2AGJH

Crystal structure of a glycosylated fab from an igm cryoglobulin with properties of a natural proteolytic antibody
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
226
structure length
226
Chain Sequence
b'EVTLKESGPTLVKPTQTLTLTCTFSGFSLTTTGEGVGWIRQPPGKALEFLAFIYWNDAKRYNPSLQSRLTITKDASKKQVVLTLTNLDPVDTATYYCARTSGWDIEFEYWGQGTLVTVSSGSASAPTLFPLVSCENSSPSSTVAVGCLAQDFLPDSITFSWKYKNNSDISSTRGFPSVLRGGKYAATSQVLLPSKDVMQGTDEHVVCKVQHPNGNKEKDVPLPVVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Yvo Fab, Light Chain
molecule tags Immune system
publication title Crystal structure of a glycosylated Fab from an IgM cryoglobulin with properties of a natural proteolytic antibody
pubmed doi rcsb
total genus 38
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2agjH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2agjH02
2CUIA 3VG9C 1L9MA 2DM2A 1HHIB 1YEEL 4GW4A 2F74A 4CBPA 3DBXA 1NEZB 3JUZA 4EDXB 4POZD 1QSZA 4UQ2B 1RIHL 3Q1SH 4YQXH 5ENWB 4C58B 1WWWX 1T1XA 3M1BB 4XP9L 1FYTD 4I9WE 3O2DL 4OLXL 5K9JH 4YAQB 1OTTC 3PDGA 1IAKA 4LLMA 2AEIT 2AABH 5KS9E 3IFNH 4HC1L 5KVGL 3U7WH 1NGYB 4NQED 4RMWA 2WLYA 4Q9QH 5EU6D 3W2DL 2D31A 4Q58C 4R90L 1J0KA 1NC2A 4OCWH 1P4BH 4JQIH 1ORSA 5JXEC 4PUBL 3BZEA 5I8OH 1NKOA 1E6JH 1G7LB 1T20A 4HMDA 1I8IA 1WAAF 3BWUC 3EYVA 4R26L 2FWOA 2PCPA 1VEPA 2VL5B 4HJJL 3O2WL 4QGTA 4AY0A 1XCTA 5EH1A 1N0LA 4X9BA 4JDTH 5B4MD 3WUWB 2BHYA 5CIPA 5A3ID 1K6QL 1N26A 1DBML 3FFCE 5IT2H 1JRHI 3QJFB 3LHPH 4XGZB 3BP4A 4U1IB 4NUJB 1A1OB 3IXTA 5JO5A 2ZUWA 4HGWA 3VFNB 4EEEA 3B5TA 2LAGB 4P2RE 4XCCL 4KDTA 2MKWA 3I3DA 2IALB 1JN6A 4F15B 3U82B 5DD1L 4N5UA 4M3KB 2OJEB 1IKFL 1NDGB 3D85A 4Z7QE 3RUGB 3DXAE 5JUEH 4R97C 1V7MH 5ICXB 4JHBA 1JMXA 3TZVD 4JY5H 4K7FB 3BZEB 1V8HA 3OJDB 1PJ9A 5GGSY 3HNVH 3VA6A 1IKFH 4XNQB 4Y16A 5CEZE 1J7VR 3O2DA 1KBGL 2B1HH 2YUWA 5DHYB 4XCCH 1JGDA 3MV9A 1JPTH 4W81A 2P48B 4AG4H 3T0VA 3HI1B 5CFHA 3MXVL 3W11D 2GSIB 1EGJH 2DJUA 4FTVD 4LF3A 3NIDF 4KJQC 1LE9A 5T1KB 2XWJA 1DANU 3HB3C 3DI2B 3UJIL 1EERB 4JN1H 1OCWL 3H0TA 3O6KH 1G9MC 1MI5D 1DBMH 1WV7T 2W9LA 3EOAB 2CO6B 3DROA 3TA3C 4JRYE 4S1DD 4D94A 4HJJH 4R26H 4G80A 3KR3H 1YEDA 3ARFB 5GGTA 2GTZA 2G5RA 4K3JL 4YXHL 2X4RB 1P4BL 3MBEB 4Q97A 3W2DH 3DXAD 3RWDA 5DVNA 1YNKL 2X42A 5KVGH 4D2NA 4UV4L 3RPIA 3Q6FA 1AGEB 4HC1H 3VE0B 2BY2A 3IFNL 2GT9B 4YDIL 4JZJC 2AABL 2XA8L 5F7DB 2VDOH 1RZJC 4K3HA 1QFHA 3WO4B 4ELMF 1MWAB 5ABDE 5HGBA 2EC9U 2I9TB 3OKOA 4K9EH 4OLEA 4XP9H 1MCWW 2E27H 2OP4H 3RGVD 4LQ1A 4LLUA 1CDHA 4YQXL 2BC4B 2E7LC 3DGCR 3JTTB 5DRWA 4YXKL 2IANE 4HUWA 2YPKA 3MFFB 1OTSD 4JDZB 3KPQA 2G60L 3ZMRA 1YEEH 4LOUC 3LEYH 3S5LB 5DK3A 3F7VB 1KUMA 4OCYH 4PJCB 5CBEA 3DIFA 3R06B 3WNNA 3ULVF 3IDXL 4PLJC 1S8DB 3C60B 4ZQKB 1I8LC 4M1GH 3KLHC 1JPFB 3VW3L 1KFAH 2NLJB 3OHXA 4GRMB 4HUMB 3S7GA 4K23H 1FGNL 1BQHB 3IRZA 3UYOD 4YAQA 3PV7A 5MENB 3RWEA 1NGXB 1V3LA 3QEHA 4P4KD 4Y4HA 1S7XB 4P2OC 1YY9C 3AM8A 2DLHA 3QR2A 5IEKA 2BDNH 4I4WA 1BWWA 3PHQB 4L4VB 5C0RL 3VXQB 4Z8FH 1RUML 4QRSA 1INEH 1IFHH 1E4XL 5EFIB 2P8LB 1KCRH 1KYOK 4G6ML 4TSBL 3TWCL 1N6QL 3O4LD 1IMHC 1XR8A 5I1JL 3BXNB 1JF6A 3KLAA 2HMIC 3PXJA 1KNOB 3CUPB 3TO4D 3QXTA 25C8L 4J4PA 4CJ1A 5EIQA 3TV3L 4PP2A 1EFXA 2FO4A 1MFAL 3Q6GH 1X5GA 2BOCA 4K94H 2Y07H 4EI6A 1E4JA 3ESUF 3UEZA 3HRPA 4OZGB 1LEGA 1Y6NR 3FL7A 4CMMA 2ITDB 4ESKA 5CEZD 3WN5A 1CFNB 3HLAA 4PYHA 1U8HA 5CGTA 1QRNA 1RZ7H 4F58L 1MIEH 5EC2A 4FQCL 5LCVH 3KYKL 3QRGL 1GH7A 4WEBL 1FZOA 4LPYA 3BVNA 3E6HB 2BSSA 2GJJA 2M8XA 1PZ5A 3WYRA 3ARGA 4IOFD 4NKIL 2O93L 1TNMA 1CGYA 4MD0A 4XMKL 1YN7A 2VMFA 1GPOH 4P2QD 3QDMD 1CS6A 4FTVB 2WUBL 4RX4A 4WI4A 3HAEB 1CU4L 3UTTA 2Y6SC 5INCB 3B9KD 4PB0H 4U1IA 4G7VL 2YRPA 1QACA 4HPOH 4YHIB 2NYYC 1FFRA 1RJYA 1W72B 4OQTL 1H3WM 1SJEB 3A6BL 1J8HB 2KUTA 1S7RB 4AEEA 2C3VB 2IALA 5FK9B 4ZUVB 4P2RA 1S9XB 3ZHDA 1MFCL 4PBWD 2HKFH 3MOAL 3ZYIA 4PJ5B 3S36H 3MBED 1NC2D 3OGCA 5GZOD 3CVIH 2AGJH 2IAND 3FQUB 3OKKB 2VAAB 2FO1A 3GK8H 4JG0H 2PUQT 3VG0H 4CVXB 4RQQB 1IC1A 3MACH 5EPMA 2GJ6B 2V2WA 5F7DA 2A6KA 4J12A 5CILL 1J1PH 1RZIA 4KQ3L 4HIXH 3F65A 2NY4B 4TOYL 4XPHL 4FTVA 4X4XA 3BD5A 4TRPH 1U8QB 1R3IH 3T0ED 3CX5J 4LLVB 4YHPB 5D72L 1I85C 2XZQL 2H2SD 1JPST 1MFNA 3DPBA 5IW1A 2FJFB 3MFFA 4I8DA 3ZKXC 1DLFL 4JY6A 1MSPA 4XAKD 5GGVY 4W6YB 5E2UL 1WCQA 3ZL4L 2J3SA 2CRMA 3LY6A 3WXVH 2DQHH 3MJ9A 5CD3A 4UOJA 4FNLL 4HUVA 1AR1D 4G8FA 4E42A 1YNTB 4R7NA 7FABH 1CR9L 2DQGH 3CZFB 1UEYA 5DJ2B 1HXYA 2ICWI 1HYSD 1QSFE 3LKOA 5EZLB 5B3NA 2CKBL 2H3NB 4FQLH 1I75A 4I5BB 1EEYB 3W11C 3Q6FB 3VE0A 5BCAA 4WI5A 3TBSA 4P4KB 4X6EB 1T21B 3O4LE 4JFYB 1M05A 3PHOB 4LSPL 3GKWL 5I71B 2DLFL 1Y18B 4BQ9A 5FO9A 4PIRF 1OT2A 3QWOA 3RTQD 3QQ9D 1JVKA 4V1DD 2EYTB 5GISH 1ZXQA 4X9FA 4QRSB 5FKAB 5CJOH 5TFSH 4WO4D 4IIQA 4D0BB 3HE7C 2I5YH 3SY0B 5CD3B 2BNRE 2EDXA 1MWAH 5HGGS 2GFBB 4LHUD 1KYOJ 1S7SA 4Q9RH 4PB9H 1S8DA 5J8OA 1A1MB 4ZOAA 1T7ZA 3IGAB 4QHMA 1F4XL 1EVTC 4M7KH 2Z8SA 1C1EL 1OSZB 4OLZL 2VR4A 3KPLA 3WKMH 4D8PA 4ONHB 1T80A 2WM0A 4YHOL 5ESQA 5T33L 3ZT7A 5D5MB 1XAUA 3C8KB 2R0ZH 2EICA 3FRUB 3PP4L 4P5MA 4AQOA 3QCUL 4MA1C 3TM6A 1VPOL 4GG6B 1QEWB 5CLWA 2BSSB 3BZ4A 3OZ9L 1RZGA 1YEJH 2CD0A 4XPAH 3W82A 2XQBL 2NXYD 2FL5A 1A4KA 1DQTA 4XC3H 4NNPL 1J1OL 4AMKL 5I17A 3ZDXF 2X4OB 1NBZB 2NY2C 5DXWA 1OVZA 1WBYB 1YEFL 5BO1H 3N85H 1OP3K 3BKML 4KHTH 3ULSA 3QFJD 3L95A 1P4LA 4KKCD 2LU3A 1TJHH 3KPTA 1LEGB 2H1PL 2FR4B 5IQ9B 2OK0H 5KVFH 1I9IL 4BFIB 3PP3K 3TC9A 2WUCH 1S9YA 4P2RB 4LDEB 3VXSB 4K8RH 5I8EB 1FNSL 5AWNL 4MGXA 5DF0A 3OPZH 4AYFA 4XZUA 3U0WH 3QI9A 4JFOB 3QIBC 2PYFA 4NQSA 1XH3A 1G0YR 5I1AB 3BJLA 1CXFA 1XGPB 3FB6B 5E5RB 3UPRB 2C3XA 2B5IC 3MREA 3MO1A 1R3LB 5CEYB 5LBSH 1CE6A 1ZTXH 5DURB 1A3LH 4TULL 3MLZL 1CL7L 3FOLA 4ZFGL 2R2BB 4OD1H 1H5BA 4Z7NF 2YRLA 5GZND 1GCFA 4F7PB 1CD1B 3GJEB 3IYLW 4ODWB 1CXLA 2A6JA 4WW2C 3CXDL 2K3TA 2J5LC 4Z0BL 4J4PD 3T0XA 2C3VA 5D7JB 5FYJH 3IAQA 3DRQB 4U0RC 5DRZA 1E6OH 1OL0A 1HXYB 1RK0B 4IOFC 1YPZA 3QEQB 5DMJB 5C0CA 3EFFA 1ZHKA 1J05B 2AXGB 2H3NA 4EKXA 5HI3D 4IJ3C 3TP4A 4HKXA 3FT2B 1NGZA 3FN0H 2YPLD 4ZDHA 3FN9A 4W4OC 4X7SH 5HHOA 1MLCB 3WFDH 4QOKE 1F6LL 1RZIB 5BRZA 4NM8H 4BSVB 1A6AA 3QQ9C 1A7QL 3ZZ1A 4U1LB 3ZE2F 3FOLB 4YDKL 4JVPA 4ZAKB 3MLTB 4K55A 2GAZB 1AI1L 1UM5H 2VLKA 4YFDB 3L3DB 2GCYB 5F7WC 2YN5A 2WMPA 2FCBA 2E7LA 3VXMA 1PKQE 3G9VA 4KROD 4OF6A 5T5NF 2AEQH 1HHJB 5FYJU 1XGYH 1OAZH 3QXVA 2XWTA 1FAKT 5DMYA 4EI5B 5C08E 5JPMA 3ARBD 3MLYL 5GHWL 1HE7A 4ZUWA 4YDVB 1ITCA 3LKOB 2JJSA 5D2LF 3OKMB 4ZDHB 1ZT4A 4XX1G 4LLWB 1PAMA 1RPQA 2DYPD 3H7BA 3CFCL 3OGOE 1EEYA 2X1PA 1ZT7B 4DKFH 4PRAA 4JO2H 3SJVB 4WHTB 5EO1A 5GS2H 2LTQB 3DX7B 4DOHB 5DD6A 4NGHL 5CZXD 1OT1A 1LDPL 4KWUA 3FQWA 2VXSH 1A7RH 1UJ3B 1T7XA 4JPKH 5HI5C 5M94B 1AFVH 3LAFA 5I1HH 3ME0A 3SCMB 4X6CB 4P57A 3ARFC 4YNYB 3DURA 4FQ2L 1J86A 4HC1A 3D3VE 2CIKB 2QKIA 3MCLL 3SCMD 3AUVA 4XWGL 4YDVA 5MI0B 3VWKA 1U8JA 1ZSDB 4KUCF 5IMLA 3NH7H 1MRDH 4PLKC 3UTQB 3A6OA 1U36A 4DVRH 5GRUH 2FR4A 2W60B 3IGAA 2EIBA 3O8XA 3FO0H 4XBEL 1BHGA 3DBXB 4DUWA 3GMRB 2CLVA 3EO0B 5FM5M 3G9AB 1QZ1A 4U0QB 1YPZE 2X4UB 3PG2A 1OAKL 4LPCA 4HV8A 2KPNA 1DQLH 1FNGA 5DJ8A 5IGXH 3CDCA 1T1XB 2CLZA 4UINL 2DJ4A 4FQ1L 3H9HB 5TPWH 3VFGL 4HKZB 5FO8B 4TUKH 4KMTH 1SM3L 3OAZK 4HLJA 5CHNB 3GIZL 2FNBA 2R0LL 1T5WB 4I77L 1MCFA 4L8SA 4PJAA 1N3NB 4JY4B 5D2LA 3D25B 4Y4KD 4ELKB 4ZAKC 5EU6A 3LKPA 3JWOL 5GGQH 3RVXD 3OG4B 1OSPL 2ZUYA 1VHPA 5F72S 5KZCD 1AJ7L 2XTLA 3WUWA 5D1XA 2CR6A 5EU7C 3GM0A 1OM3L 1X6LA 1A3RH 3DUUB 4G9FE 5J0BA 4MZ3A 2HFFB 3HMWH 4PJFA 1BM3L 4N0YH 4MQXD 3QIUD 3IXTB 4LL9A 1CTNA 3QIBA 2D7TH 5D6DA 4L1DA 5CSZA 3MJ9L 1GZPB 1BJ1H 4MJ5B 4R2GD 1KEGL 1FSKC 1MRFL 3BPOC 4G5ZL 3QDME 3VXNB 4UILH 1TJIL 3NAAL 5ADPH 4JQVC 1NGZB 3QI9B 1RJLB 3BH9A 4JKPH 1A6TB 1OPGH 3MTRA 4Z7QF 1L0QA 1HILB 3L7FB 4HWBL 5D93C 3RL2A 4GQ9H 3CDGA 1IGIH 3QNZA 1BBDL 3EYFB 3KG5A 15C8H 1IGFH 2HYMA 3MV8E 4CJ0A 4Q0XH 3CU1A 4KKCC 1KTRL 2AJSL 4ZS6D 1NCAH 1GGCH 3OX8B 5CINH 3WFBL 4LPUA 1R0AL 1HN1A 4LSUH 3QBTB 4R6UA 2JE8A 4M7LL 5A1AA 3DARA 1CLZL 3QDMB 4CAGA 2W65A 5FGCB 2ICWB 3BDYL 5ESVA 2CRYA 1YEIL 4X7EC 1EEQA 4YDLB 5IR1B 2A6IB 3Q0HA 2EDQA 4L8BA 4X4YA 1MFBH 1MI5E 4LCCB 5F9WB 1RIUL 4UT9H 3CK0H 5B38G 1MCPH 4OLUL 5KVDL 3SE3C 4ODVL 4OF8A 1QFOA 5I16B 4P9MH 4PG2A 4HXAL 2A77L 4MAYA 1X4XA 1P1ZB 5C6TL 3SBWA 1Y6MR 4XCEA 1XF2A 1XZ0B 3DUSA 3I85A 3T3PE 4F7TB 1LQSR 12E8H 3WDIA 1AQKL 1MEXL 2FB4L 5C08A 3GBMH 5C7XH 3K74B 5D7IF 1W0WB 3ZKMD 4LRIC 3ZE2E 3AVEA 3FB7B 1UKQA 4X4ME 4HH9B 2CLRB 4HK0B 3I84A 2OTUA 1K2DA 1S7VB 4NO5B 4OAWA 1NFKA 5IV2B 4MXVE 5GRJH 3I50H 5CBAA 5ISZE 2F54D 1IAIM 2HA1A 2C7UA 1QSEA 4P57B 3H9SD 3FB8A 4DAGL 4IIQC 1UYWL 4YPJA 5DYOB 3IF1A 4RMRA 4OCXH 1UFUA 4X99A 3TO4B 3I2CL 3NA4A 3BP5A 1YQVH 2Z93B 3U9UA 4QRQA 1RHHA 4LSTL 4G8IB 3MXWH 3KPRA 1I9RL 4U6XA 3UC0H 3UTQA 5EZJA 5HGHA 1Q0XL 1QTYT 2NYYD 1FNEA 2A83B 3KJ4C 3VWJA 1N59A 2DQIH 4NKOB 4IOIB 2HJLA 4KVCH 1LO5A 2FECL 2G75A 5LXGH 2QQNH 2NY6C 5DA4A 1RSFA 1OP5K 3FRPG 4RGOH 1FIEA 1JNLL 1UJ3C 1RI8A 4J3WA 5DGRA 1PLGL 5DVOA 1JPFA 1B0GB 3VGDA 4KPHL 3HZKB 3H9HA 4F2MA 1NCBL 1KB5L 1MJUL 1FORL 1OAUH 1CK0H 4OCRH 3D1MC 5TQ2L 3OWEA 4JM2C 2FGWH 3MQIA 4WWKB 3RJDA 3RVUD 5T1LA 4HIJB 1B88A 2AQ1A 3G04A 2VUYA 3HNSH 4CDGC 4IBLT 4X99B 2HJKB 2B0SL 1JNNH 5EA0L 5M95B 5F7EH 3F7YB 5HDBE 3ROOA 4NJ9H 2CIKA 2QKIB 4U6YA 3PGDA 4LGPB 4NKOA 1MF2L 3RNKB 3S3SA 4K2UL 4PRBB 1NLBL 4R8WL 2V6HA 3ECBA 1IGCH 4FXKB 4IRZH 1HYRC 1WZ1H 4PJHA 4CN1A 3G6DH 2UVEA 2BNQE 4BZ2L 5L9DL 3IDIA 2FO4B 4JG1H 4NHCL 4NUJA 4PJGB 3G6JA 1YPZF 2VDPL 5F89A 4HKBA 4J3VA 5DJCB 4P5TA 2CIIB 4YFLF 1GC1L 5E1HB 5IBUG 2X5PA 1R6VA 5T3XH 3GSNL 4L8SC 3QUKA 4O5LL 4UIKL 3SPVB 3IS1X 4HDIB 4PJXA 3GMOB 5JOEA 1RURH 3IETB 3L7FA 5GRZA 5DURD 4TSAH 4Q9BA 5ANMA 1KB5A 4NQEE 4WJ5B 3O2VH 5EORL 3FTGB 3RX5A 3LCYA 1U3HA 5KG9B 4F7MB 1PZ5B 3VRJA 1C5CL 3MNWB 3T0EA 4NZDA 1BQSA 1TZGH 2EDFA 2VLKD 1KT2B 3EO9H 2DQDH 3QH3A 4PGEB 4FQXC 5CD5D 1QSEE 4HX1A 4LIQH 1OGAA 4MDIA 2VXQL 3WHXB 3UTPE 1JGVH 2LVCA 4MJ4A 2P49B 3G5XA 3T1WA 4WU7A 4M6OH 2A6IA 5IMOA 4HXBL 1MHHA 5FIEA 1F3RB 1VGEL 4NSKB 2ADIB 5JPNB 3V5KA 2XRAL 3OJMB 3BOVA 5I1CL 2JLLA 4DCQA 2DYPA 3EOAA 1YEGL 3E8UH 3MRBA 3JWDC 4HF5H 2BXYA 4WFHD 2IFFL 4TYUA 3VH8B 5ANMB 4NWTH 2GY7B 1IAII 4X4MA 2A6DA 4LBEA 5B4MC 5EIIA 1ROWA 3RHWK 4MWFB 4ODSH 3BWAA 5T3ZL 4DGYL 5JIIA 3PIQB 5TQ0H 2DLGA 4PBXA 4C59B 3MRRB 4OGAD 1NSNL 4G42A 1AGEA 4PJIE 5EZOL 4GW1B 5BJTA 3LZFH 3UBXB 4OCSL 2HTKC 2MQCA 1AXTH 4Y4KA 5LGJA 2D9QB 4GAYA 4X0KB 2JJSC 6FABH 2APFA 2BVQA 3M8OL 3FMGL 4TQEL 1WTGT 2VOTA 5J12C 4L8BB 4DKEH 2Y06H 1G7MA 4S11A 3VFTA 3BT2L 3HG1E 2B4CL 1FNEB 2A83A 2V5YA 1M7XA 1JN6B 2X4TA 1LNUA 3FQXA 4UIMA 3V8CA 3BQUC 3T1FB 1BD2D 2ZCHH 4N8CL 4HFUL 3R06A 4ONFH 2ZCLH 3RUGA 2AXHA 4I18B 5ITBL 5CKGA 2I24N 2R39A 4MX7B 3U2SB 4CU7A 4MA1B 4FP8H 4R7DB 5F9OH 5E2WL 3CXHJ 4WI9A 4Y19A 3GSUA 4B50A 4WUUE 4JFYA 4RBPH 1J5OL 2EDHA 5TE4L 4HIEB 1AHWC 5I9QC 3BE1H 5D2NC 3RIAF 1FO0L 1XR9B 4NCDA 1YUHA 4XT1C 3GSRB 1EA9C 3ETBF 4FFYL 3EIFA 3VGBA 4QNPE 1T04A 4JAMA 4YHNB 1NAKL 5ICYA 5EFIA 1MCQA 2ZG3A 4KI1A 4R4BB 2F74B 4HD9A 1S7SB 4I18A 2W0PA 3PWLA 4O9HL 5E7FA 3NCCB 1RZKL 4YH6A 3MODL 2WANA 4BJLA 4PJDA 3R1GH 4R7DA 4GKNB 2BOCB 2XV6B 3C60C 4OGZA 3UMTA 1JGLH 1NC4A 4OD2A 1WCBA 3HZMB 2VLKE 4I0PC 2ERJC 4JKWA 4URTB 3QEQD 5BV7C 4YBQD 2C3WA 3QWQB 3RAJH 5FOBA 2DWDB 3GI8L 1IAIL 2ZUTA 4APQB 4NZUH 3LQMA 4XMPL 4G6JL 4ZUUB 1SMAA 2J8UF 4OGYL 1QRNB 4U7SA 1SY6L 5C08D 5E2VH 1MQ8A 3ARZA 1A6WH 4XTRC 3UBXG 1SHMA 2FEEL 4GG6A 4K3EL 1Z9OA 4KK6D 1I9JH 4LRNH 4NQDA 3HHRB 4KTDL 3W81A 3KAAA 1TITA 3QHFH 5BS0A 5ALBH 2O5XL 3GM8A 3ZE1F 1LO4L 1J1XL 4PGBB 5E7BA 1AE6H 2HRPL 3ZDXE 5I17B 3OG6B 2MFNA 5GGSA 5J89A 1LHZA 4UDTB 5C0GA 1U93B 3B6SB 3FO2B 3BO8B 3HMXH 2FIKB 2IAMD 5KVEH 3RWGB 1HHGB 1YY9D 1DBJH 3ARXA 5FCUH 2PTVA 3C5ZD 4JPVL 5C92A 1RU9H 4NRZB 4QXWA 3OQ3B 1FPTL 3LN9A 2MHAB 5DFVC 3TA3B 5HYIA 1PKOA 5I8EA 4ZUUA 5DQDL 2ZKHL 4WTZA 2HFEB 3EZ8A 2WIMA 2RFXA 4IHOB 4FXLA 5DMKB 1I4FB 3D9AL 4XP4H 1VFBA 5H94A 2R4SH 4OZFG 5EO0A 4I4WB 3GHBL 1FYTA 2MWCA 3MLSH 4PV9A 4QO1A 2FD6H 4EXKA 3CLEL 4A2MA 1DZBA 3LD8B 4N1HB 3HG1D 3LPGA 2AJXL 4JGJA 4RDQG 3X12B 1Z2KA 2XTJC 2J88L 2AK4B 4NO3A 2VLME 5IESH 4OLWL 3UTZB 2YA2A 2UVFA 4NRXB 5AG9A 2BNQA 3P9MA 4K3DH 3MLRL 4MZ2A 1WSST 1XCQB 1S5IH 3B6SA 3FO2A 1NGPH 3QG6A 5F9JA 1HHGA 1QFWL 2PN5A 4NWUL 4LLVA 4F7EB 4PTTB 1BJ8A 4PJ9C 4KI5E 4S1RL 3ARBB 1B4JL 1YNLH 5ESAB 4Y1AE 5KSBE 1J8HE 5F1IB 2EO9A 5J1AA 5IB4A 3CFKB 1B2WH 4ODWA 4ZUTB 1BIIA 4EN3D 4JY6B 2VLJB 4G6KL 1U58A 3S88H 1QYGL 3C6LA 1QQDA 1YDPA 2X89D 3RVWC 3CX5K 1XMWA 2PW2B 4FA8A 5BOPA 2VABB 4PJIB 2YMXL 4F3FA 3WUZA 3ULUL 4MNGA 3TIEB 4BFBD 5DTFB 3P11L 2AJVH 3R0MA 5KSAC 1LO3L 2B20A 4OD3L 1MQKH 2AI0H 1AC6A 4M8QA 4U6VH 1V5JA 3OKEB 4DN4H 2YK1H 3MLVH 4CNIA 4Q6IB 1MLCA 1LD9B 5K9QG 3UTZA 5ANME 3VDCA 4Y0GA 1FH5L 4XPFH 3UYRL 1KTLB 2PXYD 4NYLA 3SE4C 5F9JB 4N1EA 2Y36L 1U8IB 3O3DB 4YHIA 4G7YL 1L7TL 2ZCKL 5IB4B 3OF6D 1MNUH 4LLDA 4U2YA 4F33A 1DEDA 3DRTA 3T0AA 3C6LC 5CZVH 5D7SL 2JJTC 3WMSA 2NY1C 2F8XC 5I19H 1L7IL 4GSDL 3IJHB 3L5WB 2D7QA 3B9VA 1G84A 4X5LA 2DQJL 5EUOB 4OGAC 3TYGL 2DQUH 5CP7B 2GFBA 4KU1A 4OLVL 5BXFB 4YHZH 4DEPC 1BGXH 3NA9H 4Z7UA 3S34H 3EHBC 1BFVL 3IDNB 4M61A 3UTSE 1FLRH 5D2LE 4I0PD 3OKMA 3RL1A 2EDRA 5IHUL 4NQEB 1MIMH 1WIOA 4S1QH 2NY4D 1OSZA 3GSUB 4R2GB 1UVQB 3MRLA 4CKVX 4HKJB 1CLOL 2MQ0A 2Q20A 1MHPH 1KTLA 5FUZH 3C5SA 1OWWA 1JK8A 1S7QB 4OM1H 5ACZA 5JR1H 2VDQL 4OZHE 3U36A 4QYOB 5EBLA 1D6VH 3QXUA 5A2LH 4YUEH 1U0QA 4PRDA 1MI5A 4JFPA 1IEHA 1E27B 1KIPA 1HEZA 1T04B 4JAMB 2IADB 4DVBA 3JWDH 3O3BA 3MA9H 5HYQB 1FZKB 4HMCA 2V7HB 1TQBC 1KPVB 4Z7WA 4LHJB 3KPOB 3DXAA 3HZYB 4OIBA 1INQB 4R96B 2QQLH 5JHDA 4FQIL 1CGSH 4IRSA 4FFWC 5EO9B 1T6VN 3PWNA 2Y25A 1H3PL 3JV0A 3TBWA 4FZEH 1B6UA 5T3ZE 1OHQA 3OJ2C 3MNZA 4J1UA 1CDCA 3TBYB 3C5JA 1YEKL 4DTGL 2CLZB 4O02H 3VXRD 1VFBB 1Q9OB 5EC1B 3VFOA 3LVEA 2B2XH 2J8UE 4WHYG 3AS0A 4PGJA 4MQXC 3A67L 5I75C 4UT7L 2XTJD 3LKRA 2QBWA 4GBXC 1E27A 3CC5B 2VE6A 1KJ2B 1NMCB 4Z7UF 4L8SB 4LSDA 4WI7A 1MVUB 1R3LA 5CEYA 4MNQA 1TVBB 3GBNL 4J6RL 4U1HB 2CGRL 1IGJB 1LP9A 2R9HD 2VIRA 2K9UA 3O6ML 2V7HA 5EB9A 5JW3H 1U93A 3TVMC 5J4MA 5HHQA 4GMTL 5IBTL 2V9QA 2V2TA 2FIKA 4NN7C 4QF1B 1INQA 4MQTB 2CRZA 3KWWA 2IQ9L 3NFSH 5HXMA 1RUPH 4ZFOA 3HUJA 4F7PA 3P40A 1ZA3B 2ITCB 4L29A 2AJZB 4KY1L 5EO9A 5MP6H 1H3XA 5I8KL 3RHWF 4NZJA 2HFFA 4PJFB 1IEBB 3O4LA 3WJLC 1WBZA 1NFIB 4B0MM 1T4KA 3RUGF 1II4E 2NNAA 4WFFE 3E2HC 3F8UB 1GZPA 4Z77A 3DRQA 4J3OC 1QR1A 2RFXB 4IHOA 4MJ5A 5T3ZD 3UPCA 2A9NH 2KZ1B 3FRPA 3QQ3A 3R0NA 5D6DC 5F70A 5JDSB 5JW5A 1RZGB 1IC7L 5EPMB 5FDWB 1ZANH 3WS3B 2BNQD 4GKSB 5DHVA 3REWA 1YMMB 4YHLH 4Y4FB 4FFZH 3A0OA 4EVNA 3MLPA 3O3DA 2F54A 4KMLB 1RZFL 2EYSA 3VRIB 5F3HB 1W0VA 4JRXB 2NW2A 5IWLA 4ZAKD 1G9NL 3HCVB 5CEZH 1P4LB 3C6LD 2OMBA 1M7IA 1JTPA 1Y6KR 1ZEAL 5EUKB 5JNYA 4LMQI 4U1JB 4GFTB 3C6LB 4XVTL 2YZ8A 2WINA 1YEHH 1F11A 3QIWD 3GGWB 1X5YA 3MBXH 4RX4D 3DO3A 4PRHA 1LEKA 3T2NL 1NCDH 3EFDH 2C3HA 1WF5A 4QTIL 4KKLD 4MNGB 4HZLA 1HCVA 4H88L 4QTHA 5I1KL 3MV8B 5GGTL 3Q5YA 3LOWA 3TBSB 5AZEL 3NFPB 5DD5L 1BBJA 2NR6D 1AD9A 3LKQA 4ISVB 1MHEB 2ATKB 4L3CA 4WHTA 5EO1B 3TT1L 4F7TA 4OJFL 1OLZA 4XXDB 5INDB 5MEOB 1WT5A 2R23A 1EO5A 2A38A 5D7IE 4EN3C 4QKXB 2NXZC 2VXVL 2BERA 4XI5D 5EZIL 5FKAA 3RVWD 1B6DA 4U1KB 3IXAA 4ZSOB 4Z95L 1XF3B 3A6CH 3TBTB 3BD3A 4BZ1L 3HA0A 1WWCA 3QCVH 1KJMA 1X5HA 2C1PB 4UZGA 3CSYB 3VXUD 1IM3B 3IU4L 5IHBA 3TO4A 1CXEA 4Y8AA 3HS0A 1RHHB 2AJUH 3O45A 2DL9A 3DURB 3HB3D 4OGXL 5KANI 4KTEL 3KLDA 1BFSA 5ADOL 2IG2H 1D9KB 3STZB 4IMLA 1EO8L 3L3JB 3T4AA 1BEYH 2Y5TB 3AY4A 4JR9H 4NUGL 4JANB 1D9KD 2R15A 2IMMA 1N7MH 2VC2H 3RDTA 1QBML 2OJZL 3V0VB 3K2UH 1M6OB 1WFUA 1PSKH 5IIEA 3T2QA 1YN6B 3EO1A 4X7TA 3G6AA 3QDJB 5FYLE 1K5NB 1FZJB 3S35X 1HNGA 3C9NA 4CU8A 2AQ3A 5ALCH 1RJZB 3V4UL 2E5EA 5LWYH 2DIAA 3UZEA 1LMKA 3ARPA 3QQ4A 4NKMB 3LSOA 3T8XB 5I1IL 4PPTA 1F5WA 4PY8I 5HTSA 3MRQA 5HDBF 1NBZA 3SDDC 1LEIA 4D3CH 1Z9LA 4KJPD 2EEDA 3WIHH 1IQWL 32C2A 4CU6A 4KK5D 2EE9A 4L5FL 4UUJB 2VLLB 4JFED 2AEWA 1CL7I 3PWPE 1Q0YH 3UZQA 1RV6X 2XZCL 1ZT7A 2AV7B 5FYKE 5C0AE 5IVXB 3O9WB 2EDNA 5GRXG 1A7OL 4RMQA 4DK6A 3CFBA 1IILE 3C5JB 4HKBB 1RIVL 4PJHF 5FKPB 5DJ0B 3V5HA 3BEVB 4P5TB 1VADB 4I3SH 2C9AA 2BVTA 5I30L 5DUPH 4QOKD 2PYFB 4PV8A 3TCLA 3IVKA 1UWEL 4JVWA 3RWJB 4LGSB 5FDWA 1E28B 1IAOB 2BJML 3D69A 4RMUA 1VDGA 1UWXK 4W4OA 4GAGH 1NUGA 2HLAB 4MQ7B 3V2AR 4WJ5A 2GQHA 4LQFL 1NFDE 5GJSH 2EC9T 1S9VB 1A6UH 1X3DA 2HVKB 2P8MB 2UUDH 1A02N 3QEGH 3OKLA 5CEXB 3CCHA 1AD0B 2XNAA 5BZWA 4P9HH 1U8KB 3UTPD 4D0CA 5C1MB 5EUKA 4LOUD 3FO1A 4JFEE 1L6XA 3EYOA 5E9DB 5J9PA 4RISL 3GGWA 5C9JB 1CDIA 2P5EB 1UA6L 2I9LB 3O9WC 4RFEA 3K2MC 3B9EA 5MI0C 3DECA 2D0GA 1BWMA 1S9WB 3VI4F 3G5ZB 4LCWA 3V5HB 3P4NB 4HKZA 3BHBB 1QBBA 5F7UA 1FO0B 3QQ3B 3QULB 3U46A 3E3QE 4OZHA 5KJRH 3V7AE 4XNUL 4JB9L 5K93A 2FJGA 2XN9D 2VLRD 1G0DA 3H7LA 5IHLB 5JW5B 2ZNWA 5H37G 1U95B 4NOBA 2VERN 1G6RL 4LARL 4G8GA 2J4WH 4KJYA 5T5FL 2H41A 2EKJA 3INUH 1IC5L 3QUYD 4GS7B 4ZNCD 2OZ4H 1QBLH 2CMRH 3NCEB 4ONGL 5LJYH 3L5HA 4LDLB 5FB8A 1I3VA 5I6XC 3DO7B 2VWEC 5GGUA 3OR7A 4KZEH 3HE6A 4TSCH 1T1YB 3CH1B 4KKAC 4M6ML 2IGFH 5IV2A 1AQDA 1BVKA 5I15H 2P7TA 5E99L 4PJ7F 4PRHD 5IFJB 3C09B 2X9WA 2PTTA 4EQ3A 3DX9B 1NLDL 4GKZB 4LHUA 1ZLUK 4OFPA 1T0NB 5DEZA 2I60L 4KI5C 3G5YB 2Q1EA 3U9UB 2WWMC 3RWHA 1QKZH 4NN5C 1I1AA 3I02A 4UIMB 4XVSL 3OR6B 1D9KC 3K8MA 4B7LA 2W9DL 1MCCA 2E8YA 4U7MA 1H0DB 1BMGA 4RGND 1CICA 1P9MC 1YY8B 3BMWA 5DFVD 1KCSH 4PYGA 3WL9B 4Z7WE 3MUGB 1C5BL 3VFSA 1I7UA 5KS9F 1KN2L 1YN6A 5E6YA 2J6EA 3E6FB 5L2KB 4OSUL 1MY5A 4LSRL 3BKJL 4XVJH 4LPTA 4BM7A 4LVNC 5D1QB 3PWPD 4HIEA 4DQOH 1FCCA 1RMFL 1R3HB 5ISZD 3UJJL 4PS4L 4UQ3B 2G9HA 3HI5L 5TE6L 4FTVE 1KLGB 4YHML 4FG6D 4LCUB 4H8WH 3KPQB 5JOFA 4ZXBA 5L0QC 4L8DA 4GUPA 5IFAL 5IMMA 5E24E 1RULH 1FJ1B 3X3FL 1HCFX 1E4KA 4G6AD 4W4NA 2H6PB 3GMPA 5L6YL 1MJ8L 2NXZD 4ZPVA 3WSQL 1A14H 3SJVD 5BOZG 3MLXH 4P0DA 4GKNA 3HZMA 3QA3B 4ODHL 3DI3B 4FMFA 2QADC 4EUPH 1GGBH 2P43B 2A2QT 3LRGA 2B5IB 1IAOA 2ORBH 2CIIA 2FZ3B 3D69B 3T0BA 3RIFK 1T5XA 3IU3B 4XP6L 2C1OA 1KC5L 1UZ8B 4JCMA 5F3BB 3FHQA 3C5ZC 3VXUA 1JZ8A 4KXZI 4JY4A 3IDJA 2RQ8A 3T0EC 1QVOB 3BGFC 5A2KH 2P8PA 5HGAA 1KJ2H 3MNVB 1KT2A 1U8KA 3V8OA 3V6FB 1A7BA 1V7NL 2F5BL 4IS6B 4Z7VA 5GGSB 2D7NA 3RFZC 2AK1H 4XHQA 4OTXH 4L8CB 1MFEL 1E4WH 3MRPA 4HLZG 4G3YH 1QRNE 5T1KD 4NQCD 2UWEE 5LAXA 3VU2A 3G08A 3U0TA 2W9EH 3M45A 4J23A 4AT6A 2W0LA 1QNZL 2ZUVA 4NRZA 3GO1L 3ZKND 4MCYA 2VDRH 3MZTA 3M17B 5E0QA 1JIBA 3REVB 4J3SA 4IDJL 3CVHA 8CGTA 5E03A 4OQTA 3MJ8A 2EXWD 1ED3B 1KG0B 4PJCF 4LCIH 5BRZD 3K0WA 3CDGB 1ADQL 2R2HA 4G9FD 1PG7W 3KPMB 5EO0B 1WZMA 3THMH 4X6FB 4JE4B 3E6HA 1JRHL 4QRTB 4M8VA 4X6BA 3UP1A 3SKOA 1BZ7B 1VFMA 4JZJB 3JTSB 4K7FA 3BIAX 1IT9L 5JIKA 1S7UA 4YHKH 3CH1A 4Q6YA 5I9QB 2HWZL 2B1AL 1UM4H 4DGVH 4GMSH 1FVEB 4YHYC 1NBQA 4XMLH 1H3TA 4WEUD 3L5XL 1SYSB 3EYQC 4UTAH 4LHUB 2HKHL 4MQSB 4KI5D 5DJAB 1OP3H 4IRJD 3X13B 5GS0H 1ULVA 1KB9K 3W5NA 4JFEA 1BOGA 2OTPA 4XC1L 4ZUTA 3MV8D 3QUMH 5CWSA 1EHNA 4IRJB 5DMGD 1FRGH 5LKNA 3VD5A 1MJJA 3VXPA 1YDPB 5GSRA 4LCWE 1CLCA 1FL3A 1JWMB 3CFJA 2Y7QA 1AR2A 1KEMH 4C57C 2PYEA 1I7UB 3KJ6L 3GB7A 3DUSB 1FDLH 1XZ0A 3ARQA 1FFNA 2EDEA 3P0YH 4N0CC 4QOKA 5BRZE 4JPWH 1D5IL 5J57B 3T0WA 5I1DA 1UGNA 4WGWB 2PYEE 5SWSB 3RPIB 2VL5A 4O4YH 3ZYZA 2YKLL 3NABH 2WP3O 4FQHB 4PTUA 4AL8L 2BRRH 1NCCL 1T0MB 4GRWE 1NFDA 3WDHA 1CZ8H 1XF5B 3HC0B 5TH2A 3BAEH 1KLGA 4F9LC 1CI5A 5GGRY 4MB3A 5CSGA 3TYFA 5IFJA 4M6AA 4QXTB 3WFEH 3MZGB 4L8DB 2V17L 5AYUL 5DD3L 1A21A 1WUNT 4JDZA 3AM8C 3I6GA 1EJOH 1PY4A 4YHNA 4IOIA 1GAFH 3F7VA 1KENL 3IJHA 3DIFB 1YNTA 4R7NB 5DJ6B 3P4OB 4LCWD 4MAUH 2XXCB 3SDCC 4P3CH 1OP5H 4HT1L 5EIIB 1YY8A 2XN9E 1NBVH 3TT3L 4BK4A 2HTKD 5C0DA 4YWGL 3O6LL 5HI3C 3S37L 4KKAD 3E6FA 3GMQB 4JO1H 4YDJA 4HS6B 1IEAA 2LAAA 2DICA 4P4KA 2E9WA 2D03H 1F58L 3L1OH 4JRWA 4L1HA 3BPLC 5CUSH 1LGVA 3SDYL 2DWDA 1Y18A 3ILPA 5ACZB 3QFDB 2P46B 4OF3A 2RCSL 3KNBB 3U36B 2XFXB 1N6VA 5I1LA 4LSQL 3RU8L 1S78D 1U2HA 4NC1E 3ZO0A 1EMTH 2IMNA 4DW2L 4R4FH 3VGAB 3F7YA 5CJQL 3Q5OA 4LCUA 3T0DA 4I2XA 2YUZA 5IEKB 3V52H 4AEHH 3SDCB 1CD8A 1HEZB 3SY0A 3JUYA 4KAQH 5BS0B 3GSXA 3UO1H 3U9PH 4FXKA 3O3BB 3L7EB 3NTCH 3U30B 3DX8B 4LASL 4ALAH 1KIUA 3TZVC 3BXNA 2VH5H 4XNXL 1SEBB 4YXLH 2X41A 3G08B 2X4RA 4X7DC 3WIHA 4M43L 4OCMC 1TETL 2Q86A 2E6JA 1UWGH 5JHDB 1QRKA 3ZKNC 1HKLH 2W07A 4LNVA 5E08H 4ZMAT 4RA3A 1ND0A 2V2XB 1HINL 1Z3GL 1ZT1B 4OFYA 4XP5H 1T0PB 3TA3A 3MUY1 4G9FB 3D0LB 1YYMH 4C56B 3QB7C 4FQQB 4NQVB 2BVUA 5I76B 2GEEA 2XZAL 1IKNA 3BZ4B 2X70B 3LEXB 3D48R 4ZXBD 3BJ91 3SDCA 1P2CA 5D9SB 1JYVA 1ZLSL 5IM7B 5ICYB 5BMFL 1ITBB 5HDOA 1JNHA 4XNYL 3FKUS 4H26A 1YN7B 1RVFH 3AU1A 1ZVSB 3QJHB 5E2TH 5EIVA 4EBQH 1MHHB 3IKCA 2MCPL 1LP9E 3MRPB 5ILTH 5JIPA 4KZDL 4MDJA 1G0XA 4X8JB 4HGWB 2UYLA 3V6OE 2JELH 3IJYA 3KPNA 4K7PH 3QDHA 3DVIA 3U7YH 3AFLA 4Y19E 5F1IA 5HD8C 2HG5A 3ARDC 3VH8G 1ND0B 5I75B 1BLNB 3RKPA 5IOPA 5J6HB 3WHE0 1QQDB 3M17A 4APQA 1S7RA 1UACL 1NDGA 3D3VD 4NC0B 1N5YH 3QG7L 1T3FA 1ED3A 3GHEL 1FAIH 2I26N 5KS9A 5J56B 2X4NB 3ZHLA 1C7SA 3E3QC 2GITA 3KHQA 1H8NA 1YC8A 4H1LG 5B39G 3TO2B 1MVFA 4F57L 1U8MB 3TO4C 4ELMA 2UZIH 3PGFL 2Z91B 4M8QB 2P8LA 4P2QB 1CGWA 4GW1A 4NO0A 4O2EB 3GSWA 3SE9L 5BJTB 1XIWC 3RZCC 2A6KB 3CSBA 1XR8B 5A16B 1O7SA 4JRYB 3B2VL 4O58H 5EOCJ 3QCTL 3O6FB 4WI8A 1OB1A 1W0VB 3BO8A 1MAML 3GIVB 4L4TE 1T66C 4XPBH 5E4EB 3OAZH 1QO3B 2BP3A 1FV1A 5DUBA 4BFEA 1JGEA 5C0FB 4WI6A 5HYSA 1OP9A 2X4TB 3FQXB 5CZKA 3DRTB 3ZSTA 1NCWH 1U42A 4NM4L 1Q9WB 2NZ9C 4PBVC 4OZIB 3QIUC 1JTOA 3RIAK 3P4OA 3O3EB 1RUQL 5SWZA 4MSWA 4P5TC 4QCIB 4WWKC 4G8FB 4E42B 1X7QB 4RAVA 3RBSA 4R2GC 3VGEA 2R29H 4NNYB 3HNTL 3BN9D 3BP7B 2M26A 4F15C 4KK9D 1HQRA 4LSSL 4GAFB 4XCNB 2ZOLA 3H3PL 4HJ0C 3QT2A 3GNML 2QQKL 2WBWB 1MWAA 1AKJD 1A6ZA 1AO7E 3W0WE 3ZTJH 2GY5A 1D5ZA 4JFFB 4IJ3B 1OB1B 4CVUA 3MRKB 1U92B 1HH6A 3RI5K 4R0LA 4ZPTA 3KJ4B 1LE5A 3HFMH 1AGFA 4PGZA 2X1XR 2GCYA 5DJXB 5D7IB 3U48A 2UWEA 5GS3A 2Q8AH 5CGYC 1RUKH 4OZIA 3N9GL 3LMJH 4QRRA 2YA1A 3VFMA 3AGVA 2IADA 5I74B 3O45B 4LPVA 4X7CC 1MCIA 5GS1B 4ZUWB 4ZTOL 1DQQA 3QYCA 3I75A 3GRWL 3IAGC 1IRAY 5DT1L 2EDWA 3EW3B 4PJDF 4L9LA 4Z7WB 4OKVA 1WCBB 3MMEB 1CGXA 3MLUH 3KPOA 5DHVH 1X5ZA 4EUPG 5HY9A 2ARJA 4IRSB 2VITA 2ILLA 2JTDA 3VXSD 3NN8A 1OLLA 5D71H 4NBXB 1AGCA 1ES0B 3BRDA 4RCAA 3NGBC 4Y2OA 5DLML 3QDJD 4ZXBC 1F45A 4Z9KB 1KCVL 1EUUA 1BAFL 4PJ8A 1GZQB 4D0DA 4LLDB 3TNNA 4MA8H 5EOQL 3WXWH 1B0RB 4DGIL 5JA9A 3IDGA 4P23C 1JYXA 3RA7L 5FHAH 3WBDA 1U6AL 2ID5A 4KRPD 4KQ4H 3IFLL 4HPYL 3B2UC 3OAYK 5EOTA 3U30C 1DFBH 4PJEB 1BQLH 4M7JH 1IGML 5GS1A 1F3DH 1TCMA 1ZV5A 4MNQB 4KVNL 3CVHL 4OB5H 1OARL 4MJ6A 2CDGA 4NFDA 5FUOL 4IOSD 4QWWC 1JUFB 1HDMA 3HI6H 3BH8B 4JFQA 2EECA 5C2UB 4FZ8H 3C6SA 2OYPA 3MMEA 3MRFA 2Q86B 5DJYA 4BA8A 3RTQC 1A6PA 3O8XB 3H9SE 1EEUA 4NRYB 1CN4A 2CLVB 4AEIH 3SOBH 1ACYL 1GOGA 1NAML 2X4UA 4ODTH 2ZZUT 2VDML 1AKJB 2ZJSH 4UBDD 1AH1A 1ES0A 2OMNA 4HV8B 4LRIA 3K4ZA 3X3GL 1AGDB 1TXKA 4OKDA 3WFCH 1CFVH 4YX2L 4PV8B 1P84J 4NO2A 3BX7C 3BVNB 2EO1A 5FDYA 1DBAL 2FSEB 4PJFF 4PV9B 3EYSL 3LEXA 4NQXB 3B43A 2R4RL 1B0RA 2Q6WB 1IGYB 2EH8L 2VZVA 1XGPA 1NFDF 1CE1L 5FA4B 2BNQB 2DTMH 2HH0H 5I1GH 5TJWK 3C2AL 2XQYG 4Z18A 1T66D 3RBGA 4EOWL 4Q2ZA 3ARVA 5E56A 4KMQA 4HWNA 1YYLH 1O0VA 1LO2L 4X5XB 4GG6E 4X98B 4ZNEA 1PW3A 4HEPG 1MFDH 2R69L 1DVFA 3F5WB 3QUYC 5HYSB 4UU9A 2EH7H 1YECH 4KK5C 3V0WL 1DR9A 2GI7A 4YR6B 5DUML 1E4XI 1T22B 4JM4H 5EWIH 1WWAX 4KH2A 5D5MA 4POZC 3PP3H 1Q9OA 1PQZA 2NY6D 3QUZD 1FBIL 3ZDYE 1A7PH 3C08H 1F4WL 4NNYA 3VMPA 3U0PA 4HIHB 4KK9C 1F2XK 1YPZB 1MCLA 4JFZH 5D7LE 5DWUL 1J05A 2AXGA 2R9HC 2WWKO 5KSBA 4LSVH 3OKEA 1Q9KB 2FATL 3C8DA 2FRGP 3DHJA 1IE5A 4Z7OE 5I8CA 1A22B 1VFUA 1NMBL 3RL2B 3PWPB 1NMAH 4P4KC 4P59L 3DSNA 1VGKB 4NQCE 1O5DT 5E95B 5A16A 3JV4A 2R8SH 5CCKH 1NAMA 3DOSA 5TE7H 4RGNC 4XP1H 3QO0B 4ZPTB 3J8F7 1N0XL 1OW0A 1UQSA 2Q76B 1C08A 4RNRA 3MLTA 2GAZA 3VMOA 4H1LB 3MCKA 1T1WB 5DUBB 3BYTA 1OF2B 4MXQD 4PJ7E 3EBAA 4PJ9A 1CF8L 3FZUD 1F90H 1WBZB 2BZDA 1IM3A 5AEAA 4MHHG 4M5ZL 4X4YB 1JHLL 5I0DA 3UTTD 3ZE0F 4Z7UB 5E8EB 3SGDH 3RWIA 2FX8H 2PKDA 1X7QA 5GRVL 4P2QE 4E41D 4WGVB 4A6YB 5HYJD 4U1NB 1Q9KA 4IMLB 1DDHB 2XPGB 2Z8VC 4NZRH 5I8CB 3RZWA 2SEBB 2ESVB 5L88L 1I3GL 4HKJA 4LAQL 5HYEA 1WK0A 3I9GH 4LEXL 1TQCB 4JFFA 1FFPB 2JCCB 5L2KA 4QYOA 1G9MH 1OGTB 1S5HA 2YS4A 2CDEA 1C08B 1NL0L 2Z9TA 3EO1B 1OAXH 4HS8L 5JQ6L 5TDOB 4P23D 1B3JA 2HRLA 3ULVL 3PL6B 3L3IB 3U1SH 1KIPB 2DQTH 3H42H 1DQMH 3IDUA 5KSVB 3K8KA 4TPRL 3HC4H 3BN9C 5MERB 5T5NG 2C4XA 4OZ4A 3BP5B 5MEQA 4YNYA 1RK0A 1SQ2N 1P69B 1EVUA 4QXUL 5JA8B 3UROR 5EZJB 4HZLB 5DD0L 5EN2A 5IB2B 4QRPD 3AS2A 2XG4A 3N50A 1U41A 5F7FA 4QHMB 4PJDE 2DQCH 3WLWC 2HTLC 3MV11 4E41E 5FA3A 1OW0C 4R9HA 5EUOE 3WFHA 4LLYB 1BVZA 1B0GA 3EO0A 3STLB 5DK2B 4U4BA 3GSNB 2A74B 1K4CB 3TJEL 3V4PH 1I8KB 1NGQL 4LK4A 4I0PA 1PEWA 2MMXA 4M62H 3HPJB 4JFDB 3HRZA 1OAQH 1RUAH 3VCLB 3QXDB 3WEXA 5HDQH 1KN4L 2MKLC 1CVRA 3IDJB 2VQ1B 4JGUA 2FECI 1PFCA 2QSCL 4MQ7A 5D6CB 1IGJA 2P45B 3H9SB 5EOTB 3BKYL 4OT1H 5EN2B 2CDGB 2FHFA 3CGTA 4EN3A 4I3GA 4K7PY 3MGOA 3RNKA 1G7IA 1GHFH 1J18A 1PG7H 2BSRB 1HHIA 4GW4B 1BF8A 3FAXA 3FQRB 3NOIA 4V1DE 5C70A 2BSTB 2H26B 4NRYA 4OF5A 3K4AA 3WN5C 4N68A 3BPNB 4PGDA 3U0TB 3GSNA 2KDGA 4NDMB 1Q72L 4YIQA 1NGWB 3QDJA 4MNHA 4GLRH 1KTDB 3VXSE 3NPSB 1P5UA 1P5VA 4PY7B 1WQVT 3FFDA 2HP4A 4MD5B 3GUTB 4K3GA 1G7PA 1T2JA 3P30L 4PJFE 4ZOCA 3ALWA 1QLRB 5B8CA 3MR9B 1BD2E 4JHWH 4GKSA 4UB0H 2GJ6D 5DMGC 3O0RL 4N90D 4RDQF 3CDFA 3TESA 1GIGL 5GS0D 4K7PX 4RWYL 4S1SL 2F5AL 4HQQH 3EYFA 4XAWH 1NPUA 4M6NH 4W6WB 2Z31D 4M6NL 3OB8A 4NPYB 3K8LA 4XRCB 4X80L 4UUJA 3BISA 3V5DA 2YHGA 1HHHA 3ZDZF 4RWYH 3FZUC 2AXJA 2A6JB 4WUUD 1I8MA 2P24A 3DVNA 4U1SA 4UB0L 4R4NC 3KDMA 4NP4H 2AV7A 4XNZC 2ICWA 1U91B 5D7LA 1TJGL 5I66B 3S5LG 3ZTNH 1ZHNB 4NN7B 5JPNA 1QBAA 1NGWA 3HAEH 5E8NB 4NZTL 1UH3A 2ICEB 5FHBL 5JHLH 2AQ2A 3AY4C 3I02B 2BMKB 2RJMA 1FL3B 3OR6A 1F8TL 4UT6H 4TNWK 1JHKH 4YE4H 5GRYA 3WO4C 2HLAA 3D5OF 4H25B 1T5WA 5C2BL 4WTWA 1ZGLB 1AO7B 2O5YH 4HW6A 1GHFL 4XXDA 5INDA 3MUZ1 5IQ7L 1YMMD 3VFSB 3JV6B 1KLFA 1XF2B 1DL7H 4UNTA 4OT1L 4NPYA 4A6YH 2VISA 5IF0A 3QO0A 1AD0A 4KGJA 1P53A 4JO4L 1WLHA 2DI9A 1HXMB 2DQEL 4I2XE 3S4SB 4FABL 2JJWA 1DP0A 1UZ6E 5HDQL 4ODXA 1KIRB 1OAQL 4OZIE 3BKCL 1XF4B 4NJAL 1CD0A 1IJ9A 5DYOA 1RFDL 1DQDL 1AGBA 3TJEH 5E8NA 2E9BA 1FO0A 3WD5L 1MCRA 1NCTA 3QUXC 2DJSA 2E7BA 4FN0A 3UXFA 3DROB 1OOAA 5C0JB 4IRSD 3QNXB 3G6JE 3BSZH 1XGRB 3NCYP 4JDVA 1ZHBB 4FQJL 1T7WA 2HJLB 1AO7A 4WFHE 5KN5B 3LS4L 3B3IA 2G75B 3VRLF 5I71C 2GK0B 3VXOB 1HWHB 2EE2A 2XQYK 5E1AB 3P77A 1TZHA 3W9EB 1L0YA 2EIDA 5DVKA 2ZUSA 4QXUH 3VWJC 4PRPD 2R1XA 4MXQC 3F12B 1DJSA 1GL4B 5HHXH 4ZD3L 2YPLA 5KSAA 2L7JA 3RWFA 1HSBA 1T7YA 5IB5B 1TTFA 3CMOH 3VXUB 3U1SL 2R56L 3T4YA 1UCBL 1YUHB 7CGTA 5SV3A 3NBNA 5LQBL 5D4QA 2VDNH 2HJKA 1NL0H 2WQ8A 5J1SC 3S97C 1ZOXA 4EN3B 5JDJA 3O3AA 2IPKA 4PJ9D 3UTTE 5CP3H 4LAQH 4PFEA 5CIPB 4F9PA 1I3UA 3EDEA 2ADGA 3DETC 2JB5H 3B3IB 4M48L 1SEBA 5KW9L 5D7JC 5EUOF 4WW1B 3I6KA 5DVLA 1EDQA 3SGJC 3V6ZA 5HHME 4EDXA 4JJ5B 3N1GC 3KGRA 3RZCA 2NLJA 3M07A 5F9AC 4PD4K 2LABA 4H5SB 3VXTB 4KDVA 5HYSG 3QDGB 2CXGA 1P4IH 4MXWL 3QWRA 2NXYB 5MEND 4HCRA 2KKQA 3WIIH 3TNMB 3D18A 1WEJH 5CBAB 3WIFB 3WEXB 5HD8D 2FGZA 1Y0LA 5ID1A 1YQ2A 2VDLH 4ZOBA 1VKXB 1SEQL 3UTSD 1H3GA 3I6LE 1KGCD 4M5YH 4X9IA 5C0AD 5EU6B 5KG9A 3GSVB 1QFWI 4WV1B 1INDH 3QQNA 1L4IA 4Y5YA 2EXYC 1CFTB 1JL8A 4MA7L 1I8MB 2IF7A 5I0ZA 5IEHA 3RWCA 3DSFH 4UDTA 4W70A 3QIWA 1KJ3L 5BW7C 3I3BA 1N64H 1KOAA 2FATH 1LP9F 5HHPA 4HK3N 2DD8H 1EFXB 4NNXB 1ZK9A 2XWJB 3ARBC 4JFZL 3QA3A 1HOCB 3WKNA 4ZFOL 1QP1A 3V5KB 2ITDA 1TCRA 2D0HA 4GRWB 1OAYL 4JLRB 5LGHH 3MRHA 2GYSA 3L3OB 43C9A 4P48A 4ELME 5HYFA 2IC2A 3GB7B 2HFGH 4P3WA 1MFDL 5ICXA 2GTWB 3P0VH 1EEZB 1YYLL 1BJMA 3MLWH 2Y9RT 4P23A 5I74C 3D0VA 2CK0L 3NZHH 4Z76A 5SX4H 2VXTH 5GRVK 5IMKA 2NY5H 4G8EB 3KLHD 2DTML 2W65B 1UKTA 4MYWB 4UAOB 5EBGA 2I9TA 4D9LH 3ECBB 5D7LD 5DQ9B 3TFKC 2NY3D 1I7ZA 2EH8H 1AXIB 5DHYA 2DD8L 2R4RH 4ZO7A 3HC0A 5TH2B 5B3JF 4U6HB 4YHYB 4X9GA 4QRRD 3RGHA 3U4EB 5HSFA 1JE6A 4KRMB 2WZPD 1F4YL 2UY7A 2D4DA 2ATPA 4AT6B 1FIGH 3MV7D 1Z9SA 5DJCA 1PEZA 3ILQD 2I25N 4OF7A 5DGQA 3S36X 4D9RE 3H0TB 4HK3J 5KAQG 4PJCA 2VDMH 5CBEB 4HGMA 4ODTL 1NAMH 1ACYH 1LNUB 2ZPKL 3ZYJA 3DV6A 3MOBH 4G43B 3L3OA 1EO7A 3ARGC 4F3FB 4M5YL 3C60A 3P73B 4RAVB 4X6FA 3F58L 1JPSH 1RZJH 2L4OA 1UM6H 3W9EA 4HWBA 5L8KB 4FZ8L 5M7QA 5D70H 1WT5C 2OXGA 3U2SA 5GQBA 3U4BH 3WIIL 3PL6D 4KVNH 2ZG2A 4CNIB 1IGMH 1P4IL 2DLIA 2CJUH 4LU5L 5I1EH 3QXWA 1P7KB 1F97A 2VAJA 3IFLH 3RX8A 1XGTA 1VERA 3MUHL 5DQ9A 2ERJB 3RA7H 3UAJD 2DDQH 3FB8B 1F4HA 4R0LB 3LS5H 2EDKA 4RGNE 1MH5B 4U2ZA 1OTTD 4RMVA 5KW9H 3IS0X 4JFEB 1NJ9B 2FJHB 4DZBB 2VXUH 3IFOB 4G8IA 5SWQA 1EJ6A 2UWEB 2APVA 3O3AB 3RP1A 4WUUA 5I18H 4F33B 3QHZL 5F71A 1AHWA 4TVSa 5JLZA 5D71L 3BPCB 4G43A 4KUZH 2L7UA 2Y7QB 5DJZA 2OJEA 2XZZA 4OF0A 1KNOA 3NACH 3G6JF 4FXGA 4MB5A 3D85B 5F1SA 2RHEA 2FBJH 3OXSA 5BXFA 2A6DB 1FFQA 5DEFB 3RDTC 5DR5L 5DMIH 2GK0A 4MLIA 2E3VA 3QIUA 5F93C 3MFGB 5DT1H 5E1AA 1CFQB 5CD5C 1I1AD 2AAVA 2R1XB 1NC4B 1FG9C 2XYCA 2VJXA 3BEWA 3HUJF 1DBKH 2WBJD 1T0MA 1CICD 5T1LB 1CT8B 2F58L 1CLYH 5GXBB 5ISZB 2GSIA 4QGYA 5J11C 3SKMA 3ZLQC 5C0AB 4K8RC 2Z31A 4V1DB 5SWQB 3BSZL 3GSVA 5EU3A 3V4VL 4NKDB 1NUFA 2G2RB 2EXYD 5FYLL 3IDGB 2NX5A 5IW3A 3VFUA 1IC4L 2WIIB 4U1MB 2E9IA 1OQOA 2IWGA 3H3PH 5F21B 3ARFA 5H8DA 1EFXD 3NIFE 1D5XA 2M2DA 1QLEH 4PJGA 3R8BB 3DNKA 4ORZC 4J7RA 1PBYA 3SO3B 5IFHH 5JW4N 2WP3T 2WQRA 3DXAB 4RRPA 2OR9L 1G7QA 4ODUA 1RJYB 3WE6A 2AJYH 5KSUA 2GT9A 2HG5B 3X11B 4DUXA 1X4YA 4A6YL 2F8OA 5HGBB 3R8QA 4GXVH 1DL7L 2WW8A 1CFSB 4NOFA 5FV2A 5F96L 1MRCL 2CDFA 5FM4A 1JZ3A 3BIKB 3FTGA 4UOW0 5ID1B 4NO2B 4CDHA 5EOCL 4X6BB 4YE4L 4YDLC 5KZCB 5F44A 5IHZA 1F3DJ 3QUZC 2VSDA 4JHAL 3HE6D 5HI5D 3OAUH 5D1QD 1JPGB 1J11A 4OQ1A 4O58L 3NFNA 4P2QA 5FHBH 2XICA 2RR3A 3WHXA 3QSKB 4MD0B 3EOTH 3SE9H 1U8QA 4Y16C 1TJGH 5FYLD 2HT4C 1I1FA 2KBGA 2C4FU 2V2TB 2EDTA 3UTTB 4YO0B 5JXAH 3F5WA 2Z8WC 5A2JH 1BQHA 1TQCC 3SE8H 4BSWB 4HWEH 1VFAA 1Z6JT 1N5YL 2YPVH 5IQ9A 4KK6C 2DL2A 2H8PB 3PDOA 3GEWB 3DV6B 2HT3C 3VXUE 4HUVB 4JLRA 4WO4C 1PQZB 4G6FD 2P5EE 1FNFA 2F5AH 4HQQL 1R3JA 1G9EA 2YXFA 5SWZB 5MENE 2CSPA 4NQCA 3MX0A 3CH8A 5ILTL 5TF1L 2ED8A 5C0BB 4Z7OF 4OZHF 4H0IA 1D5BA 3DGGA 2GUOB 1DUZB 1PYWA 5GGRA 3UTSA 3TVMA 2QHRH 2P5WA 1ZLSH 5C0GB 4NN6C 4X0KA 3VFVA 4L9LC 1HNFA 3GSQA 2IBGA 2EYSB 1WVZA 3P4LA 4O2CA 5IB3B 3MV7A 3QXAB 4MDJB 4TUJB 5T1KA 3ARRA 5B3JE 4XVUD 4P2OD 5TF1H 2XA3A 4LCYA 4PJ9B 4N90E 1BX2B 4QHLB 4L4TA 3HLAB 1BVLA 4RSVA 5E5MB 2E7HA 3O9WD 3E2HB 2HFEA 2F53B 5ID0B 1ZGLM 1R3JB 3ZE0E 4NQCB 5E08L 3U79A 3S96B 2YPVL 1QSFA 5HYJE 5E4EC 3SE8L 1KN4H 3MRMA 4U1NA 3EDFA 5T1DL 3MV8A 2IQAA 1MAKA 3IDNA 1EUTA 4YXLL 5HVHC 4KK8C 4M62L 5GGRB 5JXAL 4ALAL 4WFGD 2YUXA 4QRUB 1NGQH 3TVMB 1GYAA 3DUHA 5HY9B 3OTTA 4Y5XB 2CUMA 4WENB 3VFVB 1D6EB 3PHOA 1GGUA 2QTEA 2J1KA 1AGCB 2OR7A 3V52L 4AEHL 1JK8B 1S7QA 3QXAA 4Q7DA 3FCTB 3P9LB 4N8VA 5CJQH 2R0WL 4R4FL 1RK1B 3RU8H 4BUGA 3LEVH 1FL6A 3BUYA 5EOCH 1IBGL 1J8HD 2EDYA 1AHWB 2J6EH 1MUJA 1VENA 2D03L 2F53A 4JKMA 4R4ND 3GJFH 4KFZC 4KGLA 4X6CF 3L6FB 4ZQKA 4UAOC 3MRMB 3BP7A 4TPRH 3TIDB 3SBWC 2AJYL 2A9ML 3PWJB 2OR9H 1NBVL 5SWZE 1ORQB 3ULVH 1U2CA 1DSFH 4LLWA 5JQ6H 4MAUL 1QLEL 2YEZA 1KENH 1PY9A 2DBLH 4J8RA 1BFOB 1FN4A 3SE3A 2IPTL 5CGMA 5FAAA 1T83C 3RY4A 3ALPA 3QPQD 3T3MF 3TPKA 3MRKA 1IC4H 2Y4SA 3BIKA 5ESQB 4CW1B 1CDJA 3C87A 3P9LA 4N8VB 4X7FC 2JB6A 1K5NA 3N06B 3DMMB 1S3KL 1WBXA 3KHOA 4DFIA 4PLNC 2EEAA 4FFVD 1I3GH 5FYLH 2NTFB 5L8JB 3TH4T 3V4VH 4WO4A 4NZRL 3WFZA 3BAEL 5HHMD 2DRUA 4L3EE 2P4AB 5J06A 1BF2A 2B4CC 2VQ1A 2BRRL 1GSMA 2VE6B 4WWKD 4AL8H 1BQUA 5E00B 5TDNA 3B83A 4Y16D 4Z6AT 3LDBC 1U9KA 4M5ZH 1ONQA 4HHAA 1U8JB 5IMLB 3PWJA 5CSBA 4F8QA 2VLLA 4CMHB 4HZAA 5C0BE 4O2FA 3ROLA 3ULUC 2BNUB 5HHVL 3KJ6H 1G7QB 4ODUB 4WV1C 4HIIB 4BH7A 4JKLA 1K4DB 1IZKA 2PXYC 3SO3C 4IRSC 1UB6B 3WLWD 2DKMA 2FBJL 1T22A 5SX5K 4XP1L 4TVPE 2F19L 2W38A 2R8SL 4KUZL 5KS9B 3QUML 1DQJB 1UXSB 5C0CB 4XC1H 5DEGB 5B22A 3QHZH 5T1MB 4FMKA 1FZMA 5GS0L 3CFEA 5I18L 3FT2A 4HKXB 2VXUL 2VUOA 5JDSA 4XMLL 4TVPH 4GMSL 3UTSB 3LS5L 3O4OB 8FABA 4Y19D 1F4WH 2X9YA 3C08L 3NFNB 3S3JA 1N3NA 3MO1B 3V6OA 3O6FA 5J11B 1ONQB 1IT9H 5FYJD 1N2RA 3LKPB 3SDXF 3R4DA 4ZAKA 3L3GA 3O8XC 4LU5H 5EWIL 1U8NA 5FYKU 3SKNA 5I1EL 4Q6IC 3C6SB 3DWTA 3ZDZE 3LIZL 3U4BL 3HCVA 3NCJL 2VLJA 2P24B 3DVNB 4U1SB 5E8OA 3QPXL 4WFGE 4QHLA 1BIHA 5J3HD 1UM6L 3CNKA 1LO2H 5C9JA 3QNYA 5FK9A 1EZVY 3DETD 3MOBL 5CJXA 4QCIA 1Z5LA 5CSZB 2AJ3B 5D7JD 2HH0L 2ZOKB 3TIEA 1F3JB 3CFEB 2Q87A 4QHNB 4OCLC 2W59A 4HH8A 3TVMD 2OX5A 4LVOB 1MCDA 2WBJA 2YD6A 4YX2H 1GJIA 2AK1L 2AS5M 4PLKD 1V7NH 3D3VA 1FC1A 4HUXA 4LFHG 1T6WA 1MHEA 3X3GH 1I85A 3NZHL 3SOBL 2CK0H 3MCG1 2OM5A 3VDAA 1XGUA 1F00I 4RFNB 4FFWD 4LNRB 3Q3GA 4PREA 1LK2A 2DBJA 1ZA3A 4LP4A 3DLQR 3TPUA 4OZFB 3FT4A 4UBDC 2HFGL 3QPXH 3QNYB 1T2XA 3HI6L 4OZIF 3O4LB 3NCJH 3VFMB 3LIZH 2AXFB 5FUOH 3CVHH 4OB5L 5F88A 4IRJC 3UBXI 3L5WA 1BQLL 4M7JL 2BHZA 4PJ7B 1DFBL 2ZOKA 4OZ4B 2YD8A 2XWTB 4ODHH 4CGTA 5TDPB 5C0CD 5F7MC 4ORGB 5FHAL 1HWGB 3MLXL 3T65A 3WXWL 5CMAB 3GJFA 3DV4A 5FM5O 4TVPL 3QUXA 4JANA 1KCVH 1HH9B 3WS3A 1ZT4B 1N64L 1BREA 1T21A 3SQBA 3MUGA 1UKSA 1KJ3H 3MRIA 5L8LB 2IBBA 3DSFL 3SGKA 2V5RA 2BNRB 3V0VA 3DX7A 3JV5A 1QRND 3GRWA 5C08B 1PGRB 4O51A 3B8YA 2F19H 5MEPA 2F15A 3KPPB 4HAGA 4H1LA 5D1QA 3TNNB 4NO5A 4OAWB 2V5TA 4IIQB 3MLUL 4GO6B 1RK1A 3LB6C 4CVZB 1R3HA 1SEQH 5HHVH 3ZKSD 3L5JA 4PJAB 4ZUSB 1MUJB 1WEJL 2DI7A 1MCBA 1DEEA 1T1ZA 5JOFB 4ZNEE 4OSUH 3LMJL 4MXWH 3D39D 1RY7B 1RUKL 3EFFB 3F62A 3MV01 4JZOA 4WHYH 3D85D 4APQD 3HFML 4KKBC 5C09D 2EDJA 1X4ZA 4XWOC 4M48H 1PDKA 2W9DH 2JB5L 1S3KH 2BSTA 2H26A 3GMRA 3RZCB 4XVSH 4PGDB 3ZT5A 1J9CT 3QUMA 4YC2B 3U4AA 3QDGD 1KXQE 3GNMH 2CO7B 2IPTH 4XX1E 3CU7A 3L3HA 4U1KA 3RIFF 1ZVHA 2IH1B 1JHTA 4LSSH 2VDNL 2W0KA 2DBLL 1X5JA 2IANA 1G1CA 1U8PA 1VEMA 5LQBH 3JXAA 3QRFM 5I15L 1DSFL 3SDXB 2IGFL 5DS8A 1VKXA 2VNCA 2A9MH 2GSGA 1C7TA 2QADB 3ZKXB 4MB4A 1H5BC 3UAJC 5AAWA 5D2LB 4WV1A 2CMRL 5IK3B 4NCC1 1TTGA 3FFCA 3JVGA 4KC3B 2Y5TA 3D39E 5T5FH 2O61B 2J6EL 2E7CA 1IBGH 4MNQE 4N9GB 1VSCA 2BVPA 1IEBA 3LEVL 3LS4H 1MAMH 4LVHC 2HN7A 5SWZD 3VXSA 4XNUH 2R0WH 1QUNA 5DK2A 5C09E 5HI4C 1I1RA 1QR1B 3B2VH 3WO3B 3QUMB 5EBMA 2KQMA 2NY3C 4Z7WF 2PO6D 3C60D 1S9WA 1EAPA 4XZUB 4Y8DC 3K1DA 2EIEA 4BH8B 4J3XA 4JFOA 3O81A 1F4AA 1LILA 4YBQC 4QHUB 2Z0BA 1CD9B 3IDYB 4GW5B 3AB0B 4BFGA 3ES6B 2RB8A 4N0UB 3UX9B 1NGYA 5DK0B 4P9HL 5T1DH 2WWKT 3QG7H 2F54E 3SKOB 4FABH 5DFWH 2DQEH 1ETZA 2NW2B 2DIJA 4NC1C 3SDXE 3RTQA 2FWOB 1IVLA 1CD1A 1KLUA 1K2DB 4G8EA 4LQFH 4DUVA 3OR7B 4K7PL 3H3BC 1SJVA 1BQHG 3RPKA 4J3UA 4GAGL 4XCYA 2HN7B 2MCPH 2OS7A 4BKLA 2BJMH 4U6HA 3N1MC 2VLJE 2VZ3A 3MA7A 4MNQD 2V7NA 1JHKL 2X4SA 4UT6L 1XF4A 1BOGB 5I30H 4G9DA 1F8TH 4N1CA 1RIVH 4WTZG 4LCCA 4A6YA 5JHLL 1DN2A 4TVPD 2QHRL 1G7PB 1R5WB 1N59B 3MRBB 4G6FB 1ZHLA 2J8OA 3ES6A 3LN4A 4YK4B 3VH8A 5C3LD 1G6RA 5TGBB 2IFGA 5HHOB 3WNMA 2WBJB 4HBQA 4LBEB 4L3CB 4NP4L 1IL1B 1FQ9C 1A6AB 1SVCP 2EIZB 4EZMA 1IQWH 4U1LA 1EXUA 1ZA6A 2EC8A 3WIHL 4NKQB 1HINH 4D3CL 3VXRA 5B39B 4X80H 4PJ8D 3HR5A 2D4FA 5FECA 2YWZA 5FYJE 4X5WA 4XAWL 1Q94A 1X44A 1UWGL 2CQVA 1J0YA 2DOCA 4HWEL 3RWFB 3MV9E 5LWYL 1GIGH 4M43H 4EJ1C 5BW7A 3O0RH 4XXCA 4XNXH 2J12B 1ZHNA 5MEQB 4UQ3A 4EI5A 2R1YA 3NTCL 2CH8A 1XGQA 2W91A 3U9PL 4XNMB 3UO1L 5DRNB 1NDMB 1L9NA 1QHOA 3T77B 1JZ6A 4KAQL 3EOTL 2UWEF 3GMNB 1T83A 1DE4A 4M00A 4Y89A 4GQPH 1C5DB 1A6TA 5TGBA 3OAUL 5DJ6A 2H6PA 5JMRA 4JHAH 4U3XA 1EMTL 3B9AA 1HH9A 5HBBA 2HT3D 4LSQH 1IL1A 3STLA 2RCSH 2JCCF 3G6JB 3I6KB 1H3UA 1MRCH 5F96H 1F58H 2BCKA 4OGXH 3I3EA 2PF6A 4I0PB 4POUB 3J7HA 3VD7A 4AK1A 1L6ZA 3W5MA 2D2OA 4GXVL 3BKYH 2IANB 3HUJE 3FB5A 1RJZA 1DN0A 2C3GA 3ZKQD 3QDMA 4OFIA 1M7DA 3O6LH 4KJWC 3LKSB 3QCVL 4CVZA 3VD3A 3O6FC 3FQNB 2LQRA 1QSED 3TT3H 2YBRA 5K59E 5IFHL 4P3CL 5DQJB 1VACB 4QY8B 2BHUA 3T0EB 1WC7A 2VXVH 1GAFL 3ROOB 4IDLA 2VZUA 3EYVB 5CGYD 1JWUB 4QRPB 4R4BA 4AIZA 4HX1B 1CFTA 3VWJD 4IM8A 2JKXA 5F97E 3KYOB 3V6FA 4M02A 2DF3A 3WS6C 1SJHB 2GJZB 2BVOB 3SEPA 5IVZB 4LKXA 1K8IB 4PJAE 5I1KH 5E8PA 3MBEC 2DQCL 2OL3B 5GPRA 2YZ1A 1NCCH 2KH2B 4MNHB 4P5TD 4QTIH 1NCDL 3EFDL 1CLYL 2F58H 3QO1B 4LEOB 4O4YL 4FG6C 1DBKL 4HK0A 1I1AC 3L3HB 2NY4C 2YPLB 4F7CA 1D5IH 1UWXH 2V5SA 4C56E 4YGVB 2C7UB 3FT3A 3O3UN 3KYNA 3P0YL 1FDLL 5FM8A 4GRLB 4WRLA 5IBUB 4GRWF 5MHSE 1G9NH 5DMIL 1KEML 5DR5H 1JF5A 1XFPA 1P6AB 2BSED 4KRLB 4HS8H 2NZIA 3RTQB 3NACL 1OAXL 4FFZL 3DX6A 4XNQA 4Y16B 5HGHB 1JWUA 4QRPA 4XWOD 4R3SA 3MRNB 1S7UB 1G9ML 3GSOB 3B2UD 3AU1B 1U91A 3I9GL 2BVOA 3CUPA 3EJYC 5K9QI 4ZO8A 3QIBB 3DVGB 3MRGA 1S9KC 3KLSA 3P4NA 1J10A 4PY8J 3U4EA 4EI6B 2DDQL 5C09A 1IAKB 2FX8L 4PGCB 1UB5B 5ACLA 5BZDA 5F7NC 1JHLH 3UDWA 1WFOA 2CJUL 4QHUA 1TENA 4RZCA 4YGVA 3QDGE 4X4ZA 3TH3T 3CFJB 5MP6L 4KY1H 5J6GB 4TNVF 4XHJC 3ZYOA 1F90L 3H3KA 3S8WA 5D70L 1JZ5A 4LCIL 5C0BD 1JPSL 1RZJL 3F58H 3RWDB 5FF6B 1LDSA 1GC1C 1U8LA 3BWAB 4IDJH 3O6MH 5FYKD 1XCTB 1HXMA 1DTUA 4YFEA 2ZPKH 3GO1H 3MRRA 1HI6B 1QNZH 3UPAA 3TN0B 3QIWB 3ESVF 4PRIB 1J0JA 1FIGL 4L4VE 1NMAL 1NEZA 1F4YH 5LVEA 1E4WL 4UT7H 1MFEH 3A67H 3VFWA 4ETQA 1KPRB 4UQ2A 4OV5B 2HT4D 5ESAA 5DRNA 4LSVL 2VO5A 2VZ1A 3P4MB 5AD0A 3IFOA 2B2XL 3M1BA 3BPOB 4D9LL 5K9KA 1FVCA 1Q9WA 1FBIH 3RY5A 1CXIA 2NY5L 4FZEL 1CQKA 3IETA 2VXTL 4TUOB 4F9LA 4LLMB 4MAYB 3MLWL 5ECJE 1KB5B 2H32A 5CP3A 2VZTA 3CSPA 4U7KA 1CGSL 3P0VL 4UMGA 2FYYB 1S7TA 3NCFB 4W6XB 3JZ7A 4NCC2 1YECL 2DKSA 1EEZA 2VAAA 3QHTC 5IBLC 3VGGA 3K3QA 2R69H 2HMID 2ORBL 4QRUA 3FB5B 1HI6A 1ZVYA 3JWDL 1JJUA 2N7AA 1OAYH 3QFJE 4H8WC 5LGHL 4HS6A 2VLRA 3D2UB 3F7RA 5C0IB 1V3JA 1NGXA 2VZOA 5C0CE 3LKSA 1I7RA 4P5KB 2NY0C 2OTWB 1U92A 1CE1H 3SE4A 1WIUA 4WU7B 1U8IA 1A14L 2X1OA 5IMOB 1KPRA 2JIXB 4QY8A 4OV5A 5L6YH 1ZE3C 4CN6A 5AAMA 1D6VL 4L4VD 3EYSH 4PJGE 2Y1VA 1DBAH 4XB8A 5CWSB 1Q9LA 4WW2F 5JR1L 4OM1L 2EXWC 4KV5F 1ZGLP 1CFVL 4LPWA 5AUMA 4U1GC 1ZLUH 4MA7H 4ZFFA 3GDBA 1X5KA 1BZQK 4S1QL 1MIML 1INDL 3P73A 5EUOA 2EDLA 3B5GA 4AEIL 3T2PA 3HI5H 1VEOA 3UJJH 3ARED 3TIDA 1FLRL 3BZDA 2VZSA 5A3IC 2VDLL 1FFOA 1I1CA 1BFTA 3BZFB 4DQOL 2DQUL 3OJDA 5SX5H 4OZGA 1URLA 1PG7X 4B7IA 4XVJL 1L7IH 1WGOA 4LSRH 4KK8D 1UVQA 1GOFA 2J8UA 3LPFA 4FQHA 2NR6C 5HPMA 3JWOC 5ERWB 1AO7D 5CZVL 5FOBB 4BUHA 3C5SB 5DMKA 5DVMA 3SGEH 4KQ4L 5DRWB 1KCSL 2B7DT 3E1F1 1L7TH 2FJHA 4MA8L 4N0FB 4KXZH 5GZNC 1BAFH 2Y36H 4M9OA 3UYRH 1WWBX 4LP5A 5DLMH 4AH2A 4Z7VB 5KSAD 5KSBF 2EE3A 4L8CA 3OXSB 3PV6B 5CJ5A 4U6VL 1MQKL 1H15B 1QA9B 2WBJC 4OD3H 3BH8A 4JFQB 5IVZA 2FEDC 1UCBH 4PJAF 2AJVL 3P11H 5E8PB 3ROLB 2R56H 2OL3A 3CMOL 2BOBA 2H2PC 2UYLB 1KV3A 5DZLA 1NC4D 1U58B 2YMXH 3JWNC 3GRWH 5BZDB 4OI9A 2MCG1 4ZTOH 4ZD3H 3GMOA 1WITA 5HHXL 5E2JA 2OZ4L 1Z0MA 5JIHA 5CJXC 4XHJD 3SGKC 4OBSA 1KG0A 1A4JA 4HS3A 4F7CB 1S9XA 3K7UA 1AGDA 1IC5H 4DOHE 1UXSA 1B2WL 2J4WL 2NTSP 2YC1B 3ARWA 1YNLL 4ZOEA 2Q8AL 1QEWA 3FQUA 3VRJB 1ORSB 4LFHD 2YSSB 4P23B 5IB1B 3NPZB 4FQJH 2KL6A 1S5IL 1I3RB 4Q6IA 5KJRL 3MLRH 4E5XB 1BECA 4PGEA 1HYSC 4FQXA 2WIIA 4HSQA 2A0LD 3BMVA 3KXFD 4X4XB 4U1HA 1RAMA 4NN6B 3WD5H 2VIRB 1HSAB 3QAZB 4XGZA 2QQKH 1DQDH 1RFDH 2IAMA 2FJFA 2BXZA 4NJAH 4NSKA 5IB3A 1MCHA 2ARJQ 3BKCH 3PJSB 1CGVA 4EQ2A 2DLEA 3ULVE 4K71C 3D9AH 3WN5B 2AJZA 2X7LB 3PWVB 4CN4A 3VGFA 1XEDA 4DCQB 2ZKHH 1ZT1A 1A9EB 4JO4H 1A6UL 1FPTH 3MYJA 2P5ED 2X9XA 1NCWL 4NM4H 1S7TB 4NQVA 5CZXC 4QOKB 3QP3A 1C12B 5IQ7H 4PRPA 4AEFA 2HVJB 3PHQA 2VKXA 2O5YL 1VESA 5KVEL 5C2BH 3QI9C 1JYNA 5I1AA 2X6MA 5C8JA 1J12A 2EEBA 3CPLB 5DUPL 2BVEA 4ZO6A 3PF2A 4PGBA 1WISA 3B9KB 1XF5A 1NAMB 3HI1A 4K71B 4NZTH 1A7OH 4KTDH 2WV3A 3QWOB 4NBZB 2IAMB 2FH8A 2PXYB 2Z92B 5HJ3B 4FRWA 3ZTNL 2UV3A 1Q9LB 3MCKB 3VI3E 4MJIB 3FT4B 1MI5B 3SDAC 1OF2A 3F7PC 5D7IA 1UT9A 5JNYB 4L5FH 4XMPH 5K9KB 1IAIH 1FAIL 2EZ0D 3GHEH 4S0SD 3VG9B 1WZLA 5F88B 4TUOA 1TZIB 1WIPA 1YEDB 1UACH 4UOW1 1K8DB 3BYYA 5DRZB 1YA5A 5FGCE 1I4FA 2OCFD 1EGJA 3S6CA 4AZ8A 1JGLL 2H32B 5I1IH 3RZCD 3QIUB 3HE6C 3MODH 3MBEA 2DMKA 1JZ2A 4S1SH 4RQQA 3U7YL 4R96A 2JELL 3DV4B 3V4UH 5ALCL 2QQQA 4JHWL 4TTDD 5EG6C 3P30H 5E2TL 2IBZX 1R5VA 5C9KA 1PSKL 4XNYH 5L2JA 1Q72H 3HAEA 4Z7UE 1QO3A 2G2RA 4HGKC 4MJIA 4LVHB 1WBXB 1U3HD 3PL6A 2OLDA 2DLTA 1FO0H 4JR9L 1BEYL 3WHE1 4BQ6A 1SJEA 1BX2A 2C1PA 1PG7L 2IG2L 5ADOH 4GS7C 1J5OH 1HK6A 4JFFE 1OY3B 4RAUA 1NQBA 2AJUL 4XP5L 3FHAA 1Z3GH 1N8ZA 1P7QB 1CXKA 5E2WH 3IU4H 2XKSA 1FZKA 2V5MA 2QSCH 5ITBH 4BZ1H 3ZDYF 5KSUB 1RZ8B 2PW1B 3A6CL 4RMSA 1ZLVK 3BZFA 5DJYB 5HYJB 1K85A 2ZCLL 5EZIH 1RUAL 2ZUQB 3TCXA 2DMCA 4Y5XA 1S9YB 3RDTB 1A4JB 1I9EA 4LASH 1D5MA 2J8UB 3OBAA 5L2JB 2HT2D 3V4PL 2B4CH 4NYLB 5CKAA 4MMZC 2LFGA 4DKEL 5EC1A 3VFOB 1RZKC 4PJXE 3FMGH 4L4VA 3M8OH 5IHZB 4RA0C 5C0EB 1H3VA 4E5XA 3OL2A 2G5BB 3LKRB 4L3ED 4H88H 5I2IB 4ZFZB 2QEJA 4JQXA 4OCSH 2YD9A 4X6CA 3WDJA 1UXWA 5DDHB 5EZOH 5DD0H 4EVNB 5CUSL 3MBXL 5K9OA 3V9FA 4YO0A 4JO1L 3OSKA 5T3ZH 3HC4L 4HJ0D 1J8KA 2NX5D 5IW6A 3KWWB 5CEZL 1DQML 3IJSA 2APTA 3H42L 2DQTL 5E5UB 2IFFH 2VITB 5FGBC 4U33A 1D7FA 4H0HB 1IQDB 1RZFH 3E8UL 3MYJB 1M05B 1BD2A 3IT8D 4YHLL 1BOYA 5I1CH 1EJOL 4JPIB 4KRPC 4IMKA 3RNQA 2AJ3A 4PRPB 5JHDE 3DMMA 3QI9D 2C26A 2NY1D 4LEXH 2EYTA 2NTFA 1FYTB 2ENYA 2PO6A 3QDJE 3T09A 1IC7H 2GUOA 4PRDB 3WFEL 3X12A 3CPLA 5EDXA 2NY1B 5L88H 3HZVB 2VXQH 1ADQA 4LIQL 5GRWA 2A9NL 2VWEE 5BS0E 1CZ8L 1ZS8B 1VGKA 1JF1B 3EO9L 3LKNB 3REWB 3FONB 3NABL 2H32H 2YKLH 3EJJX 4KJQD 5HJ3A 4TUJA 4WW2B 5JORA 1FC2D 1KLUB 4ODBD 1UQSB 4I18C 1IM9D 1HHHB 4JRXA 3BESR 4O2FB 5I8KH 3L3DA 5C0FA