 1UADC 4F57H 1QBBA 3QIUB 2Q3ZA 3D2UB 2R4SL 5HSFA 1LE9B 1F5WA 5I66B 5BVPL 5JLZB 5D7LB 3TO4A 2BXYA 3S5LB 2VXSH 4AY0A 2FBJL 2Z4QB 4G42A 1I7ZA 3VD9A 3F7PC 4NQEE 4LSDA 4G5ZL 4QRPB 2FRGP 3KJ6H 3VWKA 5EBWB 3BUYA 4RX4A 3JVGC 4R4ND 4RFEA 2YPLA 3QCTH 1JZ8A 1NQBA 4Q9CA 4ZPVA 3HPJA 2FATH 4HBQA 1Q0XL 4F7EA 3BDXA 2FHBA 1RZJH 4A6YA 3GSNH 4YUEH 3GRWA 1NEZG 1ZLUH 2Y23A 1X5XA 4NKOB 4JDVB 2V2WA 1FO0H 1EZVX 2HT2D 1N4XL 3QEUA 3GSUA 1E27A 2FH6A 1OARH 4MD4A 3T4AB 5E9DD 3V9FA 3O3BA 5TF0A 3FT4B 2XKNA 2IAMD 4NGHH 1MFAH 3A0OA 2OZ4L 1VKXB 4PBXA 4BQ6A 3C08H 3ZL4L 5TQ2H 3QQ3A 1NPUA 4Y16C 3DVNA 3IFLH 1AHWB 1VCAA 3D18B 2QEJA 1BPVA 1YYLL 3B9KA 4JM4H 3RDTC 4I0PB 1UKTA 3IRZA 4NQXB 1S7XA 3RPKA 4NUJA 4K23L 4O51A 3VMOA 4ONFH 5BS0E 1SBSH 5L88H 2JJWA 2E6JA 4NKIH 1HZHL 5IG7B 2X1PA 1CFTA 2R1XA 4ZPTA 4YDJA 3WNNA 2QLVB 2EEBA 1N0XH 4Z7VB 4YC2C 5IHBA 2AKRB 3EOAB 3MRLB 1FBIL 1SEBB 2AXJA 4ZS7L 3EYOB 5F7EL 1DBJL 1NAML 1WBZB 3OJVC 1Q9OB 3C5ZA 5GRVL 1C5BL 3MOBL 3VD5A 1KIRA 1G9EA 2WIIB 3K8KA 2EDWA 1U58B 5T33L 3G08B 2NLJB 3RWGA 3GI9H 2XIDA 3D3VA 4NJ9H 4PJCF 4G6AC 3GNML 1DQML 4DTGH 4EI6A 1REIA 3TV3L 1JGUH 2BNUA 5IM7A 2OL3L 4H1LB 2EDEA 4DFHA 2YZ8A 5ANMB 4CADB 4Q9QL 4WWKD 1U3HC 1YC8A 3ZKNC 4DAGH 2Y9RT 2ZUWA 4MWFB 3WIHA 2HG5A 4V1DA 1U8NB 1UACH 1G6RA 3HNSL 4PTUA 5DDHA 2OTPA 3QP3A 2A6IB 3MJ6A 3UZQA 1J0ZA 4F7CB 1H9VA 1TIUA 3I75B 4OTXH 4JFDE 3ALPA 3CVHL 5TGBA 1U41A 1H0DB 1NGXB 1P4BL 4M61B 4RZCB 5MEQB 4KRLB 3SDDD 3KYKH 4OBSA 5HYSG 4IRSD 1NGZB 4Y89A 5D8JH 4NM4L 3PIQB 1RJZA 4X6DA 4PGEA 2PTTB 1X5JA 2KBGA 2BVQA 3MV01 5E8PA 4ZD3H 2DWDA 1I8MA 4ESKA 1UWEL 2QR0A 1OTUD 3QIWD 2MQ3A 5D71L 2LV4A 4I3RL 5SWSE 5FO8A 3CK0H 5J1AB 3G04A 4HS3A 3J8F7 5L2JB 4KRPC 5IHLB 4DUXA 4PP1C 1VADA 3OX8A 4LNRA 4Y5YB 4HIEB 1S5IH 2DQUL 5F21B 4JM2B 3GSOA 2BNQE 4QTIL 3NGBC 2F74A 2XY2A 1ZGLP 3TJEH 1RU9L 3BWUC 4ISVB 4PJ7A 4QXGL 4JQIL 4OKVA 2ZKHL 5MENE 4OLXH 4CRPA 3JWOL 1UYWL 1GZPB 2J8HA 1NDGB 4YAQA 4FFWC 1GGCL 1E4WH 4TSBL 3VWJC 1MHEB 4ZODA 1JZ2A 4V2CB 2DQEL 4L9DA 2E7HA 5D70L 4I48A 4FG6D 5LGJB 1G7IA 2HFFB 5DZOA 5EZIH 2EH8H 5L6YL 1K5NB 2XRAL 5A16A 3I50L 5IR1A 2AXFA 4ENED 2OYPA 1AI1L 5T5NG 4NUGH 3MRPA 1G9NH 1HKLL 1MWAB 3KVQA 4PLOB 2FECI 1RY7B 1QR1B 3D0LB 3S97C 5K9OB 3DRQA 1DTUA 1HHGB 1KJ3L 3AS0A 3RVWD 3GFUA 1LHZA 4WUUB 5CINL 2IANE 3MRBA 1AGDA 3EOTH 4FN0A 4EN3B 4NKMB 3RU8H 1DFBL 1GGBH 5CS7A 3PABB 3WUZA 2AQ1A 1KCRH 4HAFA 3RUGE 3LD8B 4LVOB 3RWFA 5FAAA 2CR6A 3LH2H 1VHPA 2I5YH 1I85A 3VXOB 4PGJA 1YNTA 1JNHA 5EZJA 1WISA 4Y1AE 4Y19E 2K7QA 1X6LA 3U4BH 3UTSA 4Z6AT 4PRHB 5SWQA 5F3BA 4R26L 2VQUA 5ID1A 1HI6B 4PB0H 1VFBB 5DWUL 3FB8B 4M5ZL 5J6HA 5T1DL 4X6FA 4NHCL 5F1OB 4XCYA 3GMRA 2XT1B 3U7WH 2UUDH 1ZHKB 2XICA 5JORB 2XTJD 4PGCA 2NZIA 3BISA 4AJ0A 3H8NA 3SEPA 1CZ8H 4YHKH 1O7VA 4WEMB 1BZQK 1RIHH 1WUNT 1DDHA 3FMGH 4S1QL 3CFEA 3QXAA 3FFCE 3QWRA 3BJ91 4X6DF 1LO3H 1RIVL 3MLWH 3QUMA 5F88B 2Z31D 5I9QC 1KN4H 2VABA 2RR3A 3EYFB 4NO2B 3TP4A 4G6ML 2JJSC 2BERA 1DBML 1PJ9A 4HPYL 3LHPH 4K94C 2FO4A 5EBMA 1JRHI 1YEKL 2DJUA 3MRGA 4QNPF 1CCZA 4Z76B 4GKZA 2OM5A 3C87A 1KV3A 4G8GB 2F53B 4JVPA 1J1XH 5ESAB 4TSAL 4PJ7F 4JFZL 3H9ZA 1NBVL 4X4ZA 3V4PL 5CEXB 3HG1E 4HZAA 5GQBA 5JXEC 3PP3K 2EDDA 1B0GB 4F9LA 3QDJB 5GZOD 4ETQA 4Q6IA 3U30C 4EDXA 1IARB 3R06A 3OKEA 1SMOA 2P7TA 1A3RH 4IOFC 4AIZB 1T5WB 3MLZH 2M26A 4XCEA 3QJFA 1A6ZA 4LOUD 4O00A 3OB0K 4WIQA 2BX5A 1FNEA 2AXGA 3K4ZA 2J5LB 4HH9B 1L0QA 1G1CA 1Y6KR 32C2B 3BAEH 4YO0A 1ZT1A 4C54A 3LEXB 1CLYL 1RUMH 2JIXD 5IOPA 1D5ZA 2FB4H 2L7UA 1LEKA 4I3SL 3UBXB 4LARL 3SDYL 3WS6A 2ATKB 1FH5L 4KU1A 5INDB 3WN5B 4PD4K 1P6FA 3QBTB 3C6SA 1ZGLA 5C7XL 4NQCD 1X5KA 5JQ6L 1DZBA 1B4JL 4NKIL 3TBVB 2A73A 4OQ1A 1T6VN 2LU4A 4RA0C 3O45B 3T0ED 4UIMB 4YDVB 2G60H 3S36L 1I9IH 1T0NB 4MAYD 1I8LC 2A9ML 2FYYA 2DDQL 5GISL 2BFVL 4AG4H 1U8QB 2A74A 4JFED 1II4E 1DANT 43CAB 1UJ3C 1A14H 1DEEB 4X0KB 1E4XH 2X4RA 1TENA 1KOAA 1CGUA 5D7KD 3FRPG 4P5TD 5ERWB 3DO3A 1ZHNA 1SVZA 3M07A 4QRQB 2X70A 2JJVA 2R1WA 5DD3L 2EXYC 5HY9B 2YK1H 3MQIA 1KG0B 4QRTB 4M7ZB 1LK2A 5E5UB 4XI5C 5FKAB 4JY6B 4LGRB 4PJXE 2ZOKB 2ITCA 3QAZC 4HGMA 3MJ7A 4S0TD 5GJSH 2Z91B 5E8EB 2D0HA 5JOEA 4CDHA 3EO9H 2NY5C 5K9QI 3NCYS 1VEMA 1Q72H 4V2BA 5JW4R 1QSEA 3WNOA 3VMNA 4G9FA 2IADA 4XZUB 2COQA 3O11B 3Q6GL 3DO7B 4BH8A 3VFMA 4PJDA 4P4RA 5D1XC 4AEHL 3QWOB 4NQSA 4ZFOB 1J5OL 4LU5H 3FKUS 3ZZ1A 3X13B 4HKXA 5SWSA 4J3TA 3QXWA 3MLYL 2IC2A 5C0DA 1EVUA 5AZEL 3H42L 2RCSL 5D4QA 3T0AA 1S9YB 1XGYH 5GRUH 4ZQKA 2BNQA 5GSVA 1JF5A 1R5WA 4FFYH 4L8CA 5KVDL 4PRIE 4RGOH 2Y06H 1W0WB 1MFDL 3FONA 5EO9A 5MENA 1UWXH 1FV1A 3S8WA 1NJ9B 4XCCL 5GSRA 3RBGA 1U3ZA 2C1PB 4FQPA 4WU7B 1U8PA 3BFOA 1RUKH 2FD6L 4GSDH 1OSZB 2VDPL 4JQXA 4P2QE 3MV7E 4IS6B 3GZKA 5JO5B 3WIFB 4U0RB 4LCIH 3TBTA 1E4WL 4HS8H 1F4YL 4GAJL 4LLQA 3V6OC 2APTA 4Z0BL 3O2DL 3BKMH 4PJFE 1YDPB 3KPSB 3DYOA 2Y07L 1JGLH 3WHE0 2GIYA 3NCEB 5T3ZE 2F54B 4LVHC 4L8BB 3V79C 2R23B 4F58H 4X6BB 2AJUH 4PRDA 4HUNB 4NPYA 2VAAB 2EO1A 2PXYD 2IANA 4WW1A 1BVLA 4JB9H 1T1ZB 3RUGA 4K2UH 4YHPA 3VWKC 2UWEB 3HRPA 1VA9A 2EE6A 1L9NA 5IBLC 3SKOB 2ICWJ 4YE4H 1CFQA 5ADPL 4Y4FA 4NJAL 1T04B 4YDIH 4Y1AA 4Y19A 4LSTH 3GSNA 3R0MA 2O61A 1AQKL 1U8MB 1AY1L 5IF0B 4Y16D 3LS5H 4HKJB 1JNNH 4IOSD 4QRRB 5J3HC 3RDTD 3ZT5A 4UBDC 1QBLH 4GOSA 3KPNA 4ZXBA 1A1MA 3H9HA 3SY0B 5H94A 5I2IB 1PG7L 4QLRA 1Q9KB 1A0QL 3S4SA 4PJDF 5F72S 3O3EB 3FFCA 5HHVL 4JFHD 5HHXL 4PJ5D 4KGLA 4DVRH 5CMAA 6FABH 1X5YA 3TPUA 3RVXC 3B9KC 1MHCB 2NY0C 4M7KH 3ARGB 5C1MB 1CZ8L 3TT1H 1RIHL 3HAEB 5T1LD 1U9KA 4JHAL 1NUGA 2GSIB 3NCBB 4DKEH 3JV6B 3DSFH 3S34L 5DSCA 3WSQH 5GGUB 1A5FH 4FQJH 4O2FB 4UV7H 3GSRB 3RWJB 2HT3C 1P2CA 3QIBA 1RJLA 3C8KB 3M8OL 3OKDB 4OJFH 3HG1A 5FHBH 3VXUE 1W72A 2CKBB 4G6AD 2V7NA 4PJHE 3T2OA 3REVA 2HH0H 2VH5H 1IM9B 5E6YA 1DE4B 1HHHA 4AT6B 2X4TA 4OD3H 4LHUA 3Q48A 1RK1B 4RNRA 4KQ3H 4XVJH 3OKNA 4FQHA 4TUJB 3R0NA 4Y2OA 3VFUB 3D85A 1U3HD 3ZKND 3NFSH 1FYTE 3O2WL 1GAFH 5DA0B 1KENH 4D0DA 5ACZA 3U9PH 2HJFA 5GRVK 1B2WH 4EUPA 4PFEA 1SHMA 4NO0B 5EA0L 1QRKA 1MI5E 4K71C 3IDGB 3KHQA 1L7TL 2CPCA 2GAZA 2GHWB 5IT2L 1PAMA 4RFNC 3VE0A 3UXFA 3MNWB 4X7SH 3S37H 3LZFL 2R0LL 3PV6A 4L8SA 4LLDA 4WHTB 3O4LB 3RUGF 4U1KB 5F6IB 3QG6A 4K94L 4FP8H 3WL9A 5D1QA 4O9HH 3X14A 3TWCH 5EU4B 2PW2A 1NSNH 2W9EL 1C8PA 3CDFA 2P5WD 5C9JA 1IT9H 1FSKB 5AUMB 4JHWH 2G60L 4X5WB 3THMH 2VC2H 2X7LA 4UV4H 1I9IL 3L3IB 4EI5B 5D5MB 5HVHC 1NFKA 1AKJD 4NQDE 5E2VL 3FQNB 1F58L 3MV11 4BH7B 3VA2C 3CU7A 4KRPD 4PP1D 1NL0H 3DV4A 1XGQB 5H37H 2V7HB 2X10A 1OB1A 3L3GB 4LVNC 4YHOL 1NCDL 2HTKC 4JY5L 3OAUL 1FIGL 5HGBA 3ARBA 4PJXA 1CQYA 4FFWD 1EFXD 2XKUA 1Q0YH 3VWJD 3RWHA 2CIIA 5F1IB 4JDZA 3MOAH 2YBRB 4NZUH 2CRZA 4XPBL 2QTEA 5FYLH 3DROA 25C8L 2E5EA 5FA3B 1WBXB 3V0WH 4GXUN 3HZYB 3HC4L 5C8JB 5IFJB 1MCSA 5HHPB 3IDMA 2YD6A 5DJDA 2DRUA 1I1YA 5DLMH 2FX9H 3TESA 2DTMH 1RJYA 4K3JL 3AREA 1F00I 1M6OA 2OTWB 1JMXA 2VSCA 3FQUA 5IJVB 5KSBB 5IW1B 5ITBH 4ZO6A 1FGVH 3UTTD 3WE6A 1T1WB 2NY6C 4H88H 3CVIL 2V5RA 3O3AA 5FO7A 4XNZB 1OAUH 4IRJC 1MCFA 1FL3B 4PRIA 4I3GA 1KPUB 2MJWA 4UILH 2I27N 1HIMH 1RZ8A 2ENYA 5MI0B 1DBAH 1W0YT 3WO3B 3QDMD 1A6WH 5CJQH 4KROC 3I3DA 4P2QA 1JPSH 1HWGB 2H2SC 2EYSA 3VI3E 3TT3H 1I85C 2JB6B 2NY5L 2W9LA 2JLLA 2DBLL 3RKDC 4U1GC 1I7TB 1UQSB 4JZJA 4GSDL 4JRYB 3FQWA 4PJFA 5FB8A 2V9RA 3U6RB 1P5UA 3WCYA 4D9QD 3IJHA 3LS4L 4PRPE 1KB9J 2R69L 2VDOH 3P9LA 2GTZB 3INUL 3MRCA 5E00A 1EAPA 2O26U 3EYVB 1RULH 2GT9A 3D39D 2P8PA 4JHZA 3T0XA 4AZ8A 5CBEB 1RZ7L 4M4RA 3T3ME 1MRDH 4OZHB 1QFWL 1X5FA 2AJUL 3KPRD 2BNRB 4M93C 2XNAA 5CIPH 2E7MA 2VZ3A 3N9GL 2VISA 1A6UL 1AP2A 5EULV 1BHGA 4L1DA 5JXED 1MVUA 4JZOB 5C70A 4PJXF 1HKFA 2Z35B 1LQSR 3CC5B 3LRGA 4IOFD 4H20H 4JLRA 4WDIA 2DMCA 4PREB 3QUXA 3O8XA 3WHXA 1AFVL 1BQHA 3VFNB 1X5ZA 4NQVA 3U46A 5D7SH 1U3JA 1HHKA 1KT2A 3WFCL 4P23A 2EECA 3ZE2E 4MZ3A 3OV6A 5DYOA 3VXRE 1NGWA 2FCBA 3CSBA 4Y2DB 1JJUA 4ELMB 1QQDB 1UXWA 4WV1B 2WINB 4UIKL 4MA1B 1LEIA 4Q6IC 5BJTA 5GS0H 1AO7E 3KNBB 4WCYH 5L2KE 4W81A 1FZOA 2GI7A 3LCYA 1H3WM 3L6FB 1J1PL 3QXTA 3DVGB 3CFKB 2Y36H 3OKMB 4GQPH 4C56D 3VXPA 5IBUB 3DI3B 2H3NB 2VXVH 3S6CA 1Z2KA 4KHXL 5C0EA 4UTBH 5DJYB 1F4AA 3W82A 3WS6C 2FBOJ 4MSWA 1SQ2N 1AH1A 1ZA3B 4GW4A 4FQ1H 2EIDA 4CKVX 4QOKA 4JO3H 3VXUA 5J7CC 1YN7B 1NLDH 4KY1L 1KTLA 1HILA 4FFZH 5ACMA 4HJGA 5FYKE 1E6JH 1FQ9C 1RUPH 1R3IH 4A6YL 5I1KH 3F5WA 3QNYB 4Z8FL 5IVZA 1CFSB 1X5AA 4WW2A 2KPNA 3H3KA 3TZVA 2ATPA 5CUSL 2N56A 4HK0B 1M7IA 1GHFH 3CUPA 1GIGH 3O0RH 1FYTA 2DM2A 4MQSB 2EXYD 5DJ2B 4WHYH 5EWIH 4Q58C 4PJFF 2B1HH 4PP2B 2IALB 4RQQB 4O02L 4LAQH 1D3CA 4D3CL 2W38A 1MI5A 5D2NB 1ZVSA 3PHOB 2WAHA 1ZA6B 4FRWA 4X8XA 3RY4A 1FL5A 1KENL 1D5BB 1MIML 5M94B 1BGXH 3GI8H 1PG7W 2G5RA 4PYGA 2VLJD 4KUZL 4PJIB 4HIIB 1KUMA 5TQ0L 1DQLH 2EEDA 1H8NA 5E99H 2VITA 3VI4E 3U7YH 2BY2A 5EBLA 5D1XD 3HE7B 1H5BB 1ES0B 2B8OT 3HFML 3IXTA 4F37K 1P84J 3WMSA 4NNPH 4TVSa 1LNUB 3SGDH 4KK8C 4EVNA 1MHHB 4NQDA 4M6ML 4KZEH 5HGDB 1YYMH 4DZBB 4JANB 5I8OH 4NFDA 4WEBH 4P2RB 5DXWA 4XP4L 5I1AB 3K2UH 5D6CA 4F7MB 3OAZH 3VXNA 2AJSH 1ZKAA 1G9MC 2O5XL 3QO1B 5ECJE 1FZKA 3G6AA 3C8DA 3RGHA 5LWYH 3QCUL 5JR1H 1DQTA 3WNKA 3NZHL 5H2BA 5JW5A 1BD2D 5F9JB 4LSQH 2E9BA 4CU8A 1I1AA 1T3FA 2Y5EA 5E6IA 3PWPB 4HFWA 1T83A 3ARSA 4LHQB 2PNDA 4UINH 1VDGA 4R3SB 3VXTB 4OUUB 1NLBL 4DGIH 5T1KB 1AXSB 4WU5A 5FGCB 3WIHL 3MRDB 1G6RL 4XXDA 1LDSA 1UM4L 3KPPA 4PG2A 4JQXC 4GXVL 4OCSL 3TO4D 5FOBB 4UT6H 1IFHH 4HXAH 4OZ4A 4HUUA 4M3KB 4WW2F 3L3KB 3WXVH 3IDNA 2NY2C 4NYLB 3VWKD 3UTQB 1IM3A 4AM0A 1IAIL 1UM5L 3MYJB 3ROOB 4RX4D 4XB8A 5IBLD 1VFAB 2BVOA 1U42A 5FHAL 2YPLD 3BI9X 2W07A 2HLAB 1ONQA 2DM7A 4JFQB 1BECA 3UYPA 3D25B 5AEAA 1B88A 2EH7L 3PDOB 3SJVE 1LO5B 3V7AG 4LCWB 4M48L 1TJHH 1TZGH 4RFOH 1K8DB 1Y6MR 1FE8H 3SDXE 3BD4A 5JIPA 1S9XA 3H0TA 5J3HD 1KJMA 3QUZB 4UBDD 1WWWX 4XP6H 2NW2B 4L4VE 4M62H 3S3SA 2L7JA 4ODXB 5FECB 3CLFH 3LMJH 5IJKA 4AL8H 2GSGA 4Y4FC 3VD4A 3IAQA 1G7LA 4X7TA 3S9DB 1A6WL 1F90H 1QYGL 1RZJC 5I1DB 2K3TA 3DXAB 2BVPB 2Z8WC 3V6FA 4FZ8L 1IGFH 3NFPA 1BWMA 3DGCR 4PRPA 1NMAL 3RVXD 3B9KD 2NY0D 5FV2A 4TOYH 5KVFL 1IC4L 1IKNA 1CLZL 2AI0L 4GMSH 1IAOA 1MCDA 2OI9B 4TSCL 4U1SB 1BX2A 1ORSA 1RFDH 4B41A 5DRWA 3KPOB 3GHBH 4HUWB 4JN1L 1U8LA 5I6XC 3GDBA 1D9KA 3CXDL 4JO4L 4R0LB 2HT3D 3MRHB 3WYRA 4TULH 4ALAL 3BH8B 3BEVA 3OJDA 3DECA 1U8HB 4HDIA 1EEZA 4UUJA 3MLVH 1T7YA 2DKUA 4WFHE 1VEPA 2DMKA 1NCTA 4XNQB 5D7JB 4RAVA 5C0BA 4POYA 4P99A 1JV5B 1CT8B 5CHNB 1J87A 3JWNC 4YHNA 5KN5B 3C5ZD 5E56A 1FAKT 3BWAA 4TNWF 1CE6B 1KPVB 1EFQA 4MJ5A 4NQTA 1N5YH 3DIFA 1MWAH 3EJJX 4P3DA 1A7OL 4BQCA 3ZSSA 3QIBC 4M6OH 1UG9A 3E8UH 3RL1B 3VXRA 2ID5A 3D3VD 4MA7L 4ZTPL 3MRJB 1EO5A 3QCVL 3EO1B 4YHMH 3QQ4A 5GJTH 1IC7H 1AO7A 3W39A 2ESVA 5D96C 1ZLWH 4OM0H 5L2KA 4UTAL 3DX8A 1ZHLB 2VLLA 3IETB 1DSFL 4K7PY 5DK2A 4OLWL 1N59B 4BM7A 3RGVA 1RUQL 2CD0A 3U1SH 4ZUVA 1YN6A 2NZ9C 1PQZB 2EE3A 4V1DD 2J6EA 4X83A 2BHZA 2OQJB 3LV3A 4E9LA 4PB9H 8FABB 3CSGA 1N2RA 2VDQL 1GOHA 1S7UA 5J89A 2YEZA 4C59B 4OIIL 5BV7B 3QDGB 1WZLA 1K9TA 3DVFA 5HVWA 2VZVA 4X5LA 4XBGB 5DJ8A 2PO6B 3V52L 1FFQA 4XRCA 4YNYA 2EDJA 5EZLA 4YR6B 2WM0A 4J1UA 4UNUA 1NAKH 3ULSB 3WFEH 2AEPL 5D1QC 5CILL 5EOTA 4X6EB 1EX0A 5I19H 1IGJA 4UDUB 5BZDB 5JHLH 1MH5A 4L29B 1WIPA 5HI4C 5BMFL 1W0VB 2HTKD 3WKNA 3NN8A 3G5YB 4JFPB 3CXHJ 2NXYC 1EXUB 1CS6A 5KS9A 5KSAA 1PSKH 1UKSA 4K9EH 2FL5A 1JPFB 4HX1A 5JZ7C 3O2VL 4PGBB 3QPQC 4GAFB 1G7QA 4AMKH 5HYJE 3OXSA 3GKWH 2A0LC 1QEWA 3T3MF 5MEOB 2G75B 1UB6B 1OAYL 2MQCA 5C0GB 1S7RB 1I4FB 1WC7A 4QHUB 3ARBC 1XCTA 5I15L 4AQ1B 4HIXL 4M9OA 1RZKC 5IMMA 3VCLA 2DMBA 1D6VH 3P73A 1A2YB 2I9TA 3HE6B 3B6SB 3SKNB 4OCRH 3WV0A 3E2HC 1KEGH 1BVKA 1Y18A 2DS4A 5C09E 4OLUH 3C6LA 2VLKE 5BRZB 2I24N 2XWTA 2ZSWB 4NNPL 5TDOB 1O5DT 3ARFB 2NY6D 2ZUQC 3ZE2F 1FDLL 1U92A 1S7SB 5E2JA 3AREC 3NIGE 3G5VA 2JB5H 5EH1A 2NY4B 2XZQL 1NBYA 1UCBL 3X11B 2DQCH 3KPLA 1NC2B 4X4YB 3MOQA 1MPAL 4PR5A 5IW6B 1HQ4A 1NCNA 3ALWA 4KROD 5TE4L 1SJEA 4QHMA 1HHJA 3V4VL 1K4CA 2H2SD 4KKCC 1INDH 3LEYH 3DYPA 3O6ML 1HH9B 2ZUXA 5DMJB 3MV9E 5CZVL 3IJSB 3RKDD 4YBHA 1DQDH 2APFA 2CK2A 2WUCH 3UTSD 4JFYA 5AZ2H 1QTYT 2J3SA 2MPAL 3DHMA 1BFOA 3X3FH 5IBTL 3MNZA 4C58B 4CNIB 4XVSL 5DURB 4D0BB 4HF5L 1YPZA 4JRXB 4ZAKA 3W9DB 4O2EB 4YGVB 4N0UB 2CMRL 4B53A 3PGDB 3VFSB 1C16A 2FJGB 5GGSB 1G6VK 2CIKA 3QWRD 4D9LH 4JZJC 1FNAA 4GXUM 1GCFA 3BZEB 2IPKB 2APVA 4FTVE 3CPLA 3FQRA 3IFPA 3CU1A 5EIQA 5F7UA 2JKXA 2P47B 1YEGH 2CDFB 1F3DJ 2R2HB 4R7DB 4C83B 3QA3A 5KS9F 1U8KA 1KC5H 3SDXA 4I1NB 4OAWA 2YC1B 5B3JF 2DD8L 4NCC1 4AIXA 5CJBA 4L4VA 5HBBA 2AJXH 2CK0L 3MNVA 3KYOA 3VI4F 2P5EE 3QFJE 4TUOA 5CBAA 5KAQF 1UXSA 4IIQA 5T1MB 2IF7A 5DJCA 3FHAA 1YEEH 3GBLA 3O6KL 1HDMB 3U82B 5KANG 4OV5A 1E28A 3QUXC 5F97E 4Z18A 4X80L 1KJVB 1HSAA 4LLUA 1X7QA 3TN0B 1G7JA 3DUHA 1YNKH 2MKWA 1GGIL 2ZPKH 4OI7A 4LCUB 1J18A 2W0KA 4P23C 4ZFFA 1KCSH 2QV2A 2ARJQ 3P9WB 5ALBL 4XAKE 3MACL 1KBGH 3FO2B 4B7LA 2PYEB 3G6DH 1RV6X 4GMSL 4YDKH 5IMKB 2LU3A 3JSSA 4OGYH 1CG9B 3A6BH 3GMMB 4OLVH 4HXBH 2ADGA 4PRBA 4M5YL 1ZVYA 1EEUA 2C26A 3VDCA 2BVEA 4JDTL 4ODBD 2J8UE 4PRHE 3L5WB 5SV4A 3RWEA 4BKLB 4QXUL 4Q0XH 3QRGL 4PY8I 1RIUH 3GB7B 1NFIB 2FECL 5JDJA 2B20A 3IKKA 4OGZA 3JTTA 1U2HA 5HYQB 5JLZA 5D7LA 4O4YL 2Z4QA 1V3JA 1CK0L 4ZYKB 1ZLVK 4GS7C 4U6HA 5F7WC 5EBWA 3BD3A 1HE7A 1DVFB 1TQBC 1LO2L 1SYSA 1TTFA 3AY4A 2VDLL 3CLEH 4HLZG 4WW2C 1R24B 3EYUH 1YPZF 3ARDB 3TBWA 3TZVC 4ZG1A 3QO0A 1FVDB 1JTOA 4YK4B 3VRLE 2ZJSH 2D7MA 4U6VH 3ZTNH 1MJ8L 3IVKB 1INEH 1F3RB 4JDVA 5EUKB 3GM0A 1RPQA 1S7VB 4WHCA 5BCAA 3MLUL 5J6GA 1CFVH 5FYJH 3ZHKA 3DV6A 3CMOH 4K8RC 4KK8D 2ORBH 3LPWA 4RMUA 3IU3A 3SDXF 4HAGA 4JO2L 1CGSL 4PTTB 1QSED 4E42B 3BP7B 4JO1L 4O5LL 2AW2A 4G9FD 2Y5TB 4IJ3C 1AHWA 5I30L 4CJ0A 2R8SL 4GQ9L 2R4RH 1ACYH 5IEHB 5KTEH 1ZTXH 1ULVA 4OB5H 5J1SC 2NY7L 1M4KA 1JRHL 2X4NA 5SWSD 1W72L 3BT2H 4ACPA 4BSVB 3RAJL 1UWGL 3SO3C 5I0ZA 3SKJL 2BNQD 2AKRA 3ZYJA 3EOAA 2B4CC 2HN7A 3CMGA 2CKBH 5C86A 5E9DB 5I1EL 2IBGA 2ERJC 5MEND 4OLZL 5GIRB 4DZ8B 2R0ZL 5C0AE 3SKMB 3C9NB 4XNUL 1I1AC 3NCCB 3G08A 4PYHA 5E6IC 3P4MB 1T83C 4OSUH 1D5MA 1WVZA 3KPTA 5TH2B 1AQDA 2F5BL 2VLKA 4FQIH 4E0RB 4H1LA 2NY2D 3ECBB 4OGXH 5CKAA 2X4PB 3SQOH 4Q9RL 3LN4A 4U49A 5DQJB 4CADA 2FWOA 4JVWA 5C9KA 3FB6B 3DX6B 2VB5A 4YHIB 1P7HL 1J0JA 2O5ZL 3OKYA 4HWBA 4PG2C 5EU3B 3T4YA 4FQ2H 3LQAH 5I16B 2ZUTA 1XIWA 1FC2D 2IAND 1NBZB 2YD5A 3QEHB 5IB1B 2WUBL 3KJ4B 4HC1A 2A6IA 4OCWL 1ZMYA 4F7CA 1DN0A 3I75A 1KXQE 4TPRH 5C0IA 4EBQL 4Y4FD 1UFUA 5A3IC 3MV9A 1OT2A 4Y1AD 3FO1B 3DUSB 4LF3B 3BGMA 2GUOB 4M61A 4PJEB 4JPWL 3HI1A 4RZCA 3IJYB 4WO4A 5D72L 3N1FC 4BK4A 5C0CB 1OGTA 3PIQA 3ILPB 2PTTA 4FQCL 4XPTH 5HYSB 4R2GC 2YUWA 2OR8A 4ZXBD 3B9AA 1RZKL 2UVEA 4WWKB 2E9JA 5IJKC 1TXKA 2QHLA 1TZIB 3ZE0E 4P3CH 5CJOL 4L3CB 3FFCD 4Q2ZA 5F7NC 4MS8C 4Y5YA 3WS3A 3K3QA 4FTVA 4FQLL 4YHLH 1JP5A 4JGUA 5AYUH 1SJHB 1IKNC 1A1OB 1QFUH 4X8JB 1MRCL 4G6KH 1U3YA 3T77B 5FUOL 4OZGB 3CX2A 3O41A 5E08H 1GZPA 2EYRA 1NDGA 3K8MA 4KJPC 4NKDA 1QFPA 4LSSL 1MHEA 3BN9C 4IRSB 5LXGL 3VGDA 1D9KC 3F62A 4M7LL 1CXIA 3GUTA 4QCIB 1MCOH 3QIBD 1BVZA 2P5EA 3QFJA 2HFFA 5DMKA 3HG1D 1BF2A 3S4SG 3MRQB 4NN5C 5AWNH 3QIWB 4IMKA 5EU6E 5J9PA 5HHMB 2VZ1A 1TTGA 5E2WL 1F3DH 1G84A 4YQXH 2GFBA 5KW9L 5EN2B 3V5HB 5LCVL 4LHUD 2IQAB 1QR1A 4B0MM 3A67L 3STLB 3D0LA 4HCRA 3P30H 4R9HA 3D85D 1J1OH 1V7NH 3ZTJG 1HHGA 1J10A 1RUAL 2V5MA 3UO1H 2L4OA 2ADFL 2NZ9D 1V3MA 1Z5LA 4I2XB 3S36X 3WEXB 3PABA 2DQHL 2P45B 3FQXB 3HI6H 3FB7A 4U3HA 3NIGF 4ZOEA 4CBPA 1URLA 3BQUB 3BESR 5T3ZL 1GGYA 5IQ7L 2P49B 4PRHA 3RGVC 3AS3A 4YLQT 3A6BL 5DUPL 2Y25A 2PYFB 4NWTH 4OV6F 3HRZA 1BOGB 1T80A 4TQEL 4PJAE 1J05A 4LHUG 5EB9A 3WUWG 2AXHA 5D1QD 1CXKA 2ZSVA 3T2NL 2E27H 2HFGL 4XMKH 3U4AA 1ZHKA 5A2JH 3QEGH 2CJUL 4DEPB 5HI4D 4UU9A 2HA1A 3V7MA 1MRFH 1NAMB 1OWWA 3GMLA 1FNFA 2OMBA 4LMQI 1DUYB 4GBXA 3QG7L 2NXYD 1TETH 1MQ8A 3FTGB 3SDAA 5F88A 5CCKL 4GAGH 3OB8A 1XF3B 2CGRH 3ARPA