2AGKA

Structure of s. cerevisiae his6 protein
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
260
structure length
233
Chain Sequence
TKFIGCIDLHNGEVKQQHPSSYYAKLYKDRDVQGCHVIKLGPNNDDAAREALQESPQFLQVGGGINDTNCLEWLKWASKVIVTSWLFTKEGHFQLKRLERLTELCGKDRIVVDLSCRKTQDGRWIVAMNKWQTLTDLELNADTFRELRKYTNEFLIHAGGIDELLVSKLFEWTKDYDDLKIVYAGGAKSVDDLKLVDELSHGKVDLTFGSSLDIFGGNLVKFEDCCRWNEKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneam
publication title Crystal structure of the yeast His6 enzyme suggests a reaction mechanism
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 82
structure length 233
sequence length 260
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2agkA00
2QKFA 3TR2A 1A5SA 2ZTKA 3ABOA 1T96A 1DL3A 1YTDA 2EHHA 2TMDA 4GC4A 3PUDA 1K8ZA 2CLHA 2B7PA 2I14A 3M16A 1X1ZA 3QM3A 1T99A 2VFEA 2NWSA 3E0IA 2ZZ4A 3U2OA 2A6NA 2HMCA 3P67A 4UFMA 3IVUA 2B7NA 4XKYB 2QCFA 4XTIA 3MMTA 1X6UA 2QF7A 3O6CA 4AXKA 2QCLA 2HTMA 4FNTA 3BG5A 3BPWA 4KFOA 2GUUA 2H6RA 1HO1A 1Q3NA 3N73A 3VI2A 2C19A 4GUGA 2UV8G 5FF4A 3FFSA 4YCPA 2I1OA 5U4NA 1A50A 1UUOA 3CTLA 4A3UA 4UMBA 2VFGA 4DEFA 1H7WA 3HPZA 1VYSX 2V2DA 1UJPA 3E96A 1Z42A 1H50A 2V5LA 2Y6ZA 3EX1A 2NUWA 2VC6A 2VENA 3N2XA 2WJZA 3LCXA 2XN1A 1GG1A 4M7TA 4N6EA 4R34A 3KOFA 4RXFA 1ZNNA 2ZZ1A 4ORMA 1NVMA 2HS8A 1A53A 1NF0A 1SO5A 4H3DA 4DF1A 2YXGA 2FQIA 1FDJA 3PF3A 1UASA 3G3MA 3WJYA 1I2NA 4HSOA 2OT0A 4UTHA 3W88A 3GDTA 3KFTA 4ZL1A 1TQJA 3PAJA 4EIVA 4OBTA 3L21A 3TAKA 1KFJA 5CZSA 5FEZA 1QPRA 3STCA 3UZJA 2ZRWA 3NQMA 3FS2A 1GT8A 3PG9A 3W7CA 4M7SA 4I7WA 3RNDA 5MHBA 1FWTA 2W6RA 1KV5A 3NPUA 3CPRA 2XFWA 3DBPA 1KTCA 1XDMA 3LI0A 2YW4A 1VGAA 3C8FA 3LHUA 3NQDA 3NYZA 4PL1A 3HPSA 5CPMA 1SUXA 1TRIA 3DHDA 3BW4A 2PC4A 2P0OA 1JCJA 2DP3A 4LVFA 3W84A 3NM3A 1JRBA 2PE4A 2QCNA 5G2WA 4WY0B 4Z1BA 5IBXC 5I3GA 1JUEA 4UTLA 1AW5A 2VFIA 4QQ3A 3EWYA 3EKLA 4E2DA 2ZDRA 1FBAA 3MHFA 4MZ8A 5CG7A 1SW3A 3W87A 1DQWA 4XZ9A 2DZWA 3OBKA 4ZMGA 3LRMA 3QPYA 4JEQA 1JCYA 5AHLA 3MWAA 4MJMA 2EKCA 5F4XA 1DORA 3H54A 2NX9A 3QEZA 1ZFJA 1DOSA 4FO4A 3EX2A 3O1NA 1W1ZA 3C2EA 3TW6A 2EPHA 4RX0A 1TTJA 3M0ZA 4ZQNA 2JBMA 2NV2A 3W22A 1K8YA 1WOAA 4RZ6A 3S1XA 3TC7A 5HWMA 4GRSA 3NQCA 3PC0A 3M5ZA 5AC6A 1G4SA 1RQEA 1R30A 2NX1A 3NG3A 2WKJA 3F4NA 3SECA 2P1FA 1YYAA 3G1HA 3M5VA 2FDSA 2NXIA 3W7NA 2ABAA 1LOSA 1TPWA 2VEPA 1H1YA 2F84A 1ME9A 3GXTA 2I9EA 2A5HA 3RF9A 3BO9A 4IMGA 5DN1A 2BLEA 3CT7A 1J5TA 3HG5A 2X1TA 5HWNA 1F05A 1QPQA 3RFAA 4XTDA 5CSSA 4DO5A 4Y8FA 1QOPA 5F1VA 1K03A 1YXDA 2V5BA 2TRSA 4UR8A 2V30A 2PCQA 1SPQA 2X1SA 1M6JA 1VH7A 3OHIA 2J88A 5D30A 5C2XA 1FDYA 3LCHA 1GVRA 2H8ZA 4AHPA 3ZS4A 2FPYA 1TTIA 2VXNA 1FWRA 4Y90A 4O1CA 4QSHA 1BKSA 2O7SA 4LC6A 4A29A 5LHFA 3VNDA 4NNCA 5D37A 3P8JA 2CW6A 4FB7A 4JIQA 1K7EA 5T26A 1KW1A 4JY8A 4Z0SA 3DFOA 3H55A 1D3HA 4JYDA 3N14A 3PUOA 3P74A 4DO6A 4BI5A 5K2ZA 3S1VA 3W07A 3T78A 1DVJA 1SW0A 4HNNA 3TUUA 3STFA 3JS3A 1FCBA 3A9IA 3B04A 3S8HA 1D3GA 4DPPA 2QJHA 4O0ZA 4Y9AA 3O63A 1H5YA 2H3DA 1ME8A 5CPLA 2Y61A 2QAPA 3THAA 3W1LA 3GAKA 1SO3A 1VCFA 4U4MA 3FLUA 4UTWA 3LM7A 2NLIA 3WK1A 5AHIA 3SGUA 2E5CA 2Z6JA 1Q6QA 3QSRA 1QR7A 1PHQA 1CW2A 4GUIA 3S5OA 4AWUA 4DPQA 5I3IA 3HG3A 3HB9A 3L5MA 4RCXA 3S42A 5KZEA 3RU6A 2WPBA 4GNJA 2JK2A 3PB0A 1BWKA 4WQ6A 2E09A 4P2VA 1XM3A 4KKXA 4DELA 5HULA 1X1OA 2C18A 4O11A 4RR4A 4O1DA 1LRQA 2C1HA 2ZZ5A 1FUYA 4Z1CA 2GJLA 4PH6A 5F2MA 4BI7A 5KINA 1VZWA 3KVJA 3SJ3A 1LZOA 3UWZA 2O7QA 3W3OA 3BW2A 4QM1A 3HG2A 5E0KA 4DF2A 2LLEA 4HN4A 1F6PA 2G95A 3QF0A 3SI9A 3IIVA 1DV7A 4CQAA 2Y7DA 4GJ1A 3P81A 3DAQA 1FWSA 3PG8A 2OCZA 2FPTA 3C2RA 2D73A 3LCIA 1KM0A 4UUIA 2B7OA 4LW7A 1LOLA 1TV5A 4WX2A 3G0SA 2FB3A 2TSYA 4M5PA 3TQKA 2Y70A 4LT9A 4MY9A 3M41A 1ZAIA 3MHUA 4MOZA 5A8GA 1WYIA 1FCUA 3NQVA 4FF7A 5KMYA 5LZLA 2OX1A 3C61A 1QPOA 2QAFA 1G4TA 2ZQ0A 2Q3OA 1KM1A 2NV1A 4JTEA 5KITA 3PBUA 4LV4A 4XWUA 3FKKA 3FJLA 5D09A 1OJXA 5KZMA 3A5FA 5D2WA 1FCVA 1MXSA 3ZWTA 2E5DA 3GXPA 2R8WA 3DKLA 4TMCA 1Y0EA 3R12A 1TREA 1JRCA 1AG1O 1S5WA 5C55A 1SFLA 1KM6A 5AC8A 4GFSA 3H53A 3E02A 2AGKA 3VE7A 3UQNA 1TPUA 1XFBA 2KZHA 1TMHA 1ZJIA 1RD5A 3ANYA 5IM51 5DCDA 4ADSA 4E0CA 4Q32A 3W7OA 1PIIA 1FWWA 3QMRA 4JTIA 3DZ1A 5L6UA 3NVTA 4MFDA 1ONRA 1OX4A 3INPA 3BW3A 4LRTA 2NX3A 1GWJA 3C2FA 1V7YA 4K38A 3L2IA 4LS2A 3USBA 4PA8A 1OFDA 3WK3A 3UY8A 3GLCA 4DBEA 5I3HA 3QW4B 1LBLA 1GYNA 4HKPA 4IJBA 3W85A 1ZHAA 1VHCA 3LHWA 4IX2A 3SGZA 1KM4A 3LHZA 1Q6RA 3FKRA 4FXSA 1AL8A 3LCFA 2R14A 4PEKA 4NQ1A 4YMZA 4N4PA 1JQVA 2TYSA 1KTBA 2CWNA 2ZA1A 4BR1A 3K30A 1W3TA 3HIJA 3LLDA 3W2JA 1XKYA 3PSVA 2A7NA 2Y89A 4CNPA 1HG3A 1JUBA 5L9FA 1TTQA 4LVGA 5BRBA 1HO4A 4IPIA 4JX4A 4KWVA 3DHFA 3N2MA 2VOMA 4O0KA 5G1YA 5F4SA 1ADOA 3EWXA 4UFKA 3QZEA 5LSMA 2FJKA 5AYXA 2YGYA 1ME7A 2PRHA 1PS9A 1QDSA 4LTSA 3NAVA 4OT7A 3QW3A 3CQ0A 5LNRA 3LLFA 3W75A 1QPNA 1XBZA 5DXXA 1EUNA 1JR1A 3DFNA 5LNUA 2QCGA 3G1AA 5LNVA 1SO4A 1TV8A 4QITA 3DFPA 5D2XA 3SIZA 3W2UA 4ICNA 3R2GA 3PBVA 4JTHA 3TSBA 1UUMA 3W74A 4UTUA 5GVJA 1IXQA 5LGZA 1YADA 2C3ZA 3UD6A 1OK6A 1LTDA 5U7SA 1L6YA 3RLVA 2DORA 5CZTA 2JGQA 3LDVA 2GQ9A 4ZZ9A 5EL1A 3MYPA 1P4CA 5DELA 2BXVA 3I7SA 3T7VA 2Z2UA 2GQAA 2ZZ3A 3B8DA 1TJPA 4UTTC 4HIBA 3KRZA 3GZ3A 4IMCA 5J5RA 5LGXA 3QMTA 1ZCOA 4LOCA 3BG3A 3I65A 3CEUA 3UPBA 4TMBA 4G1KA 4DXVA 2GPTA 1XBYA 3QMSA 3P7YA 1EUAA 1WDWA 3YPIA 3M5YA 4QISA 1UBSA 3G8EA 3W9ZA 1YDNA 5A5WA 3NQ8A 3W1PA 1OX5A 3M5XA 4FNQA 1YPFA 3CU2A 1GPWA 3NEVA 1NF7A 4A2RA 3P60A 3HBLA 1H61A 3B0VC 1X7FA 2A6LA 2FPVA 3TW7A 3G1YA 4JNMA 1WV2A 3LGEA 3TKFA 3LOTA 2CLOA 4NU7A 1YXCA 1W3NA 4GUHA 2E6FA 4BWLC 1EP3A 4MZYA 3N9RA 3NPWA 6ALDA 1QWGA 1QOQA 3TU9A 4H4IA 1C9DA 3LHYA 5EMUA 2YW3A 1G4EA 1OK4A 2B0MA 4JX6A 3EKZA 3IGSA 2Q8LA 3S5NA 1GJPA 3M44A 2GVJA 4JICA 2RDUA 3LCGA 4TU1A 3B0UX 3KVLA 4PTNA 1PL9A 2GVLA 3IVSA 4NNBA 3VKJA 4MLRA 1G67A 4O15A 3UZ5A 5CSRA 3SW6A 1NSJA 4E38A 4MY1A 1C8VA 1I2OA 4BK9A 4ZQOA 4PODA 3DENA 4PL2A 5C54A 2G5WA 5EA9A 4EF9A 5H91A 3OVQA 5F1UA 1KTNA 1KBJA 4U28A 3TROA 3M6YA 3W76A 4O18A 2XN0A 3C0JA 1SR9A 3NQ2A 5BOOA 4S1FA 4LS0A 4AMAA 4IPJA 1KLZA 1IXNA 2NWRA 3F03K 4FNUA 1EIXA 4XUGA 4NUWA 1SZEA 5EBUA 3W7MA 3W7EA 1M5WA 5TBOA 4MVAA 5DBUA 5DLCA 4OV9A 4AEOA 3FYPA 4UFIA 1OFAA 3LRLA 3EB2A 1RPXA 1SZFA 3QQ1A 3W1TA 3ATYA 2Z0IA 1F73A 3PBWA 3R89A 3C2OA 2A4AA 3G1SA 4IQLA 5CGQA 5CZJA 3P82A 2ZRUA 4K39A 2ABBA 2B7QA 1W56A 4ZQMA 4C1LA 4N9CA 2ALDA 2A1YA 5F2IA 3GR8A 4O1AA 3CHVA 4WD0A 1O4UA 2E6AA 2X1UA 3DFQA 1C29A 1FWNA 4LRSA 3O15A 3LXAA 2BWGA 5AOUA 5LHEA 4FIQA 1KFBA 3NGJA 3TSDA 3HMJG 1DHPA 3P62A 3SZ8A 1O5XA 2QJGA 2AAMA 4DF0A 4Q4KA 1LROA 3DKJA 4M6VA 3FIGA 3NZ1A 4N4QA 3W2NA 5CKSA 1UB3A 5D32A 3WJZA 4ORIA 3W83A 1Q45A 2CLKA 2C15A 5F4WA 1TJRA 3A22A 1IIHA 4JDYA 4E2BA 1EPXA 3STEA 4DQWA 3S5ZA 1RQHA 2A21A 2NXGA 1NAL1 2P10A 4N02A 3NM1A 3BV4A 3MP5A 1YTKA 1WA3A 4NX0A 1P0KA 1R2SA 1OABA 1H7XA 4NZFA 1DQXA 3G1XA 5D03A 2A0NA 3W7QA 3W2KA 3BLEA 2QDHA 3E49A 4KFNA 3TCEA 4JTLA 5AN7A 3OIXA 1MEIA 4UR7A 1FXPA 1LRNA 1OF6A 3EX3A 5D2VA 1TB3A 1WXJA 5KSWA 3I7RA 3TV8A 1KM2A 3C52A 3U8GA 1IIGA 1YDOA 4NJKA 3QYQA 1E51A 4NJGA 2QUUA 3W70A 1B4EA 1XCFA 3PULA 3QRHA 1W5PA 4K7VA 4IUOA 3W7LA 1W5OA 5FF7A 4ADUA 3VFLA 3O16A 3RK8A 4YCOA 4RZ5A 6TIMA 3G3DA 1RR2A 3BGJA 1TTPA 2WNZA 2EAWA 4ZQCA 3C56A 4FNSA 4CQ8A 1H63A 4TO8A 3QJAA 4OV4A 3UXDA 4UTTA 2J9ZA 3Q2DA 1GTHA 2YDAA 1AK5A 1WBHA 3MI2A 5FEXA 3LCLA 4GBUA 4AHOA 2A7PA 1BTMA 1VYRA 4GUFA 3W7IA 1VLWA 3PBYA 5EYWA 5AYZA 3MYOA 4BFAA 3GXNA 3R5EA 3DI0A 3FA5A 3S1WA 3BGGA 2ATMA 1K8XA 3PS7A 1YXYA 5AYYA 1SU5A 1P1XA 4N6FA 3DU0A 2BZNA 3OG3A 4X9SA 3MW7A 3GAYA 3CIWA 4CCDA 4CCEA 3LV6A 5K4ZA 1F2JA 2CZEA 3O6DA 3V75A 3LTPA 5DXYA 4AVFA 5C6MA 1O60A 1QO2A 4BWLA 3P8IA 4UTKA 5DCEA 1D9EA 3RLUA 1N8FA 1O5KA 2ZRVA 4NJIA 3KX6A 1DJNA 3UYCA 3WK0A 3WK2A 4RKAA 2V82A 3ZFHA 5H2ZA 2TPSA 5K7JA 1A5CA 3GB6A 4X22A 4HPJA 1Q6LA 4AB4A 3TIMA 2WOQA 5FI8A 3BLFA 2QCDA 1SSDA 2W79A 3IGUA 3W1RA 5G1TA 1QFEA 3L0GA 4NXSA 3VCRA 3KRUA 3KVKA 1VS1A 3UNDA 3GYEA 1ML1A 3NQEA 2FTPA 5BMXA 1OFPA 4Z1AA 2QEZA 1AW1A 3F4WA 3LBCA 3MJYA 5DY2A 2CLLA 3L5LA 4O50A 4ADTA 2PRLA 3DI1A 3NDOA 2QJIA 2X2GA 5BW6A 4HSNA 4EF8A 3G18A 3I7QA 4JTTA 3NPVA 1EB3A 1H7RA 3M47A 1TRDA 4QJ1A 5F2LA 1LCOA 2H90A 1KFCA 1QAPA 3EXTA 4HNVA 2VKZG 5HNRA 4WJEA 1JVNA 2Z1BA 4O16A 5AHMA 3A5VA 4UNKA 1YPIA 3LI1A 5G4EA 2DZTA 4FNPA 4GUJA 3CEPA 3LERA 1FXQA 3QH2A 1OYCA 4UTJA 1OFEA 3AO0A 2ZRXA 3W1XA 5EPDA 3NQ7A 1R47A 5KZDA 2CU0A 5C5YA 1GQNA 2CZDA 1GVFA 1BEUA 1OHLA 1M7OA 4MIMA 4O54A 4N9EA 5IBXA 4L4LA 3D0CA 4RV8A 1XBVA 4JD4A 2EF9A 4QIUA 1OFQA 3HOJA 1MSSA 2YYTA 5I3KA 1YLVA 4XBSA 3CLMA 1W5QA 4NX5A 5D2TA 3MHGA 1XUUA 1KA9F 3NNTA 2GOUA 2OJPA 3BARA 2J9XA 2Y85A 3GDLA 2C0AA 1O94A 2C14A 1VR6A 3G24A 3NL5A 3MP3A 5FF0A 1M7PA 3SR7A 5KTLA 1GVSA 3TXVA 1XUZA 4EWND 1KFLA 1JQXA 4OQVA 4O12A 3T44A 3B0PA 1R2RA 2YR1A 4TX9A 3ABRA 2DZUA 4Z1DA 2CZ5A 1LBMA 5D04C 3KVMA 3PB2A 3LHVA 3GX9A 2WV8A 1VYPX 4O52A 4Y6GA 3UWYA 3Q58A 3P5ZA 5AB3A 5G2HA 3THQA 4EOUA 1P5BA 3TC6A 1K7XA 1IXOA 2VFFA 2FB2A 3GVGA 1PCWA 2PRMA 4PFMA 4HPXA 3ABSA 4JTKA 1VPXA 4QNWA 4RLIA 4A21A 1OF8A 1I4NA 4MKNA 2C13A 5K9XA 3W2LA 5I3FA 2YPIA 2YFOA 4K36A 3W1NA 5HR7A 5E1QA 1K02A 3LHTA 4UFHA 3BG9A 2RH9A 3C4UA 5HJLA 4JIPA 4D2JA 3IRDA 1H60A 3IV3A 3SY5A 3NO5A 2BTMA 3W1AA 1ZAHA 1HFBA 3GR7A 2QCHA 1HTIA 2A2IA 2ZCGA 1CX9A 3ZWSA 3TQVA 3M1ZA 3GDRA 4LUJA 1GVOA 1Z41A 1Z44A 3MUXA 5EKYA 4K8EA 2F7FA 4LUIA 2CLFA 4R7JA 1GG0A 3UWWA 3W7GA 1TPVA 4WOZA 3PVFA 2JKAA 1OG0A 1AW2A 4HHPA 2ZZ2A 3TAOA 2R94A 3R8RA 1W54A 1TV7A 5CZ0A 1FY6A 4A2SA 4CCCA 4FEZA 1TSIA 2IQTA 2VFHA 4ALDA 5AHNA 3E9AA 1O95A 3MP4A 3PM6A 3CC1A 2Y88A 3QSTA 3G0XA 2DZXA 2WSRA 1LORA 1TPC1 4H6KA 5HWJA 1TPEA 2J27A 1WBJA 2QUVA 1TYGA 3KHJA 2CZFA 4CLMA 3HGJA 1JCXA 4IMDA 2ZFAA 1VRDA 1RVGA 3QQ0A 2Z6IA 4UMCA 4AF0A 1LDCA 4HT3A 3JR2A 2DZPA 2J6XA 1YDVA 3TMQA 5FEPA 4AH7A 1F6KA 4GXMA 2E68A 4UFJA 4IXHA 4MUZA 3TMLA 4UTMA 4AAJA 3G1DA 1T0OA 3GK0A 4IMFA 4RZ4A 1VCGA 2CFFA 4JGDA 1I45A 1EP1A 3WJWA 2W0UA 3FEMA 1I2PA 4YLWA 1LRTA 1EEPA 1H51A 5FEWA 1ICSA 1XL9A 1KV8A 2YX0A 2A85A 3QC3A 5J5DA 3KXQA 3KAOA 4PC8A 2FFCA 3I6RA 5ABTA 4Y96A 5K3VA 2NZLA 3S6DA 4LNYA 4GE8A 2V9DA 4UTWC 4FX6M 4CNOA 5G2IA 4MPQA 1HL2A 1XDLA 1H1ZA 3W86A 3E12A 4Z08A 4EVZA 4O17A 3LX9A 4UIOA 3S1UA 3TXZA 1ALDA 3G0UA 5DY3A 3LXCA 1S5VA 3BK0A 3BLIA 8TIMA 1LLZA 3L68A 1L9WA 5D38A 3M43A 3T4CA 2GVGA 3ABQA 3P5YA 5F2GA 2NUXA 5HINA 1ZAJA 1X8FA 4A22A 3EWZA 2E1DA 1FDZA 4XKYA 4YXGA 3TX9A 3S9YA 2GQ8A 3W72A 4LVAA 1NEYA 1VHNA 4S2CA 5G5IA 5I3JA 1PCKA 3GKFA 2YYUA 3OVRA 5LKYA 1XI3A 4GWEA 4JTSA 1EA0A 2VEIA 4OWGA 4BF9A 4JYFA 2E6DA 1DJQA 2WQPA 2ZZ6A 1W8SA 3LRKA 4JTFA 4CNNA 4JXCA 1JUKA 3TJXA 2V8ZA 1QMLA 3U6WA 4XQ6A 5D2YA 4FIRA 4JR5A 5CPNA 1TQXA 5HUOA 3A21A 1ZY9A 1I8JA 3W7HA 4LVBA 4I7VA 3UY7A 4KFPA 1VC4A 3A23A 2QCCA 4UMAA 3JRKA 2YCEA 2JGYA 3S5YA 3IGXA 3QPZA 4MJZA 4TIMA 3AJXA 3UWUA 1G6CA 3TA6A 1R2TA 3IIOA 1CI1A 3EWUA 3TK7A 1FQ0A 3N34A 2ZZ7A 3W2MA 1L2UA 1KFEA 1S3HA 3SSJA 1OFOA 2R91A 3W7JA 1LP6A 1F74A 4IWWA 4Z0JA 5HQEA 1Q6OA 3NQ6A 4CQ9A 4UXDA 4JYEA 3W1QA 2HSAA 3TNOA 2JKEA 5AHFA 2C16A 2CLEA 2ZTJA 4ZQRA 1SZGA 3TSMA 2E6YA 2V2CA 3CIXA 4JN6A 4JY9A 1EWDA 4K7YA 4JTJA 3GIYA 4AWTA 1TPFA 4AHQA 4IGHA 1G69A 1WOBA 5G4WA 2RKXA 2PURA 1J4EA 5TIMA 1TPB1 4O28A 3PSWA 4WY0A 3S0CA 2G96A 1AL7A 1MO0A 3N3MA 2X1RA 3RMJA 1SFJA 4NNAA 2XN2A 4FHAA 4PCFA 3WJXA 3O07A 4QNEA 1G7VA 4AWSA 3N9SA 3OEXA 1LBFA 1QCWA 1B3OA 1B57A 1EWEA 3IVTA 4R53A 4O13A 5DCBA 2JKPA 1PV8A 2RDWA 2WSYA 1MEWA 4M6PA 3FJ6A 4O10A 3SFKA 1FCQA 3LCWA 3BVJA 3KRSA 3UWVA 2GJNA 3TFXA 1RQBA 2DU2A 3O06A 2X30A 4K8HA 3UXAA 1I2RA 1EP2A 3G8RA 3HO8A 4N9BA 2DZVA 3W71A 1H7PA 5K4XA 2NUYA 4NJJA 3PY2A 1AMKA 4NZJA 2FIQA 3EX4A 2Y62A 4O1BA 1Z48A 3T55A 3B4UA 1B9BA 3HGSA 3DXIA 1W5NA 1L6WA 4O19A 2Y7EA 2ATSA 1ZALA 4J9JA 2NXHA 4M19A 1F76A 3ZR4A 1KM5A 1L6SA 3EX6A 3B03A 3G1FA 1JJKA 1WQ5A 4FXRA 1VQTA 5BMWA 2ISVA 1B4KA 4K6AA 2Y7GA 1T8XA 4O53A 4LY8A 5D05A 4BI6A 4DBDA 2RHGA 4ZQPA 1N7KA 1V5XA 4R33A 3NOEA 2YFNA 4WY0F 3IIXA 4NVTA 3ATZA 2OMAA 2QCDB 1TPH1 3LTYA 4O8RA 3NL3A 4ONVA 1WAUA 1ZENA 5BNKA 1I2QA 3I68A 2J24A 1K7FA 4X3ZA 3NL2A 3MI3A 4MYAA 1OYAA 4O4VA 5E93A 1U83A 3FOKA 4IX0A 3NPXA 4RK8A 1BWLA 1PE1A 5HR6A 2YSWA 3M7WA 5FESA 4OGZA 4DO4A 3O05A 4I9AA 1MZHA 3NL6A 3CB8A 3EWBX 3DFTA 3IEBA 1A5BA 4N9DA 4IOTA 2J9YA 3NQGA 4UFLA 1LM1A 3P84A 4O57A 4N2YA 1VJIA 2QCMA 3P61A 2H3BA 3HG4A 1LLWA 3W1MA 4C1KA 1GEQA 3EEGA 3L0NA 4IXXA 4TR9A 3L65A 3STGA 4QAIA 3TFCA 3C6CA 2OZ0A 2WO5A 3GDKA 3NR0A 1GZGA 3C2VA 4WUIA 3R13A 1H62A 2E5BA 3O6YX 1FX6A 1F5ZA 1GTEA 4POCA 4ML9A 4NXKA 2BSLA 5LNWA 2Y63A 2V2HA 3L66A 3EWWA 3LB0A 2HS6A 7TIMA 1TO3A 2Q3RA 4OE7A 4MYXA 4L4MA 1TCDA 2X16A 5CPOA 3C3NA 4HNTA 3CM4A 4KWWA 3FYOA 2B4GA 4LS1A 1JCLA 1PVNA 3TE9A 1OX6A 1XXXA 1P0NA 5K9DA 2ZA3A 3PR2A 3HGRA 2QCEA 3G22A 1GOXA 4UCGA 1IGSA 3OA3A 1F7BA 1U5JA 3DGRA 4YWIA 3Q94A 1LOQA 3HF3A 5DBTA 3MBFA 2DZSA 3EXSA 2ZYFA 3GDMA 3HPXA 4K37A 3GNDA 3W6YA 4WXYA 1OX4B 2G97A 3L67A 1H7NA 2DJLA 3GKAA 3TDFA 2V0TA 2V81A 2ISWA 2VELA 4XBKA 3IIZA 4WOQA 1SW7A 3W7RA 5LNSA 1W0MA 4JTGA 4JDBA 3QFEA 2C6QA 4YL2A 1PHWA 4LVDA 3A24A 5FF2A 5FF3A 2ZBTA 5D33A 1VLIA 3M9YA 1RZMA 3UPWA 1OYBA 2QDGA 3B05A 4JS3A 4LWWA 5D02A 2RDTA 2VEMA 1YTEA 1JULA 2WSQA 3IIPA 1XC4A 3CWOX 4RXGA 2ZRYA 4FX7A 2Q8ZA 2FLIA 4UC5A 3V1PA 1HUVA 1RV8A 4S2BA 3MBDA 1VCVA 3DH7A 1KM3A 3GNNA 5AHEA 2YZRA 3L0KA 3T40A 3LV5A 2QUTA 5TQLA 4WZHA 4UTIA 5HUPA 3L9CA 1UCWA 1W37A 1A5AA 2A7RA 1R46A 2VEKA 4IMEA 4UNLA 3NA8A 1KLYA 1MEHA 2RFGA 1QO5A 1DKWA 1QNVA 1SQ7A 3TJLA 1WX0A 3PWAA 2WNNA 1GVQA 4OHQA 1TPDA 4I7UA 4B5NA 2H8XA 4O14A 4O4WA 3LBMA 3Q37A 4ZVJA 4MY8A 4LC8A 3TH6A 3W7KA 2BX7A 4LV9A 3MI6A 3UWQA 3HJZA 1G7UA 3WFAA 3MO7A 3W73A 3OVPA 3F1QA 1KBIA 4MLJA 4P61A 3NQAA 3HQ1A 4JTUA 4JX5A 4HNUA 1XBXA 3CWNA 3PUEA 4OU1A 3TQ0A 3L5AA 1G4PA 5EY5A 1ICPA 1IF2A 1ICQA 3NQFA 5K9CA 4WXZA 3N19B 3G1VA 1EX5A 2CLMA 3ELFA 1OVDA 4NT0A 3DFSA 1J2WA 1THFD 1S5TA 2ISSA 1OFBA 4AF0B 4X2RA 2E77A 1W31A 1JCMP 3LXBA 1NFBA 3NXFA 4MZ1A 3WJSA 1IXPA 1SSGA 3B06A 5SWUA 3W23A 1N55A 1K3UA 2AQWA 5HMSA 2WNQA 4MFEA 4FX8A 2ZRZA 1TIMA 1SO6A 2EGZA 3EXRA 2Y7FA 1KFKA 1H7OA 3NZRA 2VFDA 2ZA2A 3P80A 1SZNA 3LTSA 1W5MA 3VE9A 3W7DA 4M6QA 1GYLA 2CLIA 1OFRA 2DJXA 2OT1A 4FNRA 3O8AA 3W1UA 2QR6A 5AFDA 3W7PA 4NJHA 5AC7A 1DBTA 4W9TA 4LU0A 1JCNA 1W3IA 4RJEA 1LYXA 3HGOA 4Q33A
chains in the Genus database with same CATH superfamily
4WSHA 4DYEA 1NM9A 2NVAA 1A5SA 4XAFA 1YTDA 3WF2A 2WZEA 1MQPA 6REQA 1W1B1 2HWGA 5TF0A 4IJCA 2B7PA 2QYGA 3DYOA 5J04A 1X1ZA 3QM3A 4IF2A 3ONBA 1Q63A 3VNLA 4GISA 3U2OA 2OO0A 1PJ9A 2FJUB 3MCMA 4C65A 4UFMA 1E0TA 2B7NA 3GXIA 4XTIA 2IPFA 3AXKA 2QCLA 4AXKA 2QGYA 3BG5A 4W88A 4XVEA 2H6RA 1J0HA 1HO1A 2Q71A 3N73A 3VYLA 5CPTA 5FF4A 2XSBA 4YCPA 1UUOA 2VX7A 1Z69A 2VFGA 3THCA 3ZQ9A 3HPZA 1EO5A 4H7CA 2V2DA 1UJPA 1ZQ5A 4K3ZA 5A6BD 1PKNA 2NUWA 2REQA 1EPVA 3OLEA 2J8FA 4WHBA 5EMKA 2WBKA 1RBOB 4PMNA 4M7TA 4MDOA 4R7OA 1K9TA 3T07A 4HD5A 1IV8A 4RXFA 3H70A 3CUGA 1H41A 2WJEA 4ORMA 2RGLA 3USZA 1NVMA 5HQMA 1OCJA 3IARA 1V3HA 5ENLA 3H7UA 1M68A 1CT5A 2YXGA 1UASA 2QXWA 3C0SA 4CD6A 1E72M 1TKKA 1TV2A 3KFTA 3PAJA 2OQYA 1J9YA 2WBGA 1OGBA 3TAKA 5CZSA 5FEZA 3STCA 4M7SA 1KGWA 3VOJA 4XD4A 2W6RA 1MW3A 1KV5A 1RHCA 3NPUA 5GPRA 3DBPA 3WF1A 1CGXA 1UW9A 1KTCA 2PWDA 4N42A 5D9NA 1VGAA 4PL1A 2YKKA 2ZX6A 3HPSA 1SUXA 4TV5A 5CPMA 2WMJA 4J3XA 1AH0A 1TRIA 3F4CA 1TZZA 3IUDA 2A3LA 3KBNA 2P0OA 2UBPC 4H7ZA 1J0ZA 4U3AA 3S3GA 1PWLA 3GC4A 1UWAA 3MMDA 4HU8A 4B15A 3PFRA 4Z1BA 5EBAA 3T05A 3LK6A 1AW5A 2V69A 4E2DA 4S3CA 5CG7A 4GXWA 1V3KA 5HAOA 2HJPA 4JQ4A 1XLGA 3OBKA 3VIIA 4JEQA 2ISDA 3UR2A 3MWAA 5BROA 2DUZA 2BHZA 3QEZA 1Q8JA 2QJMA 4KCWA 4MWAD 3EX2A 2WHLA 4ZQNA 2JBMA 2NV2A 3W22A 3NSXA 4NAFB 4GBDA 1QTWA 5HWMA 4GRSA 3NQCA 2PLCA 3PC0A 3N4FA 5AC6A 3R0DA 2NX1A 1R30A 3NG3A 1MW0A 2P1FA 4GYFA 3D6NA 1YYAA 4YNGA 3ARXA 4CEUC 2ZX8A 1TPWA 2VEPA 1H1YA 5EMYA 2F84A 4M81A 2O55A 5E9XA 2I9EA 2A5HA 3DGBA 3RF9A 1V6VA 4Z2JA 3GVVA 1RJRA 1J5TA 1ZS2A 4URIA 1AA1B 4Q6XA 3R79A 1W1PA 1EJUC 4YJ5A 4FAMA 2EEXA 1K03A 1KD0A 2X1SA 3TONA 1M6JA 4QFUA 3OHIA 2QLYA 3KDNA 1OB0A 1GVRA 1FHVA 5I0DA 3ZS4A 3GTHA 3THUA 4M29A 1K8CA 4X60A 1UR1A 4C6MA 1WKYA 4Y90A 4O1CA 1BKSA 2O7SA 3A9BA 3KHDA 4HCDA 4CU7A 2A3HA 3KL3A 1C7TA 2FHBA 5T26A 1KW1A 4UBPC 1PB0A 3DUGA 2PAJA 3PUOA 5I7GA 4DO6A 4PB5A 4BI5A 3UZYA 3S1VA 3W07A 4LEFA 1GEHA 3NFUA 3RDKA 3TUUA 1OIFA 4RZBA 1EHAA 4O0ZA 4Y9AA 3O63A 1H5YA 1ME8A 3N15A 7TAAA 3BE7A 3QY6A 3VU2A 4YTRA 2PS2A 4QG9A 1EF3A 1UH4A 2BY2A 3N4EA 2BOEX 1TA3B 2PDUA 4KWOA 4H83A 3QSRA 1QR7A 3WMBA 5IFPA 4Q8VA 1CW2A 3S5OA 3QGKC 4RCXA 4HJFA 3UGRA 3QTGA 1TR1A 3RU6A 2AL2B 3AXHA 1HQTA 2JK2A 1UD6A 1BWKA 2JFEX 1W8GA 3W01A 1V0KA 4ERAA 3GU1A 4H8NA 4QP0A 1TMQA 1OBAA 1X1OA 2C18A 2FZMA 5C0QA 1GOQA 3KBJA 2XDFA 3KVJA 3VKDA 3ZR6A 3W3OA 1KRAC 4DF2A 1UP3A 4HN4A 1F6PA 1E55A 5H6HA 3OQ8A 3IIVA 4CQAA 3PG8A 1FWSA 3N6JA 4LW7A 4WGXA 4BJHA 4DWDA 3BQ5A 1TV5A 2FB3A 3W6MA 2EPMX 4H01A 2CHRA 4XZBA 3RPMA 1WYIA 4FF7A 2CKSA 4Z2KA 3ZIZA 3WLIA 2ZQ0A 1DIDA 1KM1A 1YHTA 2P8CA 4CD5A 1Z7AA 3PBUA 3RM9A 4A6GA 5D09A 4JL1A 5D8WA 3A5FA 2D2HA 5JVLA 4B5TA 4MB1A 1EDQA 5BU9A 3GXPA 2R8WA 4YPJA 3SQMA 4TMCA 4LSBA 2XIOA 5BCAA 2Z4GA 5I06A 1XYLA 1U1UA 2G41A 5AC8A 1S2AA 3SRHA 3E02A 3VE7A 2KZHA 2HVOA 4HNOA 2VZOA 1BFNA 4J5NA 4L9ZA 1BYDA 2PDKA 3PNZA 3TW9A 2GUYA 1U5VA 3VGBA 2WNWA 1UG6A 3WENA 4Q32A 3BAXA 2V68A 2OODA 1PIIA 5L6UA 1TCMA 7ODCA 3RIKA 4NKCA 3ZJ6A 3WLRA 4QG8A 1ZJBA 4LRTA 3C2FA 1KFWA 3WLTA 3BH4A 1TR9A 4KPLA 5I3HA 1BWVA 3ZT5A 4KETA 1KC7A 4IJBA 1CENA 3SGZA 4HGXA 2V67A 3LHZA 1Q6RA 5LIWX 3LCFA 1XRTA 3TWAA 1JAEA 1OC6A 1Q2RA 4G56A 4I5UA 1TMLA 4LBSA 2EO7A 2AQOA 3HIJA 4Q8OA 3AI0A 2Y89A 3MCNA 4CNPA 1HG3A 2NQZA 2ZXAA 1HO4A 4IPIA 4JX4A 3DHFA 4ECLA 2VOMA 5I07A 3WEZA 1PWMA 4L9XA 1B3WA 5G1YA 2J8TA 1ADOA 5F4SA 4L61A 4HJWA 1X6LA 2FH8A 1E1FA 4GQBA 2YGYA 1ME7A 1JZ2A 3NAVA 4EPBC 3E0FA 3OYXA 3DOPA 4LF2A 9XIMA 3LM3A 3RJYA 3UCCA 3AYTA 1MI3A 3KCJA 1EDGA 4HCLA 4QITA 3DC8A 2BGNE 5D2XA 3SIZA 4TX6A 3W2UA 4KEMA 3NIYA 3PUGA 4JTHA 1UUQA 1TWIA 5GVJA 1YADA 3TVAA 1OK6A 4QSFA 2DORA 5CZTA 1DJIA 3LDVA 1FOBA 4F0KA 1CCWB 5DELA 1XIDA 4DO7A 1A5MC 3I7SA 2GQAA 3MUCA 3AS0A 3S83A 3KRZA 5LGXA 3UPBA 1XCXA 3L7RA 1XIIA 1DWHM 1SR0A 3WQGA 1VFTA 1XBYA 3P7YA 1VPYA 4DZHA 4GYPA 1W2PA 2PTZA 3W9ZA 5A5WA 3NQ8A 1OX5A 3M5XA 2PDMA 1E73M 3CU2A 2AL1A 3QTPA 1H61A 3B0VC 2UY3A 1F61A 2A6LA 2FPVA 3G1YA 4JNMA 2W92A 1OSEA 3LOTA 2CLOA 1E6ZA 1XLCA 1YXCA 4MZYA 3AZSA 6ALDA 3AMLA 3LHYA 5EMUA 2FGBA 2YW3A 1G4EA 4REQB 1OK4A 3OTRA 5CPSA 3LLXA 2Q8LA 5I09A 3M44A 5IFTA 3N3TA 1P0DA 1XIBA 3B0UX 4S3BA 2QDDA 3UZ5A 1O12A 3H23A 3GWQA 2G5WA 5EA9A 2FMOA 3OVQA 3M6YA 5MKGB 3V1HA 2XN0A 3C0JA 3E3HA 3NQ2A 2F38A 5BOOA 4LS0A 4RNFA 4AMAA 1KLZA 1UR2A 4MNMA 4L9YA 5TBOA 5DBUA 3QC0A 4EP8C 1Q7ZA 1A0CA 4TV6A 2YL9A 4LUSB 3QQ1A 3VGHA 1GW1A 1F73A 3R89A 4LYRA 3ARWA 5CGQA 3P82A 4K39A 2ABBA 4R88A 2HVMA 5DRCA 5CGTA 2A1YA 3CHVA 3DFQA 1C29A 3CUFA 1H0IA 1UBPC 5AOUA 1KXQA 1HNYA 1KFBA 3TSDA 1HN1A 1NWSA 2IPWA 2QJGA 2AAMA 4DF0A 1LROA 5BRQA 3K4WA 1D7FA 1CGWA 1RBLA 2XH4A 4N4QA 2X0SA 1UB3A 3WJZA 1OCQA 1PZ3A 1UWUA 4ORIA 1GZ1A 5F4WA 3MZNA 5E6ZA 3A22A 4KCUA 4E2BA 1EPXA 3VAVA 4QDWA 4XB3A 3STEA 2W5FA 2A21A 2NXGA 3IJ6A 4IFKA 4N02A 2IPGA 5DMMA 4MB3A 1YTKA 5CGMA 4TXEA 5DO8A 1GORA 3PPFA 1H7XA 1R9XA 1SYTA 2G3MA 1MRQA 1UOZA 4S3KA 4GZJA 2G4JA 3W7QA 4AFYA 4XZNX 2YDSA 4IJRA 3UG4A 1EJSC 2PLMA 4Q8MA 1RA5A 3I6EA 1MEIA 1R7AA 3CAKA 1QNRA 1DJHA 1OF6A 4HU4A 3WMCA 4HZ6A 5I03A 2GFTA 5JUVA 3QYQA 1HL8A 2OVLA 4AUBA 3W70A 1B4EA 1VENA 3QRHA 1W5PA 4GI4A 4CQDA 4LYKA 4OOUA 5LIKX 1W5OA 3VCCA 1JNEA 1RJPA 1EBHA 4C6CA 3RK8A 3EKGA 5A6JA 4YCOA 3E5BA 1S2VA 3OGRA 3N13A 2DUXA 4IGSA 4CQ8A 2BOFX 1H63A 3SCWA 3NDZA 4ZSTA 3QJAA 4UTTA 1CXLA 1XYBA 2XIBA 3UJRA 3S2NA 4GBUA 3W81A 4AHOA 3OZMA 1BTMA 2GJXA 1UHVA 3NO3A 3PBYA 3CYJA 2ZVRA 1ZGDA 3R5EA 4MKVA 1Y5WA 3FA5A 3HU7A 2AAAA 1K8XA 5AYYA 4N6FA 3DU0A 3OG3A 4X9SA 1TE1A 4AZ6A 4CKQA 2YXOA 1PX4A 4CCDA 2PD9A 4CCEA 2XFRA 1XLJA 1Q8AA 3V75A 4AVFA 1EXBA 4BWLA 3N17A 4U31A 4Q7NA 3WK0A 2FGZA 2V82A 4H9XA 1SJAA 2ADAA 2V5KA 3GUGA 4NRRA 5D9PA 2TPSA 5K7JA 3CZGA 3B40A 4X22A 1Q6LA 3WH7A 3MTWA 4C1NA 1C90A 3KLKA 3BLFA 4RDYA 2PPGA 1KR0A 3FN9A 3PZOA 1SSDA 3IGUA 4F9DA 5G1TA 4AZCA 3L0GA 5DF0A 3WLNA 4QDMA 1V51A 3VCRA 6A3HA 2P0IA 4B3ZA 3KVKA 4MF4A 1YMYA 2FTPA 2QEZA 5DY2A 1I0DA 5JMUA 4ATWA 2WMHA 3NDOA 5DRIA 1JZ4A 2BY1A 4PUDA 4ZODA 4ZTYA 4EF8A 3I7QA 1EB3A 1EZWA 4FA3A 3MT1A 1LCOA 3L2LA 3WLQA 3LQLA 1M65A 2IKGA 3KZSA 1QAPA 1CIUA 3EXTA 3ZZ1A 5A8OA 2AL2A 1W1YA 4O16A 3LI1A 3RCYA 1PX8A 2F6KA 3DERA 4C5YA 1FXQA 3QH2A 1OFEA 5GJNA 1XIHA 2Q8XA 5KZDA 2CU0A 1GQNA 1BEUA 1OHLA 1UZHA 4O54A 3OGSA 2ZUNA 3D0CA 3TYUA 3ZSSA 1XBVA 1NWRA 1OFQA 4NP7A 4BQ4A 1MSSA 4XBSA 1W5QA 5D2TA 2Z28A 3HURA 3ZLGA 1XUUA 1KA9F 3OG2A 2RDXA 2WZIA 4HU0A 4RW5A 7CGTA 4B5VA 5MF5A 2PU1A 3HZ3A 1E6PA 3WFZA 2G3NA 1UD3A 2GOKA 1VR6A 1P43A 4Q8TA 4W5ZA 1B2YA 3TXVA 1WZLA 3BAYA 1K9DA 1E6SM 3MSYA 1QPKA 4TX9A 3CHEA 1WKEA 2DZUA 5D04C 2QQ6A 4C7GA 3F2DA 1JYWA 3KOXA 1XIGA 2NW0A 3GX9A 4Y6GA 4KF1A 3WQOA 5G2HA 3RX4A 1A80A 4AU0A 1T5AA 4EOUA 1K7XA 1IXOA 2PP0A 3ALFA 3DX5A 2VFFA 4V28A 1PCWA 1U1JA 2BY0A 5H8PA 4H9VA 4PFMA 2J6VA 4EAMA 5LIUX 4W5UA 1KQYA 1IHIA 3OPSA 4PUMA 4A8NA 3CHDA 3C0QA 4ASTA 4RLIA 1DE5A 1OF8A 4JN7A 4Y7EA 2QW5A 3W2LA 4FZIA 5E1QA 2J79A 3MKVA 4F79A 1FA2A 2XVKA 5A2AA 5IHSA 2DT3A 1EEXA 2A2IA 4M82A 1L2QA 4G7FA 4X63A 3KOWA 2F7FA 3EWCA 3UWWA 2GGEA 3B9AA 1TPVA 3PVFA 1WDDA 4HHPA 1AW2A 4CVUA 2R94A 3R8RA 4DJED 4US5D 2JQXA 3COTA 4FEZA 5AHNA 3E9AA 1O95A 2V63A 3LYEA 2DZXA 4BQ3A 2BVDA 3KL5A 2J27A 1WBJA 2QUVA 1TYGA 3KHJA 4KGJA 1A0EA 3VA8A 3ZVIA 2ODOA 2J7FA 1ZB5A 4HT3A 4K68A 2J6XA 5FEPA 4GXMA 3G5EA 2DDXA 4MUZA 3PPCA 1EJTC 4ILSA 3QPEA 4RZ4A 1VCGA 3MSDA 4DI8A 4CU8A 3MUAA 3W4RA 3FEMA 6CGTA 1XPGA 1LRTA 2ZUSA 1KV8A 1B90A 1F4AA 4E3TA 3BLKA 3CHCA 3PTMA 2A85A 3KXQA 4PC8A 1XINA 3OO2A 3A4JA 1E4MM 5K3VA 1HKVA 3H2NA 1C3FA 2V9DA 2WJDA 4CNOA 2DW6A 4LUTA 4JHOA 1XDLA 4Z08A 4Z2HA 4HYVA 1MUMA 4DUXA 3S1UA 3TXZA 3G0UA 4GX8A 3LXCA 1LT7A 4PB4A 1G94A 1L9WA 5A1AA 4DJDD 1N8WA 3M43A 4DLMA 4XIMA 1XPYA 3LSBA 3LPFA 1CZ1A 5A3HA 2Z1WA 3GVRA 3S47A 4PMZA 1E70M 2I56A 1FDZA 1B0IA 1B30A 1QOXA 3S9YA 2GQ8A 4E5TA 1NEYA 5EFDA 3UNTA 1ELSA 1HKMA 1POJA 3AHZA 1UOKA 2VEIA 4JYFA 1TZ9A 1V6TA 3AALA 1M01A 1HGWA 5DT7A 4FIRA 5HUOA 4LYQA 1FHUA 4NZ3A 3W7HA 4RPQA 1R3TA 4I7VA 4KFPA 1R0MA 4UMAA 1H4PA 3ARVA 1J11A 3WBAA 1V6UA 4MJZA 3CIVA 2QUMA 4FLQA 3ANUA 1TUXA 2BG5A 1G6CA 5E70A 4X0NA 1R3VA 2A3EA 3PWIA 4XG1A 1FQ0A 3N34A 3ZT6A 1C8YA 1J96A 4QROA 3MB9A 2BXYA 1CLKA 4LUSA 5HQEA 2FVKA 1AH3A 4CQ9A 3VNIA 1KNWA 2Z7KA 3DCPA 3W1QA 5CBIA 4B4FA 2HSAA 4D6EA 4EPKA 1RBAA 1SZGA 1EO7A 2YCIX 5HPOA 4BS0A 4F66A 1EWDA 1HVXA 5C9RA 4Z2IA 3GIYA 4AY7A 1LWIA 4HOZA 2J7BA 4AHQA 2RKXA 3FJ4A 2G3IA 1J4EA 1XJBA 2G96A 3N3MA 4Q4SA 4P7NA 2XN2A 4FHAA 4PTMA 1G7VA 1LBFA 1XGEA 2PA6A 5G4HC 3IVTA 4UQ9A 1Y65A 4J3SA 1FHLA 5DCBA 1XSIA 1LG1A 3GFZA 4WR3A 4M6PA 2DV0A 2ICSA 1P48A 1PX3A 2V3DA 1YE6A 3LCWA 5I02A 3RMEA 2WCSA 4D8AA 2FVLA 2X30A 2NLYA 3MKCA 3G8RA 3IANA 4N9BA 2HVNA 3PY2A 2FIQA 1ZJHA 4JEJA 4O1BA 3B4UA 1B9BA 3DXIA 1JYNA 4PRWA 1L6WA 2Y7EA 4W7UA 2NXHA 3QKZA 3NQBA 3A3XA 1L6SA 3F2BA 2PDHA 3SM0A 5HANA 1VQTA 2X2YA 4P7OA 1S46A 2OOFA 1NOUA 1E1EA 4RE4A 4WY0F 3N2TA 1KBBA 2QCDB 1TPH1 1TV4A 2WW5A 1ZENA 4HHHA 1OYAA 3A6OA 4YS1A 1IEXA 1S2TA 3FHQA 5HR6A 5M17A 3BAWA 4MWAC 4ZOBA 3NL6A 3L4WA 4MNLA 2XM2A 3MS8A 3IEBA 1KCKA 1LLOA 3VDCA 2OO6A 4IOTA 2P53A 4S3DA 4UFLA 5FD0A 4O57A 1HGYA 2KX9A 2NQ5A 1W9PA 3U5YA 3HG4A 4GJIA 3ZT7A 1LLWA 1UKSA 2XVPA 5EFFA 1J6OA 4C1KA 4CN6A 3WNLA 3GIQA 1UWTA 2FHCA 2EPNA 4FLSA 4QAIA 3EOEA 3TFCA 3C6CA 2OZ0A 3JZUA 3QZ6A 1GZGA 4EXAA 4WUIA 3I3DA 4DRSA 4XD5A 3M7SA 8CGTA 3VD4A 3UEQA 1XC6A 4NZ1A 1C7SA 1JZ8A 4LPCA 5LNWA 4PTWA 3I4EA 4KERA 3SB0A 2JEPA 2HS6A 4R9OA 7TIMA 2WCAA 2Q3RA 3VM5A 4I5RA 5I2UA 1UPMB 1TCDA 5CPOA 1L0PA 2GLKA 4KW2A 4KWWA 3WLPA 3KDOA 4LAUA 1JCLA 2POTA 4FOKA 5K9DA 3PR2A 3HGRA 3G22A 1ZTVA 1MWOA 3HF3A 4GPNA 5DBTA 1JYVA 2ZYFA 3GDMA 7REQB 3AS2A 1XX1A 2DVXA 3HPXA 4NZ4A 1IYXA 4WXYA 2GDQA 3DBNA 4XBKA 4WOQA 5I5RA 4AEFA 3FVDA 4JDBA 4YL2A 4LVDA 4J1OA 3IJLA 1VLIA 3M9YA 1RZMA 5CLWA 3VDGA 4JTDA 2IKHA 3AIVA 1V6YA 5D02A 4HK7A 1XSKA 2VEMA 1JULA 3IIPA 5A2BA 3O9NA 5FAGA 3R11A 4FX7A 4PTVA 1DHKA 5TNVA 1E9YB 3ZXWA 1C92A 4IL2A 1VCVA 4U5KA 3E2SA 4HMNA 4FR1A 5A6LA 1XDJA 3CL7A 3L0KA 2CC0A 4B9YA 3LV5A 2QF8A 1QXLA 3ARZA 4PRRA 2W62A 4DAFA 5HUPA 1KRMA 2A7RA 2VDHA 3NA8A 2WAGA 2YLLA 3WQPA 1PZ0A 1QO5A 5DMYA 4V33A 1XYFA 3PZTA 3EMZA 5CG0A 1VFUA 3F4VA 4AMCA 4PZVA 4HA1A 4MG4A 1A5LC 2UWFA 3FSUA 1XLKA 3TLQA 5A69A 3W7KA 2BX7A 3UWQA 1QJWA 3GG0A 4AQLA 3MSRA 5JBDA 4AX6A 4MAZA 1U5HA 1V3LA 2QV4A 3HQ1A 4JTAA 4FS9A 4OU1A 3CO4A 3RPTA 2O9RA 2PDFA 1IF2A 4JKMA 1KXHA 2OZTA 5BOEA 3DFSA 5JBEA 1VFHA 2VR2A 2E77A 5GQBA 1JCMP 4OIFA 1NFBA 3NXFA 3WJSA 4R85A 1IXPA 3CMJA 1VJZA 3B06A 5SWUA 4DI9A 4ZO7A 2AQWA 3AXXA 2BDQA 3F7JA 3WLOA 3B8TA 2Q09A 3N2CA 2Y7FA 1KFKA 3BOFA 3NZRA 2VFDA 1ZZMA 2RJHA 2GJRA 3NCOA 1W9DM 2ZA2A 3LTSA 3E74A 1GOIA 4OOZA 4M24A 5JBFA 2WMIB 4HN8A 2BV9A 2CLIA 2O9TA 1OFRA 1JDEA 4FNRA 1VRXA 3O8AA 3W7PA 4ZCWA 3V7PA 2XHYA 2X09A 1AJ0A 1W3IA 2ZX9A 3HJEA 5ABFA 1PXGA 3BMWA 3GO2A 5I79A 1DE6A 1FWDC 2YB1A 4GC4A 1K8ZA 4GO9A 4WF7A 4IIGA 2DZBA 1C91A 2Y5SA 5FKYA 1SZRA 1J2BA 2A6NA 4S38A 3SN1A 1BXCA 3WD4A 1Q6EA 3GM8A 4HTBA 1XH2A 3IVUA 4XKYB 1K6WA 3AXMA 1FRBA 2HTMA 1FWAC 3WEMA 4FNTA 1GHSA 4GVIA 3BPWA 4WRHA 4PUUA 1S2CA 2GUUA 1BKHA 1Q3NA 3CH0A 2G3JA 4CCZA 4C5ZA 1KR1A 1ISZA 1Z42A 2ZIDA 2GVEA 2J25A 4AY1A 2VC6A 2VENA 1FWCC 3UFYA 4J3WA 3WNOA 2XN1A 4ZO9A 3FGCA 4TX8A 4R34A 3KOFA 1B3VA 3AJ7A 1ZNNA 4KESA 3FK4A 2E9LA 4PTXA 3H7VA 3GFXA 3CMGA 1NQKA 2HS8A 2X1IA 1U22A 3SRDA 1VFMA 1FDJA 4QEEA 2X7VA 4HCHA 3WJYA 3URNA 4HSOA 2OT0A 4UTHA 1DTNA 2PWEA 3W88A 1YX1A 3KTCA 1TQJA 3DHUA 6PTDA 1V0LA 2GSHA 5ECUA 3PG9A 3W7CA 1PSCA 2CHNA 1XDMA 4B90A 2YW4A 2VRQA 1X1NA 3BW4A 1T7LA 4XZHA 5H8UA 2DP3A 3WUFA 3W84A 3NM3A 3ES7A 1I0BA 1U1HA 3P3BA 3BCFA 3TR9A 4NY2A 5G2WA 2YIHA 2F6UA 3BZJA 1LF1A 3B9NA 5IBXC 4HP5A 4D6CA 4D72A 5I3GA 1JUEA 2VFIA 3EKLA 1XIEA 4MZ8A 3MHFA 3WNNA 4GJJA 4XZ9A 3B4YA 2CCRA 3QPYA 1JCYA 4MJMA 5F4XA 2NX9A 1DOSA 2EPHA 1REQB 5HK4A 3PZGA 1TTJA 2VR5A 4N0RA 3DG7A 1M03A 2FZDA 1UC4A 4RZ6A 6TAAA 1Z3NA 4PCTA 3M5ZA 1QI2A 3RG6A 1WNOA 2DSVA 4RDWA 1RQEA 3F4NA 2WKJA 3CLWA 2JF6A 3SECA 1X7IA 4X9YA 3WL1A 2BVTA 3W00A 1NFGA 3M5VA 1QHZA 2NXIA 5CSUA 2ABAA 3WD0A 2ZUUA 4W87A 3GXTA 4PSPA 3JW7A 2WMGA 2EPKX 3LZ3A 1HJUA 1E3ZA 3CT7A 1VFSA 2NQ9A 1MFVA 4NSBA 1I60A 2X05A 3RFAA 2J47A 5IXEA 1GCYA 2A3BA 2V5BA 2PCQA 3KOZA 3ZM8A 4ACZA 1WDRA 3LCHA 4IQJA 3WL0A 2H8ZA 3EB3A 2R6OA 3VUPA 1TTIA 2PD5A 4LC6A 8XIAA 4NNCA 3P8JA 4FB7A 1UJQA 3C2YA 4L80A 3HFTA 1D3HA 4IQDA 4JYDA 4NILA 3P74A 2CWXA 2FGLA 2WMFA 5K2ZA 3FDKA 1G01A 3STFA 3JS3A 3A9IA 1KKOA 5BXRA 2ASHA 3THAA 4AEEA 4EK7A 3GAKA 1E6RA 1SO3A 3FLUA 4HPNA 3EOSA 2NLIA 3LM7A 5A6AA 3WK1A 1EZ2A 1R86A 5AHIA 3VILA 2Z6JA 3K1DA 3AICA 4C6DA 1OQFA 2R1MA 1R87A 5I3IA 1J79A 2YDRA 3EYPA 1QUMA 3UR7A 4LCRA 4GVHA 1K77A 6XIAA 3PB0A 1W3JA 4WQ6A 2E09A 4AD4A 4KKXA 3QLDA 4XD3A 2VQUA 3LENA 4O11A 2XM1A 4Q8NA 4O1DA 1ONWA 2C1HA 2ZZ5A 3B9EA 1ISWA 5C7HA 1EFZA 2VOTA 1WUEA 4A8IA 2GJLA 4PH6A 3RITA 1VZWA 3HMCA 2VCCA 3R4IA 3HG2A 1MQQA 2D0FA 4D1IA 1GJUA 2BP1A 4ERGA 2Y7DA 4D9PA 3P81A 3DAQA 2YL5A 3LCIA 3WDHA 2B7OA 1LOLA 2TSYA 4LT9A 4MY9A 3M41A 2YCKX 2J77A 3MHUA 5A8GA 3PZQA 5LZLA 2OOGA 2D3LA 3C61A 3MUY1 3OBAA 5DMLA 4IG2A 3LGDA 4JTEA 5FJRA 4F0RA 3N2OA 2CERA 4LV4A 4XWUA 3AC0A 4GZIA 5KZMA 1XKJA 3S4TA 5D2WA 1AUSL 5DQPA 4CN4A 3EGJA 2E5DA 1XV8A 2A3AA 3DKLA 3NDYA 2R1NA 1R5YA 5C55A 4M1RA 4H6RA 3T0TA 1TX2A 4H6QA 3WUGA 2AGKA 5T9BG 1UP2A 3UQNA 5FJPA 1TPUA 3E0WA 4AISA 3K8MA 2E8ZA 4IPLA 3BSHA 2BFGA 1M7JA 2ACSA 1ECQA 1QK2A 4DWSD 2X8RA 1ECEA 5DCDA 3RCNA 1ADSA 4V2XA 3O0FA 3QMRA 4JTIA 5FACA 3AISA 5CZKA 4OUEA 4DUOA 9XIAA 4X0VA 1V7YA 4PA8A 2EKGA 1QASA 4DBEA 2XVGA 1FWHC 4LYPA 2FDMA 4TUFA 5T9CE 3CT2A 1ZHAA 1OZMA 2O92A 3DFHA 3FKRA 5HMFA 1AL8A 2R14A 5HA7A 2TYSA 2R24A 3TTOA 5BRPA 1W3TA 2DZAA 3LLDA 4F0SA 1A3HA 3PSVA 1CBGA 3DECA 3MY9A 2E40A 4MMWA 5CC6A 2XIMA 1Q4NX 4XVDA 1EBGA 2DIKA 4A8LA 1EYEA 1FWJC 2UZ9A 3UU0A 4LTSA 4OT7A 3CQ0A 5LNRA 3SCVA 1LL7A 1QPNA 1J01A 3G1AA 5LNVA 2EG6A 1SO4A 1P7TB 1JZ7A 1ITCA 4I5XA 4GABA 3AWOA 1ODZA 1TUFA 3PBVA 2Z2BA 1EX1A 4MWAA 3TSBA 1XD0A 4GCXA 3WQ6A 4P8XA 1IZCA 4WJXA 5U7SA 1L6YA 2JGQA 4ZZ9A 5EL1A 2JIEA 3T7VA 2Z2UA 5GNXA 4HIBA 3QMTA 5CAHA 2MUCA 3IJDA 3E6EA 4DXVA 4PFHA 2OWWA 4LJ3A 3APTA 4ZGYA 1Z6KA 1EUAA 3YPIA 1MVYA 3M5YA 4QISA 4FNQA 1GPWA 3NEVA 3MZ2A 3P60A 2WK2A 4U2ZA 1X7FA 3FYYA 3VZXA 4D6IA 3LGEA 1VEOA 2PDYA 2QZRA 5GNYA 2VP8A 4HA4A 1CLXA 2CXEA 4NU7A 3FV9A 2E6FA 4L4PA 3NPWA 1G0CA 3OP2A 3TU9A 1HW6A 1WDQA 3GFYA 2B0MA 3HPAA 4JX6A 3IGSA 3N1AA 2PDQA 1NOFA 2J4GA 1XP3A 1JD9A 3KVLA 4KCVA 1CDGA 3SCNA 3MQTA 4E38A 1C8VA 4PODA 3CYVA 4PL2A 2DVTA 5JU6A 4JFSA 4EF9A 2W66A 3VGFA 3WZ0E 1B3XA 3W76A 1SR9A 4UQDA 4JAWA 4S1FA 2J7HA 4GINA 1H09A 1UPPA 3F03K 4RE0A 1O1ZA 4FNUA 4NUWA 1SZEA 1AODA 5EBUA 3W7MA 1M5WA 4MVAA 5DLCA 4UFIA 3OB8A 3LRLA 2WZHA 3W1TA 2Z0IA 3AHVA 3C2OA 4DXXA 3G1SA 4GK8A 5CZJA 1E9ZB 1W56A 2XWEA 2ZUWA 2ALDA 3BC9A 2O4MA 3T0AA 4O1AA 1DXFA 4WD0A 1O4UA 2E6AA 2X1UA 1FWNA 4JOMA 3M6DA 4YIWA 3S9IA 3O15A 1AQHA 3GNPA 2BWGA 1HX0A 3SUWA 4P5UA 3MUZ1 3HMJG 2CXGA 2AOSA 3P62A 3SZ8A 4EE9A 2DVUA 4CD4A 3GZAA 4LAZA 2WC3A 1KRCC 2R1KA 3NZ1A 3M46A 1XLDA 5D32A 2XTKA 3CTTA 2CLKA 4IPNB 3RM4A 5LA0A 4B2DA 1F6YA 3ARPA 1ZRQA 4RNIA 5BU6A 4HB7A 2PLJA 5E5CA 3NM1A 1B3YA 2DFAA 3MP5A 3O2LA 3UESA 4Z1YA 2G37A 2QS8A 3APYA 3ITVA 3SDOA 1WA3A 3BCJA 3OBEA 4PCSA 3WMSA 2A79A 1PDZA 2PBGA 4FXFA 3L2MA 1DQXA 2VC7A 2WCGA 2A0NA 4W7VA 4DJDC 3BLEA 5CJ5A 4PUJA 3DG3A 3B8WA 3BICA 1A49A 4GKTA 4F9JA 4C6OA 3VDBA 2BOGX 3EX3A 5D2VA 1TB3A 1WXJA 1SFTA 5KSWA 3BAKA 3QKEA 3I7RA 3WEOA 3TV8A 1KM2A 3U8GA 3VFCA 1IIGA 1E51A 2D24A 2NV9A 5DX7A 4OKDA 8A3HA 3UA3A 2WJFA 5H1WA 3W7LA 1W1A1 5FF7A 3B0XA 1JZ5A 3GXFA 5TD4A 4L65A 3E2RA 3G3DA 1RR2A 2VGFA 3TZNA 3BGJA 2WNZA 1HXJA 3C56A 1P0EA 1CXIA 3UXDA 2J9ZA 1ISXA 2YDAA 5FJUA 1EGZA 2YCJA 1ZBKA 4HZMA 5FEXA 1GNXA 4ZFCA 2A7PA 3EMQA 3W7IA 9CGTA 5EYWA 3MYOA 3K8LA 3GBEA 1R85A 3GXNA 2VC5A 2Z2AA 1DJWA 3S1WA 3BGGA 1KWKA 3TOYA 3H21A 3Q65A 5TAOA 1P1XA 3T8LA 3NVDA 1WPCA 3IJ7A 4GQQA 5CJMA 3OZOA 3GAYA 4PMUA 2WYSA 3LV6A 3LTPA 5DXYA 4A4AA 2F61A 3W38A 4W85A 4YTUA 3PBMA 1D9EA 2HDJA 1N8FA 1O5KA 3GY1A 1KGXA 3KX6A 1DWIM 2XGIA 1Y5XA 3H4GA 4AVNA 2Z1KA 3HQNA 1OGGA 4B5XA 2W79A 2GDUA 4F3HA 4IFOA 1FH9A 2X40A 4LCQA 1SJCA 3UNDA 1ML1A 4LH8A 3A47A 3HFYA 5BMXA 2ZKMX 1IEWA 3F4WA 3GRIA 3MJYA 2CLLA 4O50A 2BBFA 1O68A 1F8MA 3BJSA 4P8UA 3WNKA 2PRLA 5T8GA 3VOHA 3DI1A 3MMWA 2QJIA 2X2GA 5EMJA 3AZRA 3V0UA 2AQVA 3OOQA 4HMDA 3PJTA 2OTDA 4YN5A 3OJGA 1EHNA 4JNYA 4QJ1A 4ZSUA 4MDPA 3CQJA 4YTQA 4HPHA 4AYGA 1KFCA 5HATA 3UETA 1W3HA 3SIMA 3A5VA 3H7RA 2WMKA 4DX3A 2XWDA 4HNCA 4FNPA 4GUJA 3CEPA 1QI0A 3U4FA 4QHRA 3TYDA 1JF5A 4JTRA 5C71A 2W91A 3KTSA 1R47A 3E38A 2VX5A 4GG9A 9RUBA 4GNVA 5IBXA 1IWAA 3EA2A 2PMQA 4B5UA 4L4LA 4RV8A 3ZOAA 5LA1A 4JD4A 3NOYA 1IZKA 1Z8AA 3WH6A 4CNTA 1OWQA 3ZJ7A 3AAMA 5I3KA 2X42A 1WP6A 2Z25A 4PCPA 4QTGA 2OJPA 4GY1A 3BARA 3NWRA 4M6UA 1W9XA 2NSOA 2Y85A 3GDLA 1ODUA 1AFSA 3QHOA 2IKIA 1RK5A 4INFA 1YBQA 1NDZA 5FF0A 5E9AA 5FL1A 2R1LA 2XINA 5BXSA 4AW7A 3N6QA 4CNUA 4B5SA 3B0PA 1R2RA 1J0YA 1Q13A 1LBMA 2FTYA 3KVMA 1ESWA 2C79A 4E6MA 4NL1A 1RPKA 1E4NA 1QK0A 4DVOA 1UWRA 2WV8A 4MSSA 1VYPX 3Q58A 3P5ZA 5AB3A 3GNXA 1GOKA 1W9BM 1P5BA 3ORWA 2YL8A 2FB2A 2C1GA 4ZEPA 4A3HA 3FJNA 4HPXA 1JNDA 4GA8A 4J3TA 4PUEA 3SUSA 4F48A 4QNWA 3P0XA 4MKNA 4QS6A 3BZGA 5AKQA 1LG2A 5I3FA 2YFOA 4QJ4B 1T8QA 3W1NA 4J3VA 4HVXA 2W4XA 3U48A 2V6AA 3Q45A 3LHTA 1FFQA 1JZ3A 3BJFA 4JIPA 1JFXA 4I8YA 4D2JA 2BTMA 3WKZA 1J8VA 1IWPA 1HFBA 4GY7A 3RO6A 1Q6DA 2PDPA 2ZCGA 1TZ7A 5F7UA 2XFYA 3JU2A 3AMGA 4M0XA 4MJ2A 1CGYA 2VEGA 3IACA 1J6PA 3W7GA 1OG0A 3H24A 3TAOA 4F40A 4EXQA 1A3XA 1CXEA 1TV7A 1FY6A 4A35A 2C91A 4UCFA 2ZUTA 3VIKA 1IZJA 1K4GA 3PM6A 3TEVA 1MUWA 3ARUA 3G0XA 2WSRA 2VX6A 3T09A 2NSXA 3HGJA 1RCOB 1JCXA 4AF0A 1LDCA 3JR2A 5HQLA 2DZPA 5A8MA 4Q7IA 2E68A 1HF6A 3RUBL 1LUCB 4AAJA 4YWSA 4AZ5A 1CGVA 3GK0A 2BGQA 4JGDA 2QIIA 4DJFC 4KRUA 1I45A 3GTIA 1EP1A 1XG4A 1PPIA 4GH3A 3RHGA 4A3QA 1XIMA 1S38A 3QOKA 4O0QA 4RPPA 1P7TA 1H51A 3WQ5A 5FEWA 3PP7A 1M1BA 2YX0A 4MM1A 5J5DA 2DQXA 3D46A 5HXMA 5JH2A 4Y96A 2XIJA 2NZLA 2HROA 4LNYA 1D7KA 1ZBWA 4GE8A 4XO7A 4UTWC 1UQZA 3W86A 3UG5A 4BCEA 3L12A 4O17A 3LX9A 1ALDA 1JF6A 2ZC8A 3VXGA 1S5VA 4PB3A 3BLIA 5D4YA 3RAOA 3SGGA 1I1WA 3AOFA 3VMOA 3QY7A 4KWSA 4GOAA 4I3GA 3CZEA 4YXGA 5HNTA 3TX9A 4S3GA 3GDBA 2XPKA 3W72A 2E0PA 1JPHA 1T6MA 1TFVA 4V1YA 4L5ZA 4S2CA 2C71A 3JVAA 3GE7A 3WBYA 3WLKX 3W82A 4BQ5A 1EA0A 4NHVA 4OWGA 4BF9A 1FVPA 8XIMA 1DJQA 1E0UA 1XH1A 3WFLA 2ZZ6A 1ADDA 1EQPA 4DM2A 4WCJA 1CEOA 3LRKA 4ML4A 4IFKB 1V02E 3W0KA 4KRTA 1TQXA 3A21A 1ZY9A 1UWIA 3EDJA 1HL9A 3JRKA 3ZVHA 3BXWA 2JGYA 4BQ2A 3IGXA 4GVFA 2QMJA 3E2VA 2UY2A 4J3ZA 3AJXA 3TA6A 4ENLA 1WUFA 1BQGA 3TK7A 1YEYA 3CPUA 1L2UA 2V5CA 2Z00A 1KFEA 3WQDA 1OFOA 5C70A 1LP6A 2I17A 1F74A 1NWTA 4IWWA 3S6OA 1Q6OA 3G2GA 2QULA 4GD0A 3GQYA 3ITGA 3NQ6A 4UXDA 1SJBA 3GG7A 4WDXA 5AHFA 4XISA 2ZUMA 2ZTJA 3H26A 4ZQRA 2X7WA 2E6YA 2V2CA 2YJQA 4JN6A 4JY9A 5I00A 4IIEA 5KEZA 2OEMA 3K8KA 4JTJA 1V3IA 1E15A 1TPFA 4LGXA 1UD5A 2GK1A 1E0VA 4IGHA 1G69A 5G4WA 1PYMA 1MQRA 5TIMA 1TPB1 4O28A 3PSWA 4WY0A 5BXTA 2CNCA 1MO0A 1MDRA 4NNAA 4FP1A 5C9XA 4PCFA 3WJXA 3EDEA 1R3WA 2INFA 1S1PA 3N04A 3N9SA 1VFFA 1OCBA 4R3UA 4O13A 2JKPA 4PULA 3FAXA 1PV8A 2GJXB 2RDWA 4J4KA 3EDFA 1MEWA 2XGZA 3MA8A 3FJ6A 3SFKA 4QLKA 1MNSA 1BHGA 3UWVA 2GJNA 1MDLA 3TFXA 2DU2A 1S3TC 1NJJA 1XF0A 4OTKA 2CBVA 3HO8A 3A3WA 2Z1VA 1H7PA 3IK2A 4NJJA 4S3EA 1VF8A 4NZJA 1AMKA 1KKRA 3CASA 4Y9PA 3LA4A 3AHTA 3CXOA 4C6PA 4YVVA 1U30A 1TJ1A 1ZUAX 2OWCA 4M19A 3ZR4A 1H11A 1RCQA 3TJIA 2ON3A 3CV6A 3RM8A 3B03A 3VDHA 1XRSA 1WQ5A 4FXRA 4MNJA 4NASA 2ISVA 3W26A 4E2VA 2XUCA 4O53A 5D05A 4A8RA 4C1NB 1N7KA 4Z42C 2OLHA 4R33A 2YFNA 1CGUA 4NVTA 2E67A 3VD9A 4BZYA 1B9ZA 1EJWC 4AZCB 3CQKA 3VOIA 3I68A 1K7FA 4X3ZA 3MI3A 4MYAA 4O4VA 2ESCA 3FOKA 4GFIA 4RK8A 3T08A 2P3ZA 3ABXA 1EF2A 3WQVA 3M7WA 4OGZA 4DO4A 4I9AA 1MZHA 2PTXA 3WQFA 1EC9A 4N9DA 4Q3MA 1ISVA 4S3FA 4GYJA 2WVVB 4QJ5B 2UY4A 2FZ9A 2CBIA 3AS3A 3CQIA 1LM1A 4ZXLA 3WDIA 2J74A 1AJ2A 2B31A 4PMOA 2QCMA 2E7FA 1GEQA 3DEQA 5GJPA 3STGA 5HNUA 2WO5A 3WF0A 4NRSA 3NR0A 3OA5A 1BD0A 4DUWA 4IZGA 3R13A 1IR2A 3S2MA 3CAWA 4KT2A 2EPOA 3WLHA 1FX6A 3EMCA 2DY3A 1FFRA 1EOKA 1TG7A 3TTEA 4NXKA 2OR2A 5AZ0A 3CZ8A 4E4UA 3L66A 2I57A 2ZX7A 1NY1A 3GU9A 2CEQA 1QI4A 3CUZA 4IIHA 5AY7A 5AZ1A 2E25A 4MYXA 1QNQA 4L4MA 3QZAA 2BMBA 2XH2A 3L4VA 3T0BA 4HNTA 1JFHA 3FYOA 1GONA 2GYIA 2PDLA 4LS1A 4H7VA 3DYMA 4DBWA 4R9XA 1P0NA 1C93A 2ZA3A 1NTHA 4AG0A 4UCGA 1TV3A 3OA3A 1F7BA 4W84A 4JPGA 3DESA 3AMDA 4QGCA 1GUVA 4K37A 3NUKA 2G97A 3M0YA 2DJLA 3TDFA 2ISWA 3ITOA 3IIZA 4B91A 3M0HA 1OGSA 5HOSA 2WM1A 1PHWA 5FF2A 2OYMA 5B7ZA 1F8IA 3JZEA 3LNPA 1H5VA 5CSYA 2P5NA 3B05A 5CJNA 4JS3A 1YTEA 2D0HA 1XC4A 3FA3A 4RXGA 2I16A 2ZRYA 2O56A 1RV8A 4S2BA 3FX4A 1CWYA 3DH7A 4C90A 1KM3A 4DJDA 4W4QA 1QW8A 2YZRA 4LQ1A 3T40A 2FMNA 1TX0A 2QUTA 1VB9A 4UTIA 1W37A 3B0YA 4JFWA 1XQLA 4L7ZA 2VEKA 4IMEA 4UNLA 5CPQA 1KLYA 2RFGA 3VC6A 2BB0A 1QNVA 1SQ7A 1WX0A 2GJPA 3U57A 3IJQA 1BG4A 1TPDA 3B8IA 3M0JA 4Q4MA 4B5NA 4EX4A 4O14A 4O4WA 2ZE3A 1IQ8A 3LBMA 3Q37A 3QGAC 1P6CA 1BPLB 1G7UA 2XVLA 3W73A 3OVPA 3F1QA 4MLJA 4P61A 4W93A 3NQAA 2WZTA 3GNOA 4JX5A 4HNUA 3PUEA 3TQ0A 3L5AA 1W9UA 2V3GA 1ICPA 3HQPA 3LQGA 4WXZA 5K9CA 3LS9A 4JFTA 3L4YA 5FCZA 2ZICA 4H6EA 1XGDA 3WUEA 2BXZA 3GD6A 1S5TA 2PP3A 3G77A 3QLLA 4DHGA 3E1F1 1QT1A 1V4YA 3GH7A 3K2GA 2G4FA 4MZ1A 1SM9A 4ICCX 1SSGA 5BYWA 1Q66A 1ITXA 4MFEA 1CYGA 2YOCA 3UZXA 1SO6A 1QBAA 4K8GA 1Y5VA 3EXRA 4M1BA 5A8NA 3MVTA 3U2EA 1D2KA 3WSUA 1EQCA 3UGVA 1P0BA 1LWJA 3P80A 4L6HA 2VHLA 1W5MA 2F6XA 3W7DA 4H41A 4DWSC 1QVBA 4M6QA 1GYLA 2DJXA 2OT1A 1WZAA 1E6QM 1AMYA 1XLMA 3BMXA 4F8XA 1BRLB 1K6AA 4LUTB 4WJ8A 5ABEA 3C86A 4LAMA 4Q33A 2QUNA 3TR2A 1AQFA 4Q8UA 1T96A 1DL3A 2EHHA 2TMDA 3PUDA 2Y8KA 2I14A 3ARSA 3ISIX 3QVQA 1T99A 4OFCA 1UKPA 2NWSA 2ZZ4A 3H22A 3IGHX 1OADA 5M5DA 1V93A 1X6UA 2QF7A 3O6CA 1QRQA 4A05A 1GVIA 1PTDA 1EC7A 4GCAA 3VOFA 3VOCA 3VI2A 4XZMX 2C19A 4GUGA 2OKOA 1MXDA 2G8ZA 1G9HA 3FFSA 1UH3A 5U4NA 1VFOA 2FZ8A 3TN6A 2P50A 2VVNA 1YKWA 2BHYA 1S1RA 1H50A 2Y6ZA 1LUCA 5ABHA 2D3NA 1E1CB 3N2XA 3K13A 2WJZA 2OGYA 4HBKA 4B5WA 1J5SA 5AC5A 5AYBA 1T41A 4CQBA 2HNEA 3VC5A 3VIFA 4V1XA 2WLZA 4LBRA 2VRKA 1NF0A 1SO5A 2FQIA 3PF3A 3UCQA 2HV5A 3GR4A 3G3MA 4JKKA 1XW8A 4CD8A 1DWGM 2PCEA 1MMFA 3D3FA 2IXUA 4OBRA 4ZL1A 1ZP3A 4OBTA 3L21A 4P8VA 3UVAA 2V5DA 1KFJA 5DMNA 1QPRA 3NQMA 1PO9A 1CTNA 4E8GA 2JALA 1GT8A 3WDPP 4I7WA 4AIEA 3RNDA 3RX3A 5MHBA 4LB4A 4NYYA 2XFWA 4H00A 2Y8UA 5EMLA 3NURA 2DPEA 3VO0A 1FKXA 3KS5A 1V0NA 4QR6A 1JYXA 2C8NA 4LVFA 1OINA 1W3KA 5JXQA 2VNCA 5C9WA 3E0VA 3WF3A 3AIWA 3CBWA 4AWEA 3SRFA 1IR1A 4PE8A 4UTLA 3VKBA 1SMDA 2ZXDA 2INEA 1SW3A 5CAKA 1PKYA 1BSLA 2HBXA 4ZMGA 3LRMA 3VOGA 5AHLA 2EKCA 1DORA 1HKJA 1XD1A 3IAQA 1EOMA 3O1NA 3TW6A 2GDVA 2QNEA 3M0ZA 1OD0A 2J7EA 3O7UA 1K8YA 3TC7A 2CBUA 4B92A 1O6IA 3VKCA 4Y9NA 1A0DA 4MJ4A 2HPMA 4P8WA 3G1HA 3BSMA 2FDSA 1LOSA 1MW2A 2OLAA 3CS2A 4LCSA 4GI6A 4KMQA 3WNPA 1ONXA 4HOWA 3BO9A 2D69A 2FVMA 5DN1A 4HMEA 3TYZA 3OYZA 2BLEA 1V77A 2E9MA 1PKLA 5CC7A 1F05A 3N4AA 4QEHA 4EWJA 5I78A 2EBNA 2ALRA 5CSSA 2E9BA 1Q2SA 4Y8FA 1ZJAA 3U7VA 4RE3A 1YXDA 2TRSA 4UR8A 1SPQA 4L1XA 3GG8A 5C2XA 1FDYA 3RU8X 5LIYX 1NU5A 2OB3A 3TYCA 1E5JA 3GHUA 1FKWA 1YDYA 3JUGA 4F0LA 4KEUA 2EJ1A 2HPIA 5D37A 1X39A 4XAYA 3U0HA 1W91A 3WDQA 1K7EA 3WD2A 3Q67A 4JY8A 4Z0SA 2PUZA 3RR4A 3DFOA 2YDQA 3H55A 4DJFA 1L8PA 1M3UA 4C6NA 3S9ZA 4TTUA 2W67A 1FP8A 3BJTA 5M1TA 2DT2A 3F5KA 4XO6A 6ENLA 1TE6A 1IT0A 1DVJA 1SW0A 4HNNA 3HPFA 3VINA 3B04A 4DPPA 2J7GA 4B4HA 4RV3A 1TIWA 3ICJA 1HJXA 2QMKA 5CPLA 2WQDA 3CZJA 3VD3A 5FJOA 4D6HA 4U4MA 4CVWA 1GQIA 1B1YA 2VQTA 4UTWA 1MFUA 5E09A 4TQTA 1DPMA 2E5CA 4AIUA 1PHQA 3R58A 4AWUA 3VUSA 3S42A 1XLHA 2WPBA 4GNJA 2Y2WA 1NDWA 2VWSA 1N82A 2VM8A 4P2VA 2HE8A 4ZOCA 4ZXOA 3CZKA 4J35A 2XIIA 3VNMA 5HULA 3VIJA 1LRQA 1E43A 2VTFA 3ARRA 3OODA 1FUYA 3V5CA 3ONCA 4BI7A 1Z89A 3SJ3A 3HTWA 4IGMA 3ZR5A 2O7QA 3WDJA 3B97A 3AYRA 4QM1A 5E0KA 4P7QA 2G95A 3QF0A 5D9MA 4B9ZA 3K46A 3EEZA 2GGJA 2OCZA 3C2RA 2D73A 3NGFA 3VX1A 1KM0A 2Y24A 4DZAA 3EDDA 4XKMA 4W7WA 1XS2A 1GQLA 1RAKA 2WVVA 4MADA 4MOZA 4MPKA 3NQVA 5KMYA 2OX1A 1JDAA 2QAFA 3TCSA 1G4TA 4C91A 1DP0A 4GIAA 2NV1A 1X38A 5KITA 1NDYA 2YBVA 4PMQA 4U10A 2HXTA 2FHFA 3FKKA 3FJLA 3VK5A 2XVNA 2PWHA 3GXMA 1FCVA 3PHAA 1MXSA 3ZWTA 1GQJA 5JH1A 3R12A 1TREA 4UR9A 1L6FA 3CQHA 5DANA 2I5GA 2GL5A 3DIPA 3BGAA 4ZB0A 1NP0A 2ZWZA 3H53A 1DTUA 4NZ5A 4QLLA 3GVQA 3GTFA 1TMHA 3TP4A 4FOJA 3IRSA 1ZJIA 1RD5A 3ANYA 3TYAA 2WVTA 3WNMA 2ZXQA 2OPJA 1JDDA 4E0CA 1H0GA 3CAQA 1WKDA 4M56A 3DZ1A 4MFDA 3AIQA 1FWEC 3LUTA 1CXFA 2CESA 5B7YA 2JE8A 4UZUA 2NX3A 1GWJA 1H49A 1OFDA 3WY1A 3WK3A 3UVIA 2GUBA 1H2JA 1LQ0A 3GTNA 1PYFA 3QW4B 3WH5A 4F2TA 3KEHA 1LBLA 3AS1A 2E8YA 1GYNA 4KEZA 4Q7BA 4HKPA 4DAIA 3LHWA 3TTSA 1JCTA 2QT3A 4FXSA 1FWBC 1UWSA 3EOOA 4PEKA 3ARTA 4IICA 5ABGA 2VJXA 1JI2A 4BF5A 3T9PA 1KTBA 2BASA 2ZA1A 4Z2GA 1TVNA 4L56A 4CN1A 3W37A 2A7NA 1L6GA 1YW1A 4U5IA 1JD7A 3OGVA 5BRBA 4KWVA 3N2MA 2PWFA 1UD8A 3KBVA 1ENUA 5CC3A 1Q65A 1PZ1A 2Y1HA 4D1JA 1QI5A 1XCWA 2VDIA 3EWXA 4UFKA 3ZSTA 5LSMA 1E4IA 5AYXA 3POHA 3GUWA 2PRHA 1PS9A 5ABFB 3QW3A 3LLFA 1LT8A 1XBZA 2Q01A 1JR1A 3DFNA 5LNUA 4N7QA 2QCGA 5FSDC 2PDBA 3OLIA 3DFPA 4ICNA 2OSXA 3R2GA 1BG9A 3LEPA 3UA4A 3SCRA 3LGGA 2QPXA 5LGZA 3PZVA 3GVWA 2GQ9A 1AVAA 4OZOA 3RCMA 3MYPA 1P4CA 2BXVA 2GGIA 3VVGA 4UTTC 2ZZ3A 1DXIA 3THDA 1TJPA 2XH7A 3R1ZA 3GZ3A 3HQOA 1AD4A 3KBSA 4LOCA 3I65A 4TMBA 1WDSA 2GPTA 1GVYA 3L4UA 3MCOA 2ZDSA 2D20A 2QV5A 4W8AA 4LAOA 2X0HA 3PZNA 1F3XA 1UBSA 4C6KA 4LAKA 1YDNA 3MANA 3WUBA 1NF7A 3FGCB 4A2RA 5EGRA 2JIWA 5CQ1A 1IT7A 1EH9A 5FOOA 3WQEA 1W3NA 4BWLC 2QDEA 1B5TA 3N9RA 1QWGA 1PDYA 2ZC1A 1BAGA 3W02A 4GZEA 2J62A 5CXPA 1QW9A 3D3AA 3EKZA 1V79A 1BRLA 1GJPA 2BVYA 4JICA 4TU1A 4PTNA 1NOWA 1CNVA 2H9AA 1NQ6A 3LMYA 4MLRA 5A8PA 5CSRA 3SW6A 1NSJA 4BK9A 1I2OA 4ZQOA 3PPGA 3DENA 4WIWA 1NDVA 2HNHA 2WVUA 1JGIA 1MNZA 1KBJA 4U28A 1JL8A 2OZ3A 4O18A 4QQUA 4LFYA 4P7RA 1J0JA 3RLGA 1EIXA 2CBJA 4FXJA 4L1WA 4NZCA 3W7EA 3GS6A 4JN8A 1DIOA 5ECVA 3GBDA 3EB2A 1SZFA 4ATLA 3M0LA 4WEVX 1R7OA 3TJ4A 3ATYA 4IL0A 3PBWA 1GJWA 5C2GA 2ZRUA 2ZE0A 5FAJA 3BV7A 3RYSA 1TWZA 4N9CA 2XJ7A 1E1CA 3EZ4A 1EKOA 1N2VA 4PBGA 4LRSA 4HOXA 1XLEA 3U2CA 5LHEA 4FIQA 2Z1XA 3NGJA 1DWFM 5FIPA 1DHPA 2IW0A 4TVDA 2NQHA 3SRKA 1J93A 4Q4KA 4JIRA 1PTGA 4M6VA 3K4AA 1OT2A 1ZU8A 3W2NA 1KBKA 1YE4A 1EA9C 2EG7A 4Q6JA 3LSCA 3BOLA 3W83A 1Q45A 2VZUA 4U33A 2C15A 2WANA 5AYIA 1HT6A 2Y5EA 1TJRA 4GVGA 2VO5A 4GO8A 5BXPA 4DQWA 3S5ZA 2DSWA 1NAL1 2P10A 3BANA 3BV4A 2P88A 1Z9AA 2XSXA 1P0KA 1OABA 2IXVA 4NZFA 4E2OA 4EXBA 3W27A 5D03A 4PMDA 4ACZB 3A12A 4ZBCA 3W2KA 4WKAA 4I6KA 3E49A 1MZRA 4MUPA 3T4WA 4KFNA 4JTLA 2HCVA 1I75A 1E0XA 3A3HA 4RE2A 2YL6A 3C3UA 2FKPA 2PWVA 3WLJA 1HJQA 3C52A 4DYJA 4LNCA 4NJGA 3UYIA 1KGUA 3AHYA 1XCFA 3UWEA 3APGA 3CV7A 3PULA 3PBGA 6XIMA 4K7VA 4IUOA 1FWFC 4DWSA 4GLEA 4K1GA 4ADUA 3IJIA 1VKFA 3N12A 3IPWA 3RPDA 4NIRA 4C6IA 4DZIA 2WM0A 3DN5A