2AGKA

Structure of s. cerevisiae his6 protein
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
260
structure length
233
Chain Sequence
b'TKFIGCIDLHNGEVKQQHPSSYYAKLYKDRDVQGCHVIKLGPNNDDAAREALQESPQFLQVGGGINDTNCLEWLKWASKVIVTSWLFTKEGHFQLKRLERLTELCGKDRIVVDLSCRKTQDGRWIVAMNKWQTLTDLELNADTFRELRKYTNEFLIHAGGIDELLVSKLFEWTKDYDDLKIVYAGGAKSVDDLKLVDELSHGKVDLTFGSSLDIFGGNLVKFEDCCRWNEKQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneam
publication title Crystal structure of the yeast His6 enzyme suggests a reaction mechanism
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 82
structure length 233
sequence length 260
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2agkA00
5FEZA 2QCDB 3T44A 3PB2A 3PS7A 4UNKA 1O5XA 1AMKA 3HG4A 5TIMA 1S5TA 3L68A 2V0TA 3QC3A 2TSYA 3WK2A 3S1VA 1VCFA 2A4AA 3VKJA 5E1QA 3W22A 1SO4A 1ML1A 4Z1DA 3C2VA 3S5YA 4QAIA 4JTTA 4MLRA 4UTWA 1AL7A 3S9YA 1VHNA 3GVGA 5C2XA 4BK9A 4J9JA 1HO1A 3STEA 2Q8LA 1XI3A 3KFTA 1B3OA 4WUIA 4KFPA 4GRSA 5F2GA 1NFBA 3DBPA 3GR7A 3TXVA 2E6AA 2J88A 5K7JA 3W71A 3EWZA 3QJAA 4UMBA 4DQWA 5GVJA 3WK3A 1F73A 1XDMA 3LI1A 5FI8A 1VRDA 1DJQA 1LRNA 3NPWA 3LRKA 3FKRA 3QQ0A 2GUUA 5I3HA 2WV8A 3W7NA 2WKJA 5LHFA 1JUEA 4I7WA 3CQ0A 2HSAA 5LGXA 1NF7A 3EEGA 2H6RA 2Y7FA 2YPIA 3KVJA 1VCVA 4RXGA 1MSSA 3SGZA 1XL9A 3FJLA 2YYTA 3W7DA 2QUVA 5DXXA 3SECA 4C1LA 2V9DA 5EYWA 3GR8A 3DXIA 4XUGA 5K4ZA 1KM5A 4OHQA 2GVJA 3HGJA 3CT7A 2VC6A 3A23A 1TPUA 3GZ3A 5FF0A 4KKXA 1RR2A 3BG9A 4BI5A 3MI6A 5KZEA 3TC6A 1GT8A 3THQA 3SSJA 4IPIA 2YR1A 4JS3A 4YCOA 1SW3A 3ATZA 2E1DA 1T96A 3VFLA 3OVQA 3LCGA 5DLCA 5ABTA 3I65A 4FNRA 1LORA 4HPXA 4DF1A 1KFEA 3NNTA 3GB6A 8TIMA 2JKAA 1IIHA 3W3OA 5EA9A 3PR2A 4WXZA 2NXHA 2VFEA 2I9EA 3DAQA 3HG2A 4NUWA 5HUOA 4AF0B 4UTLA 3B03A 4RZ4A 4DBDA 2QJIA 3GX9A 4UUIA 3BLEA 1QPQA 2JKEA 6TIMA 3B8DA 4OV9A 3SR7A 1R2TA 1JR1A 1PHQA 5G2IA 1FCVA 3PBVA 1FDJA 2R14A 2Y88A 1H7XA 4AHPA 1OYAA 3HPXA 4UR7A 1EP1A 4ZZ9A 2A85A 1P4CA 3NOEA 3RFAA 1H7NA 3G24A 4XKYB 5AYZA 5LSMA 2RFGA 1W3IA 2YSWA 3EWWA 3W88A 1DJNA 4UFKA 1TPEA 2E5DA 2QCGA 4NNBA 4EF9A 1DV7A 3TUUA 1DL3A 3S1UA 5BMXA 5CZSA 4FO4A 2NUXA 4UTTA 2CLLA 4TU1A 2GVLA 4BWLC 1H7WA 3W1NA 3ABQA 1ZY9A 4Y9AA 2X30A 5D02A 3W83A 3NL6A 5AC7A 5F4XA 1GVFA 2CLIA 2FPTA 1BWLA 3B0UX 1ZAJA 3LHYA 2DJLA 3EX2A 4JYEA 1FCUA 4MVAA 4IWWA 1YLVA 3NQAA 2B7QA 4DXVA 1KLYA 4Z08A 3CPRA 3HF3A 1EX5A 3RLUA 2NXIA 2ZA3A 4LVAA 1D9EA 4XWUA 2KZHA 5CG7A 4WJEA 5HWMA 2ZDRA 3PC0A 5G1TA 1H1ZA 3E9AA 1JUKA 1F5ZA 3EWBX 3UWVA 4N2YA 3QMTA 2V5LA 2QAPA 3UZ5A 3S5OA 4DF0A 4AXKA 3VE7A 3DGRA 1R46A 1CX9A 3P84A 4DPPA 3G0UA 3T4CA 3EKLA 4FXRA 2XN2A 5D38A 4X22A 5D32A 5G5IA 1H7OA 2CWNA 1F6PA 3MYOA 3TQ0A 1ZENA 1YXCA 1H61A 4OV4A 3GKFA 3N9SA 4X2RA 3SIZA 4ONVA 4A2SA 4ALDA 3AO0A 3W1LA 3WJXA 5AN7A 4ZQMA 3WJSA 3MI2A 3I7SA 1KV5A 1F6KA 4CQ9A 2VENA 3GYEA 3KVMA 3BG5A 4QNWA 3L5MA 4N9EA 4AB4A 5D09A 5CKSA 1Q6QA 4HNTA 3PB0A 2WJZA 3RU6A 4N6FA 3VCRA 3EWUA 3C2FA 3TA6A 1YXDA 4ZQCA 2Y70A 4QITA 3O15A 2FB3A 3SFKA 1VPXA 2FDSA 2YFNA 4MYAA 4M6PA 3STGA 2F7FA 3GDLA 1VHCA 2E09A 2C3ZA 4JN6A 3S1XA 1B4KA 2R8WA 4LT9A 3W84A 3W2JA 1QPRA 1TV5A 4MY9A 3NZ1A 3A24A 4O18A 1JCMP 4N9BA 3IIOA 4JTKA 1F2JA 2FQIA 3NPUA 3UXDA 5HMSA 1W31A 2JK2A 3UYCA 5AHMA 4AWUA 2ZZ5A 1OX4B 1OJXA 3R2GA 2B7PA 5BNKA 3N2XA 3TJLA 3O07A 2PRHA 3CWOX 1HUVA 4NU7A 3DENA 1B9BA 3TSDA 4CCDA 3PUDA 4JD4A 1U5JA 3TC7A 3W2KA 1LBLA 4ZQOA 1W5PA 1W5OA 4JIQA 3TSMA 1Z42A 3IGUA 1G4TA 1KFLA 3MBDA 3WK0A 4Y8FA 1X1ZA 3MJYA 3B4UA 5E0KA 4AH7A 3DFTA 1EA0A 1K8XA 3LTPA 1PS9A 1KFCA 3RF9A 4RLIA 3UWYA 1VYPX 2ZRYA 4K36A 2G96A 3TQVA 4RX0A 4YLWA 4E38A 1OF8A 3O6CA 3FJ6A 1I2RA 2ALDA 3A21A 1G7UA 4O10A 1LZOA 1MZHA 4MZYA 1GVSA 3PF3A 1WX0A 1YTEA 5LGZA 3R8RA 1J5TA 3G1XA 2ZFAA 3T40A 3LXAA 5LNVA 4IGHA 2QDGA 4K37A 1RV8A 2XN1A 2G5WA 3C52A 2BZNA 2A7NA 4IMCA 1TPDA 5F2LA 5U4NA 1LP6A 2WNNA 4FX6M 2VFHA 2GJLA 1BWKA 4LOCA 1EPXA 1FDZA 2O7SA 4M6QA 4DELA 4K38A 5AYYA 3W1XA 2A0NA 4Z1AA 4A22A 5C6MA 3M41A 5AOUA 4LVDA 1MEHA 1H5YA 4UTIA 2E6DA 4UFJA 3NYZA 4Z0SA 1W54A 1GVQA 3FLUA 2ZZ1A 4MKNA 1JCXA 4CNPA 5IM51 2QCEA 3HGOA 4ADTA 3TMLA 3L0KA 3TW7A 5CSRA 1ZAIA 3MWAA 1GJPA 2ZTJA 3U8GA 1QNVA 5FEXA 5DCBA 4PC8A 2DZWA 5H91A 1Z41A 3N9RA 4S2BA 3NEVA 3HOJA 4IMGA 1A5CA 3W86A 3ZR4A 1WV2A 1OG0A 4JX4A 4GBUA 2Y63A 3R13A 3QH2A 4RK8A 1KTNA 1IXNA 1Q45A 3HBLA 5CPLA 1W3NA 3BV4A 1H1YA 3P7YA 1VYRA 4M7TA 3TIMA 2C16A 3O63A 2CZ5A 1IXQA 3LI0A 4LC8A 3V75A 4HKPA 1XDLA 2C13A 5H2ZA 4O12A 2OZ0A 5TBOA 5FESA 3KRSA 3M9YA 1RQBA 5FEWA 1SO3A 2W79A 2H90A 4RZ6A 4H3DA 1WXJA 3S6DA 2ZRXA 4O50A 4A29A 1KTBA 2H8XA 1UB3A 3WJWA 2DU2A 4FNPA 5D30A 1AL8A 1GG1A 5FEPA 2ZRUA 4H4IA 1ONRA 2D73A 5HR7A 2DZSA 1ME8A 1LCOA 3W85A 1UCWA 4JX5A 3G0XA 4LS0A 3OVPA 4Z0JA 4I7VA 1QDSA 2CLMA 4NX5A 3D0CA 3SJ3A 4JTIA 1XC4A 3LHZA 3HG5A 4HNUA 2XFWA 2C19A 1UUMA 1QAPA 2W0UA 1KA9F 3M6YA 4UTJA 3HIJA 5FF2A 4Q4KA 3M44A 3W70A 5F2IA 2WSRA 1FWTA 4ZQRA 3PG9A 1I8JA 3F4NA 4AHOA 4Z1BA 3LX9A 3LXBA 3QQ1A 4HSOA 3G1AA 4PA8A 4RCXA 3NA8A 1TIMA 4N02A 4JTHA 3IVSA 5DELA 3G1FA 3W7MA 3KRUA 3NQCA 4IX2A 1P0NA 4GNJA 2CFFA 1PV8A 4N4PA 2OT1A 1I2QA 3M5ZA 1FQ0A 3NPVA 5LNUA 1H7RA 2YZRA 3IRDA 5LNSA 1OFQA 1WOBA 3MHGA 3BW4A 3TSBA 1HO4A 1KLZA 4NZJA 1KM6A 1SQ7A 4FEZA 3F03K 4CCCA 2ZZ2A 4FIQA 5LNRA 1KBJA 1OVDA 5KZDA 1U83A 3DI0A 3DFQA 1AG1O 4OE7A 4U28A 4LS2A 3NQDA 3CM4A 1V7YA 4I7UA 2ZRWA 4O17A 2G97A 3NPXA 2Y62A 3A22A 3KHJA 1ZALA 3G1DA 1VLIA 5G2HA 1VQTA 4K8HA 1A53A 3H54A 3TXZA 3P8JA 4TMBA 2CLEA 2E6YA 2VFIA 2YCEA 4NJIA 2EKCA 3EX1A 3GDKA 3W1TA 4OGZA 4JXCA 2J24A 3LDVA 1G4PA 1GWJA 1SW0A 2H8ZA 1O95A 3MO7A 1JQXA 5L9FA 5AC8A 3TFXA 3E96A 1K8YA 4UCGA 1W8SA 5KSWA 1O4UA 3G1YA 3O05A 3USBA 1L6SA 1JRCA 5LKYA 3OEXA 5I3GA 2QCLA 2GJNA 3GIYA 1EWDA 1XCFA 3FEMA 2WSQA 3TROA 2QJGA 1TPB1 3NQGA 1YPFA 3GNNA 1C29A 3RNDA 2P0OA 4LTSA 5KZMA 1TREA 4LV4A 1R30A 3M16A 4L4LA 4R33A 3DZ1A 3I6RA 4CQAA 2A7RA 1KFKA 3NO5A 1P5BA 3W75A 3TR2A 3U2OA 2E6FA 1HL2A 4Y96A 2TPSA 2C6QA 4RJEA 1JCJA 3QSRA 4YWIA 3SI9A 4XTIA 1IGSA 2DZUA 5D2VA 1EUAA 4ORIA 2NUWA 4ADSA 3W7HA 1LOSA 3A5FA 1OHLA 3L5AA 4RXFA 3O16A 2FFCA 3W7LA 2GQAA 3PG8A 2QCNA 4HSNA 2Z6JA 3P74A 1FCBA 3BGJA 3BW2A 3PBUA 4FHAA 4O1BA 1TYGA 1RD5A 4HNNA 2WSYA 5D2YA 1YTKA 5D2TA 4QQ3A 2RKXA 3MYPA 3VI2A 2X2GA 2QR6A 1LLZA 2V2DA 4UMAA 4S2CA 1TJRA 4K8EA 3W2NA 5CZJA 2QDHA 5BOOA 3EWXA 2ZZ6A 3H55A 4S1FA 1SSGA 4AEOA 4TMCA 1QPNA 3H53A 4JY8A 5EKYA 2VXNA 3M43A 3Q58A 4PH6A 2QEZA 2PURA 1GG0A 3W1UA 2E68A 4N4QA 1QO2A 4D2JA 4OWGA 1TMHA 1XFBA 3LXCA 2WOQA 3DKLA 3EKZA 1FXPA 1W5MA 3LLFA 1OFOA 2WNZA 3ABSA 3PUEA 3OVRA 1Z48A 3GKAA 3QW3A 3KVKA 1ZCOA 4R7JA 4AWSA 1L2UA 2BXVA 3UZJA 1SU5A 3RLVA 4FB7A 5J5RA 2NX9A 5K4XA 1S5WA 2QF7A 3L0GA 3TKFA 5KITA 2CZDA 3IVTA 3NQFA 5D33A 2I14A 2PE4A 5A5WA 1LRTA 1G6CA 3BPWA 1GTEA 2CZEA 1OFBA 3PSVA 5DCDA 3NG3A 1T99A 4AAJA 2B7NA 1EEPA 4FNUA 1KBIA 5CSSA 3QZEA 2A6LA 3C4UA 3JRKA 4R53A 1P1XA 3LTYA 1GTHA 3UY7A 4MOZA 5D37A 2Y89A 3HGSA 1TPH1 1HTIA 2E5CA 2J9ZA 2TRSA 3W7JA 2V81A 1A5AA 2R94A 1JUBA 1X6UA 3DI1A 5EY5A 1O5KA 3FYPA 2BLEA 4E0CA 4TR9A 2H3DA 5HJLA 2AAMA 1UASA 1FCQA 1H50A 4MZ8A 3W72A 3EB2A 3FOKA 1WBJA 5CPNA 1G4EA 1W1ZA 3IVUA 4KFNA 3UWUA 3B06A 3MP3A 4BI6A 3BW3A 1FY6A 1EWEA 4OU1A 1OX4A 4YCPA 2NX1A 3TDFA 3NGJA 2HS8A 1PCWA 2CZFA 2NV2A 2QKFA 1I2NA 2CLKA 3B0PA 4DO6A 1TQXA 3P81A 5D04C 1XKYA 3TAKA 4LVGA 4GJ1A 4MYXA 2ZRVA 3IIXA 2YW4A 1H7PA 2NV1A 4GUGA 5K2ZA 3G1HA 2EGZA 3LM7A 3LHTA 3S0CA 1IIGA 2QAFA 3W2LA 4M19A 3P8IA 2Y6ZA 3KAOA 1P0KA 3IIZA 1EP3A 3LLDA 4P2VA 4HNVA 4Q32A 3PM6A 3WJZA 1I2OA 2QJHA 3W6YA 3LTSA 5MHBA 3T78A 2GVGA 3PY2A 2Y85A 1KW1A 2TYSA 1LBFA 1G4SA 5D05A 1K3UA 3QYQA 3MHUA 2C15A 4GWEA 1SO6A 1QR7A 4LU0A 1LBMA 2PRLA 3G8EA 4Q33A 1LYXA 2YXGA 2YW3A 4UTUA 5J5DA 4XQ6A 4BWLA 3VE9A 1FWSA 4WOZA 1UBSA 2QCMA 3TV8A 3TX9A 4KFOA 5AC6A 3FKKA 1RZMA 4XZ9A 3IIPA 3ABOA 2YYUA 1VC4A 2ZCGA 2B0MA 4CNOA 3L21A 2Q3OA 3EXRA 3YPIA 3QMRA 4O4WA 4JTJA 2LLEA 3A9IA 4O54A 2V8ZA 1VCGA 3MP4A 4JR5A 3KXQA 4UFHA 4O1DA 4EOUA 3BARA 3NQVA 5A8GA 4Z1CA 1PHWA 3W7CA 2NLIA 1W3TA 3HMJG 2V30A 3ABRA 1JCYA 2I1OA 1IXOA 1H62A 4BFAA 5G2WA 2A1YA 4LNYA 2FPYA 1TPFA 2Z6IA 1N8FA 2AQWA 2HS6A 3HPSA 3BLIA 3S8HA 5AHEA 4MY1A 3ZWSA 3QSTA 4QM1A 2J6XA 2X1SA 2ZTKA 4LUIA 1VYSX 1S5VA 4LW7A 1EP2A 1KFBA 2B4GA 3P82A 5DXYA 1BEUA 1O94A 4O13A 2ZRZA 3LCWA 5BMWA 3G0SA 1ZAHA 1H51A 4WY0F 3NAVA 4QNEA 4EF8A 4WY0A 1YDVA 1AW5A 2QCFA 1NF0A 3JS3A 3QPZA 4HHPA 3EWYA 4PTNA 1B57A 1I2PA 3G1VA 3NM1A 1AW1A 1V5XA 2ZBTA 2VEMA 3HQ1A 2A7PA 3P62A 3IGSA 3P67A 5AB3A 2FIQA 1SZFA 1TPWA 1IXPA 3W87A 1A50A 2FB2A 1QPOA 4XBSA 3UD6A 4FNQA 3MBFA 4ZQPA 5HULA 1Z44A 2CLHA 4O1AA 1TTIA 5I3JA 5EMUA 1TO3A 3QRHA 5CPOA 3MHFA 2A5HA 4CLMA 1J4EA 1QMLA 2OT0A 1TTPA 3NQ8A 4PL1A 2VEKA 2X16A 3PULA 4IXXA 4MFEA 1VH7A 3B0VC 2BTMA 5EBUA 3QF0A 3UXAA 3GLCA 1DKWA 1ZHAA 1VJIA 3W7QA 2VOMA 2JGQA 2J9YA 2ISWA 4MZ1A 2QUUA 3TE9A 1YDNA 3N2MA 2Y61A 4ORMA 3HGRA 4QISA 3STCA 1IF2A 3QEZA 4CQ8A 3OIXA 2QCCA 4O0ZA 3DH7A 4I9AA 4O11A 3W73A 4O19A 4UFIA 4JICA 2PRMA 5HQEA 3DU0A 1N55A 2DORA 3KVLA 4MLJA 1I4NA 1YDOA 2NUYA 1TB3A 3DFSA 4RZ5A 3B04A 3HPZA 4WXYA 2BX7A 5EL1A 3P5YA 1G69A 4RKAA 3TAOA 3ZS4A 2JBMA 2X1RA 3EXSA 2X1UA 3LV5A 3E12A 4LC6A 3CIWA 1I45A 1JCNA 2YGYA 3G18A 4ZQNA 3AJXA 1KM3A 3W07A 6ALDA 1R47A 2QCDA 3WK1A 3R12A 1DVJA 4XTDA 1W56A 4IMDA 1GOXA 2ISSA 4O16A 4W9TA 3W9ZA 5KTLA 3EX6A 1BKSA 1YYAA 3LOTA 1F76A 5HWNA 1OF6A 1ME9A 5AHIA 1L9WA 3LBMA 1JRBA 3E0IA 4LS1A 2DZXA 3L9CA 3GDMA 1QFEA 2YX0A 1OYCA 3LRLA 4WOQA 2PCQA 5U7SA 4IQLA 5D2XA 1F7BA 4IUOA 1N7KA 3LHVA 4K7VA 2WNQA 2WPBA 1TPVA 3FA5A 1LLWA 3EX4A 4JDYA 3W7IA 4UR8A 1Q6OA 1O60A 1FUYA 3W2MA 7TIMA 3WJYA 1PCKA 1GZGA 2R91A 1JJKA 3LGEA 2UV8G 4DF2A 1EB3A 5FF3A 3W76A 1D3HA 1RVGA 1SFJA 2A2IA 2RDUA 1KM4A 1G67A 5DCEA 3W1RA 4IXHA 4MJZA 4E2BA 1ME7A 2TMDA 4JNMA 4ICNA 3GXTA 3C2EA 1G7VA 3LCXA 3UPBA 4BF9A 2ZA1A 1OFAA 5AYXA 4A3UA 3NXFA 3N34A 3UWWA 3BGGA 1XBYA 1FXQA 4UC5A 3CU2A 2DJXA 1NEYA 1SO5A 5DY2A 1F74A 4RR4A 3IEBA 3PVFA 3THAA 1TV7A 2XN0A 1H63A 2ATMA 4M7SA 2NX3A 3KX6A 4NJJA 3ANYA 3F1QA 3KOFA 1FDYA 2C0AA 2ZA2A 4UTTC 5LNWA 1JQVA 3CEPA 3UY8A 4UFMA 3C8FA 4E2DA 1NSJA 1XM3A 1W0MA 3W7GA 4JGDA 2OJPA 3CLMA 4HT3A 3GAKA 1GVRA 3MW7A 3WFAA 2VFFA 3BG3A 2P10A 3LRMA 4K7YA 3ZFHA 3TU9A 3IV3A 5F4SA 3G22A 3G8RA 4FX8A 1OFDA 4R34A 1SZGA 4UTHA 4NT0A 4OT7A 1K03A 2Y7EA 4AF0A 3FIGA 1M7PA 1C8VA 5E93A 4PFMA 3SW6A 2YFOA 3M47A 1YTDA 3ZWTA 1C9DA 1PL9A 5G4WA 3STFA 2EHHA 3PWAA 3W1AA 3S5ZA 2FPVA 3O6DA 3FS2A 1MEWA 2J27A 2DZVA 3TQKA 3P80A 4WX2A 1YPIA 4FF7A 4A2RA 1HG3A 4UMCA 1PE1A 2HTMA 1QWGA 4XKYA 1ZJIA 1AW2A 5K3VA 2V82A 1GQNA 4O28A 4LVBA 1NVMA 1Y0EA 3N3MA 4NQ1A 4DPQA 2F84A 3L67A 1TCDA 3DFPA 1CI1A 4JYDA 2ABAA 3NL5A 3SY5A 4K6AA 4JYFA 4Y6GA 1L6YA 3SGUA 3LB0A 1KFJA 1ZFJA 1W37A 2OX1A 4NJGA 3W23A 4XBKA 4AMAA 2A21A 3C6CA 5CZTA 4ZMGA 2GQ8A 3GK0A 3IIVA 4MPQA 3R5EA 4CNNA 4TIMA 2VKZG 3MMTA 4ZL1A 5G1YA 5G4EA 4YXGA 1WA3A 1S3HA 3LHUA 3K30A 4PODA 2P1FA 1EIXA 5AHNA 1DOSA 4JTSA 3C2OA 4JTGA 1A5BA 4NX0A 1K7XA 2DP3A 5L6UA 2AGKA 4A21A 1FWNA 4FNTA 3W7OA 2VEIA 1T8XA 1F05A 2QCHA 2RH9A 4FXSA 4DBEA 2Y7DA 1WAUA 3C0JA 1GPWA 3HO8A 2FLIA 3QMSA 4UTKA 2VELA 1KM1A 1KM0A 4NJHA 2O7QA 1GEQA 1D3GA 1DQXA 4GUJA 4H6KA 1DORA 2X1TA 4O1CA 1TRDA 4BI7A 3NQ7A 3L65A 3Q37A 3MI3A 4POCA 3NQ2A 1SUXA 3V1PA 4MJMA 5AHFA 1H60A 1YXYA 4UTMA 5KMYA 4LRTA 4ML9A 5DY3A 4PCFA 3NDOA 3TCEA 4O15A 3M0ZA 2GPTA 3CEUA 3NL2A 4PL2A 1XBXA 5TQLA 3LCFA 5K9CA 1K8ZA 3LBCA 4KWVA 4JDBA 1NAL1 1QO5A 3DKJA 3TH6A 3U6WA 4LWWA 2ZZ3A 1DBTA 1GYNA 4O53A 2YDAA 2EF9A 3G3DA 3O06A 4UXDA 4NNAA 1BTMA 3R89A 3VNDA 4GXMA 1GYLA 1ALDA 3OA3A 2BWGA 5CPMA 1K7EA 1R2RA 4DEFA 2B7OA 3O8AA 4RV8A 3TNOA 1J2WA 3ATYA 4BR1A 4QSHA 2C14A 3ELFA 4WZHA 1JCLA 1XXXA 5BRBA 3A5VA 3GDTA 3P61A 1SPQA 1WYIA 4X9SA 1OFPA 1VS1A 4FX7A 3OHIA 1QOQA 4GUHA 1OK4A 4LVFA 4AWTA 2W6RA 4UNLA 3HJZA 4M5PA 1PIIA 5C55A 2ZYFA 4TX9A 4LV9A 2ZZ7A 2RDWA 3TW6A 3N19B 4LRSA 1UJPA 5LZLA 1ICQA 1GVOA 2NXGA 3LHWA 2C18A 3W7PA 1KTCA 3GXNA 1TV8A 4O52A 3NQEA 3NQ6A 3QM3A 3B05A 4N9CA 2H3BA 1JVNA 3PBYA 3CHVA 3I7QA 3TMQA 1VLWA 3UPWA 5IBXC 4NJKA 3S5NA 4JIPA 5D2WA 3GAYA 1JULA 3O1NA 5K9DA 3UWQA 3M1ZA 2ABBA 4TO8A 1B4EA 4O0KA 1MEIA 3CIXA 3L66A 3C56A 4MY8A 1OYBA 2GQ9A 3T7VA 4IJBA 4LUJA 4YL2A 1OABA 2Q3RA 4O8RA 3C3NA 5I3FA 3L0NA 1TTQA 1AK5A 4MUZA 4IOTA 4U4MA 1SZEA 2CLFA 2E77A 1Q6RA 1SW7A 3L2IA 4O14A 5F1UA 4WQ6A 5DBTA 2VEPA 4JY9A 4JEQA 3M5YA 3L5LA 4GUFA 5D03A 5F2MA 3BK0A 4AHQA 5I3KA 1OX6A 1E51A 1OX5A 3W2UA 1LOQA 1MXSA 2JKPA 1XBVA 3Q94A 1FX6A 3BLFA 5KINA 1OFRA 2OMAA 4N6EA 4JTFA 4GE8A 1L6WA 4NZFA 3E49A 2RDTA 4NVTA 1UUOA 1RPXA 3N73A 2G95A 3RMJA 3NL3A 2ISVA 2JGYA 2OCZA 1TSIA 1TRIA 2VFGA 3I7RA 5K9XA 5DN1A 1ZNNA 5HINA 4ADUA 1SSDA 5CZ0A 3JR2A 4DO4A 3NZRA 1XUZA 1LOLA 3FYOA 3FFSA 5BW6A 5HUPA 3P60A 4MFDA 5HR6A 2A6NA 1ADOA 3LCIA 2Q8ZA 5CGQA 3S42A 5SWUA 2V2CA 1TTJA 4NXSA 2CU0A 3E02A 4CCEA 2DZTA 3M7WA 3INPA 3I68A 3NR0A 3LCHA 5FF7A 4UFLA 3W1QA 1SFLA 3TK7A 3CC1A 4ZVJA 1QCWA 1YADA 1LDCA 1VZWA 4N9DA 3N14A 1PVNA 4IX0A 4Y90A 5I3IA 1W5NA 2DZPA 4EIVA 1QOPA 2Z2UA 3CWNA 3OBKA 4K39A 1DQWA 5AFDA 4FNSA 2CLOA 1LRQA 3W7EA 3UNDA 1HFBA 2IQTA 1FWRA 3GXPA 2NZLA 3EXTA 5C5YA 3PAJA 5F4WA 1SZNA 2GOUA 2NWRA 4HN4A 3DHDA 4JX6A 1DHPA 3M5VA 4O57A 5F1VA 1X7FA 2CW6A 3NVTA 2NWSA 4GFSA 2FJKA 4UTWC 5IBXA 4YMZA 1M6JA 5HWJA 1T0OA 3CB8A 4HIBA 1Q3NA 5AHLA 2WQPA 3S1WA 1XBZA 4IPJA 1RQEA 1RQHA 2QUTA 2RHGA 3W7RA 3IGXA 1FWWA 3MP5A 1W5QA 1R2SA 1X1OA 4EWND 2V2HA 4WY0B 4OQVA 4QJ1A 3QFEA 2EPHA 4NNCA 3EX3A 1OK6A 1WOAA 1Q6LA 2FTPA 4JTUA 3G1SA 1LM1A 3PUOA 2Z1BA 4EVZA 4GUIA 1TJPA 4AVFA 4LY8A 1FBAA 4MIMA 3W74A 3UWZA 3C2RA 1VR6A 3PBWA 4FIRA 3O6YX 2EAWA 5DBUA 3DHFA 3BVJA 3QPYA 3TFCA 4JTLA 1VGAA 1KV8A 2E5BA 1X8FA 3DFOA 4M6VA 1M7OA 2BSLA 5T26A 1LTDA 1WQ5A 5EPDA 3QW4B 4NXKA 1K7FA 5FF4A 2ATSA 3LV6A 1THFD 4B5NA 4IMEA 3RK8A 2WO5A 3C61A 3F4WA 4G1KA 4OBTA 1LROA 1OFEA 3UQNA 3W1MA 2J9XA 3G3MA 3HG3A 2Y7GA 3NQMA 4QIUA 1TPC1 3M5XA 1XUUA 1ICSA 3GDRA 4HPJA 3Q2DA 2ZQ0A 4X3ZA 1K02A 4IMFA 1KM2A 4UIOA 5C54A 1M5WA 3PSWA 4PEKA 3LERA 3GNDA 3NM3A 1WBHA 3CTLA 3LCLA 4GC4A 4WD0A 4KWWA 2Z0IA 3T55A 4O4VA 3W7KA 1TQJA 4DO5A 4P61A 3KRZA 1A5SA 2PC4A 2ZZ4A 5HNRA 1ICPA 2VFDA 3P5ZA 3W1PA 3HB9A 3BO9A 4L4MA 1CW2A 2C1HA 4C1KA 3MUXA 3TJXA 4JTEA 3DFNA 1MO0A 2HMCA 3OG3A 1SR9A 1WDWA 5LHEA 1EUNA 2V5BA 3SZ8A
chains in the Genus database with same CATH superfamily
4OUIA 2QCDB 2J66A 3PS7A 3E74A 2OO6A 5EMMA 2XTKA 2RDXA 2GJXB 2QJJA 4NRSA 4FALA 4HQVA 3A4WA 3SN4A 3VGDA 1RA5A 3K4DA 3FGCB 2GUYA 1SO4A 1WB0A 4NHVA 4DAFA 3BUVA 5FOOA 4QAIA 1IT7A 4JTTA 3F4DA 3TW9A 3KOZA 1VHNA 5C2XA 4BK9A 3KBMA 5FAGA 2PDUA 3KFTA 4KFPA 5HANA 3GR7A 1JD7A 3ZR6A 2J88A 5K7JA 4QDMA 3W71A 4C6LA 2FZ9A 1UROA 3WK3A 4HBKA 2PLMA 1HKVA 1Z6KA 1LRNA 3GC2A 1JPMA 3AS3A 2HNEA 3THCA 2HSAA 1XIDA 3PP7A 5CJMA 2IPGA 3BSHA 4AZHA 3PPCA 4XZIA 3KVJA 1DPMA 3STPA 2H9AA 4LYRA 1XL9A 2YYTA 3E2SA 5JIPA 3GNOA 4ILSA 3W26A 2QUVA 3WIJA 3SECA 4C1LA 5EYWA 1JAEA 3FSUA 2D2OA 5FKYA 1H3GA 3WZ0E 1KM5A 2WWDA 2G50A 3BZGA 3HGJA 4XD5A 4WKAA 1KXVA 2F38A 2D2GA 3MI6A 4ZFMA 1GT8A 2YR1A 4TVUA 4YCOA 2EO7A 2E1DA 3OVQA 3PJXA 5ABTA 1J0YA 1RBLA 1GJUA 3BJTA 3B9DA 5D9OA 3WBXA 4JNYA 3GB6A 3SURA 1EL3A 3KBNA 5C9RA 3DYMA 4JHOA 4V28A 3PR2A 2NXHA 4AF0B 3HG2A 3SCSA 3B03A 3MDUA 4KEUA 4FXJA 3UCDA 2QJIA 4GIYA 3BLEA 3H7UA 3OQ8A 1E1CA 3B8DA 1RBOB 3VPLA 1D7FA 1I0DA 3PNUA 2J7BA 2PU1A 1XH1A 2PDJA 4HCLA 1VJSA 1OYAA 3HPXA 1HKMA 2BV9A 3CAWA 4LSBA 2A85A 3RR4A 5BU9A 1P4CA 2GJRA 3NOEA 3RFAA 4H9TA 3SCTA 3S83A 3EWWA 3PHAA 1TPEA 2QCGA 4HK5A 4NNBA 3S6TA 3TYUA 3TUUA 5CC7A 2CETA 1DL3A 1RY8A 1JDCA 1YMYA 4BY3A 3I10A 4KPLA 4P8VA 4ZB2A 3T0TA 2VDHA 4XAZA 3ZLFA 3B9AA 3DBNA 5A6BD 2ZXAA 2J6VA 2XIBA 1K1DA 5F4XA 2OZ3A 4A8LA 1BWLA 3QLDA 3MSDA 2DJLA 4PCSA 1YLVA 1EX5A 2NXIA 4LVAA 1D9EA 4XWUA 2J25A 2KZHA 5CG7A 5HWMA 2XVPA 4R9OA 1CLXA 3F5KA 3E9AA 4TX6A 1F5ZA 4AIEA 2A3CA 3QMTA 3UWEA 2W62A 3VE7A 1R46A 1CX9A 3WEZA 4QEHA 3VK5A 1X8CA 1IT0A 3VCNA 5C9UA 4LYQA 5D38A 4X22A 3OBAA 5D32A 5G5IA 1H7OA 2J47A 2EG8A 5A8QA 4B3ZA 4B3LA 3MV11 1YXCA 2CHNA 3N04A 3N9SA 3SIZA 4ONVA 2ZUTA 1OC5A 1MW2A 3WJSA 3PJTA 4GXWA 1RLDA 3I7SA 1XRSA 4EK7A 4ATDA 4LYKA 3JW7A 4QNWA 4L4PA 4AY1A 5D09A 1Q6QA 2VX6A 4E4FA 1G9HA 3HQPA 3VCRA 1YXDA 4ZQCA 4I6KA 2INZA 1Q8AA 1PSCA 3ITVA 2FB3A 3SFKA 1VPXA 2FDSA 4M6PA 2C1GA 2F8QA 3STGA 2MNRA 1GOKA 2E09A 1HGWA 1KR1A 3E2QA 4QQUA 5CAHA 3T81A 1AODA 5AYIA 2OEKA 3NOYA 1X97A 3C2YA 1IZJA 3W2JA 1W9UA 1S2WA 1JCMP 1TCMA 3VGFA 2DEPA 1F2JA 3GM8A 2FQIA 1W31A 1BYDA 1LL7A 1WO2A 1OX4B 5BNKA 4OECA 3O07A 3CWOX 3CYJA 4BHYA 1HUVA 3WF4A 2PDWA 3FVMA 3TSDA 4CCDA 3M0MA 2HXTA 3K1DA 4JD4A 1U5JA 3TC7A 1GHSA 1ZRQA 1RP9A 3W2KA 2VURA 1JL8A 1W5PA 1W5OA 2Q6ZA 1LT8A 3UXKA 3IGUA 4QLJA 3T05A 5IXEA 3MVIA 5CAKA 3DFTA 1K8XA 4C6EA 1KFCA 3UWYA 1UR3M 2XZ9A 4PB5A 1CECA 4L1WA 1E0TA 4YLWA 4E38A 1PIGA 3SGGA 4GLEA 4A3YA 3A21A 2ZICA 4BF5A 4W88A 1G7UA 3QOMA 4L5ZA 4F48A 2DFAA 3VNYA 3PF3A 2EPMX 3R8RA 2VUNA 1IEWA 2DH3A 3LXAA 4ZOBA 5LNVA 1ZP3A 2QDGA 4K37A 3BV7A 3DFHA 5HA7A 4B2DA 3TTEA 2OYMA 4PRRA 2NVCA 2G5WA 1VD6A 3VVGA 5G1MA 4EWJA 1A80A 1IE7C 3MCNA 1TPDA 1PKYA 5F2LA 1XLAA 2WNNA 4J3SA 1KRBC 4LOCA 3S5SA 4Q8PA 4K38A 3W1XA 5A6JA 4Z1AA 3M41A 2Z7KA 4DBSA 1H5YA 4FS9A 2E6DA 3NYZA 4Z0SA 5E0FA 2QCEA 3HGOA 4PRWA 1UKOA 1GJPA 5JH2A 4WEVX 4PUMA 1QNVA 1CXHA 3ZXWA 1UC4A 4XZWA 3WD0A 3OHMB 1UKTA 2WC4A 3HOJA 4IMGA 1A5CA 4L6OA 1C8QA 1WCGA 3HBLA 5CPLA 1E6RA 3P7YA 2BVWA 3M0IA 3VKBA 2XSBA 3IS4A 3QTPA 4M24A 1IXQA 3EYPA 4HKPA 2C13A 2JIWA 5H2ZA 3LPFA 5CJ5A 2OZ0A 4L56A 5TBOA 2CCRA 4TQTA 5FEWA 2DVXA 3GVRA 5JBDA 1OINA 1FWBC 3RILA 4CD8A 1YX1A 3H2FA 3WH6A 1KTBA 2PP0A 3GW0A 2WWCA 1S2AA 5FAJA 3GU2A 4UOQA 3AXHA 4FNPA 3MTWA 1AL8A 1GG1A 4IZGA 2SFPA 2EG7A 4C6FA 2D73A 5HR7A 1W2VA 3GG0A 2CXGA 3W85A 1C92A 2TODA 3UFYA 4PMUA 1UIPA 1VIZA 1VBJA 1CGTA 4NX5A 3D0CA 3SJ3A 5E09A 5BCAA 3HG5A 2EBNA 4HNUA 3VCCA 3TQPA 1QAPA 4BS0A 3LN3A 4Q4KA 3W70A 3K8LA 3LX9A 2OKTA 2W3ZA 3G1AA 4NIRA 1WXYA 1M68A 1T8QA 3GTNA 4AC7C 1UPMB 1TIMA 3IARA 3NQCA 4TTGA 3BOXA 2OGYA 3G6MA 2WK2A 1NFPA 4N4PA 2OT1A 4HHLA 1I2QA 3GC4A 3MVTA 1P43A 2VCAA 3UERA 3IRDA 4ZTYA 1R9ZA 4UTFA 2AOSA 3TSBA 5TNVA 1LUCA 5C0QA 5H1WA 1XLMA 1VRXA 3AISA 4LAMA 3F03K 1YHTA 2RUSA 2CBJA 4FIQA 1KBJA 1KRMA 3R8GA 4J5NA 2QNEA 4KGLA 1DWJM 4OE7A 1QRQA 3H6OA 1ECQA 4LS2A 2DW6A 2AMXA 1VFLA 4JIIX 3CM4A 1ZPTA 3BAKA 1QJWA 2BGSA 2G97A 1CENA 3NPXA 1X7IA 3P0XA 3UJ2A 1AH0A 1ZALA 4PMOA 2OU4A 2VR2A 3H54A 1RY0A 3P8JA 3NWRA 2E6YA 2OB3A 1VBUA 3UJEA 3GDKA 4D71A 4JXCA 1JZ7A 2I9UA 2R1KA 1GWJA 2H8ZA 3MO7A 2V67A 3K8KA 1MW3A 5AC8A 3GNXA 3E96A 3LK6A 3H23A 5ABEA 5KSWA 1IWAA 1O4UA 3O05A 1JRCA 1NIUA 3OEXA 4GVIA 1MVYA 4GGHA 1ZLPA 4KCUA 2D2JA 1TPB1 1C29A 3EZ4A 4LTSA 1XP3A 4R33A 3DZ1A 4H9XA 4WK9A 4UOZA 1TUXA 1P5BA 3QPEA 2YBTA 4XZHA 2E6FA 1B0IA 3C8NA 1MZRA 3T2PA 1YDYA 1EHAA 1TR1A 3GRIA 3SI9A 1IGSA 1FHDA 2DZUA 5D2VA 4G7EB 3WLSA 1OHLA 2DSUA 2O4MA 3CL8A 3L5AA 5CG0A 3O16A 3UF9A 3PG8A 2Z6JA 3BGJA 4FHAA 4O1BA 1TYGA 1RD5A 1XR2A 2F2HA 7XIMA 3FJ4A 3PPHA 2RKXA 3VI2A 1LLZA 3W53A 1I9CB 4P7LA 2V2DA 5KEZA 1TJRA 4K8EA 2WHMA 3VIPA 5BOOA 2FGBA 1V79A 4AEOA 3B0YA 4IP5A 4C90A 4Q4OA 1EGMA 1C8YA 1MI3A 1E0WA 2O92A 1MMFA 4WKFA 2O56A 4PCPA 1KQYA 1X1NA 2HBVA 3J7HA 2WMHA 3OW1A 1L8PA 1HIZA 3EKZA 2R9RA 3DIPA 1S2TA 2WQDA 3ABSA 3PUEA 3VNKA 3HQOA 3GKAA 3QW3A 3KVKA 1JF5A 2E9MA 4AWSA 4YYFA 1LF1A 3UZJA 3VMNA 2QVNA 3MY9A 4AWEA 4KWUA 1ZZMA 5J5RA 3N2CA 2NX9A 1C90A 1S5WA 2QF7A 3L4YA 3TKFA 5DEZA 5KITA 4CEUC 4DBUA 2YLAA 4YS1A 2I14A 2PE4A 1BGGA 4PRTA 5IDIA 3BPWA 4IIGA 1GTEA 2DUAA 5D4YA 3TJIA 3S4TA 2B7NA 5CSSA 4HA1A 1TA3A 4R53A 5BWFA 1GTHA 4MOZA 5D37A 2Y89A 2FKPA 1RVKA 1XYCA 4N42A 2E5CA 2J9ZA 1EIBA 1V08A 4FA3A 1JUBA 1WDPA 2NVDA 5FJTA 1WAWA 2F6XA 3DI1A 4HSHA 1ISYA 5HJLA 3WQCA 1W3HA 3UGVA 5EFFA 2DW7A 2GGIA 1G4EA 3MA8A 1EBHA 4KFNA 3SUVA 3VDCA 3MCOA 4XAGA 2WSPA 1EWEA 1VFMA 3R8HA 3F4VA 3SCRA 1DXEA 2NX1A 2ISDA 4ZTXA 2HS8A 2NV2A 1I2NA 1XF0A 1MQPA 3P3BA 1TQXA 3KCOA 3F2DA 2V69A 2DSKA 4GJ1A 1VEPA 2XM2A 4PB3A 2NV1A 5K2ZA 4AD1A 1QI4A 4PUNA 2NLYA 5XIAA 3S0CA 1M9HA 3P8IA 2Y6ZA 2XUCA 3KAOA 1GVYA 4P2VA 1EP3A 4HNVA 1YNPA 4Q32A 4A35A 4LAZA 3W6YA 1V77A 3LTSA 2XDFA 3N6HA 1V0MA 2TYSA 5CPQA 1LBFA 4E2VA 1P6CA 3QYQA 1H4PA 2PD5A 4H6EA 3W37A 4LU0A 1LBMA 4H9ZA 3G8EA 1LYXA 2NQ5A 4QJ3B 2YW3A 4UTUA 5J5DA 5AYBA 1W1PA 2QCMA 2PFHA 2PTZA 4DUWA 3AHZA 1ZP4A 3FKKA 5FSEC 2PDMA 1RZMA 1JD9A 4HYWA 2BNJA 4XZ9A 1J6PA 1OM0A 5DMNA 1VC4A 2B0MA 3ZSTA 1DJGA 1BG4A 4RL3A 4CNOA 4JKMA 4D6JA 3QMRA 3CV7A 5ECUA 3MP4A 1IEVA 3BARA 4CCZA 5CBJA 2IKIA 1R86A 2HISA 4YU1A 2YKKA 1XYBA 1FRBA 3W6LA 4U2ZA 3WQDA 4AVNA 4Q3MA 3LYEA 3UZZA 3U9IA 1WZLA 2AQWA 3HPSA 5MF5A 1V3LA 3JZUA 2OVLA 2VGFA 4WJXA 3AHYA 4LH8A 4QDPA 5M17A 5AHEA 3S46A 2P8CA 3OGSA 3LD5A 2G41A 3ZWSA 2WKGA 4NZ5A 2QJMA 2X1SA 4LUIA 1VYSX 5DXYA 4O13A 3LCWA 3RRXA 4QNEA 1AW5A 4OOUA 3JS3A 1B57A 1EXPA 3UJSA 2ZBTA 3HQ1A 3WF2A 2A7PA 2YBVA 2FIQA 2FB2A 1QPOA 3N6JA 2HVNA 4FNQA 1E1FA 3MBFA 2A3BA 3ERPA 5HULA 1Z44A 1UWUA 1O7AA 5I3JA 1TO3A 2YDQA 4QJ4B 2A5HA 2VNCA 2QPSA 1DIDA 2XPKA 4Q8QA 1M01A 1DWIM 2VEKA 3E5PA 3AUJA 4XO6A 1EZWA 5A8MA 4DXKA 3UXAA 3S2JA 4XK2A 2J79A 2PWDA 4ACYA 5A2CA 5I6SA 1F8IA 5A69A 4AD5A 4IPNB 2XWEA 4QAWA 3SQLA 2ISWA 1XC6A 3HURA 4MZ1A 3N2MA 2FVMA 1RLCL 3ZZ1A 3FSTA 1XLLA 3QEZA 1NARA 5A6KA 3HN3A 4NAEA 3OO2A 1PZ3A 4M56A 2PRMA 2GVYA 1FTXA 1I4NA 1YDOA 1TB3A 3DFSA 4RZ5A 3CAVA 3B04A 4K1GA 4WXYA 4WGXA 3BCDA 4E8GA 2AMGA 2X1UA 3EB4A 3W81A 3VFCA 4FSAA 3CIWA 1UR4A 3SUUA 1XLFA 2WM1A 3I4KA 1KM3A 4I3GA 2QCDA 3L23A 5D8ZA 4XTDA 1EF2A 5GNYA 5KTLA 1OGBA 1F76A 2GJXA 4D6EA 1OF6A 3LBMA 3Q67A 4J1OA 4H6QA 3L9CA 1QNPA 2ZX6A 3KP0A 1OYCA 3FGCA 2ZOXA 1AJ2A 2G3IA 2POZA 5AZ1A 3BGAA 5D2XA 1S1PA 1N7KA 3LHVA 5LA1A 3ZIZA 5I09A 1ENUA 3FA5A 1LLWA 1P48A 1A5MC 3V0TA 1DJZA 1RHCA 1TZ9A 7TIMA 1PTGA 1PCKA 1RUSA 1JJKA 4HHMA 3CB3A 3W76A 1SFJA 1JEZA 1TJ2A 4IGMA 7ENLA 2UWFA 1ME7A 2VZTA 3BL3A 5AKQA 1ISVA 2ZA1A 4YN5A 2OTDA 3R0UA 1ITXA 4GMEA 2PF8A 3BGGA 1XBYA 4J3XA 5LA0A 2FZNA 3CU2A 4MHBA 5DY2A 4HVXA 1F74A 4LUYA 4QRNA 3PVFA 4B2DD 3CMGA 3THAA 1Y65A 2DPEA 1H63A 2ATMA 2PZNA 3MMWA 4ROQA 2VCCA 2V5CA 3ANYA 2PF0A 1CDGA 3KOFA 3R0DA 2P88A 5HAOA 1LWJA 2BY2A 2ZA2A 1EKOA 4E2DA 5EMYA 4X61A 2PSNA 1BQGA 1SFTA 4H00A 4CU7A 2OJPA 3RR1A 3CLMA 3AALA 1PJ9A 4JOMA 4HT3A 3IAPA 3PZ9A 3BG3A 4K7YA 5I00A 2YXOA 4FX8A 4MWAB 5LXEA 3POHA 2DH2A 3H2CA 3IJLA 2OWWA 4AF0A 4F0KA 3IAQA 3I6TA 2PP3A 2VMFA 4DB7A 3M47A 1ZB5A 1ZCCA 2VC7A 1LT7A 1E9YB 4AX6A 3D6NA 2EHHA 4R9XA 3S5ZA 2FPVA 3O6DA 1TJ1A 2BHUA 4XSLA 3UCCA 1MEWA 4GXPA 4WX2A 2XGZA 3AS0A 2R24A 1AW2A 5K3VA 2V82A 1XCXA 4O28A 4A3QA 4YHEA 1UD4A 2IQDA 1B3XA 1CI1A 2CITA 2WNWA 1VENA 3F5JA 5H8UA 3ZT5A 4JTCA 2HQAA 4DNMA 2EQDA 3KOYA 3WDPP 5CZTA 3WL0A 3T08A 4ZMGA 5PTDA 2GQ8A 3M6DA 1TVPA 3IIVA 4RE2A 4MPQA 1F4HA 5BRQA 2INEA 2VC5A 4FXFA 2VKZG 3MUZ1 3CQKA 1JCTA 3ID7A 2GGEA 1BGAA 5LIYX 4B5TA 3AJ7A 1RPKA 4RPQA 4D8LA 4ERIA 2QW5A 4JTSA 4JTGA 8CGTA 3W29A 2DP3A 4F3HA 4XSMA 2AGKA 4A21A 3PN8A 4DY1A 4CQCA 4JTDA 1OBAA 3F4CA 3E5BA 3DFYA 1WAUA 3C0JA 3HO8A 1B3YA 1J9YA 4HPGA 4L80A 2YL5A 5JU6A 3GG1A 3GFYA 2Q02A 1U5VA 1GEQA 1D3GA 4FLRA 1VB9A 2O9OA 4GUJA 5DMMA 3SSZA 4UB9A 4U5KA 2X1TA 4PCNA 1FFRA 3VD5A 4ZB0A 3DGBA 3T2OA 3OBEA 4POCA 1SUXA 3V1PA 4DNHA 1VEOA 2DIEA 3CMJA 4PMXA 2FZDA 4P7OA 4H04A 4XZLX 1YXYA 4UTMA 4ML9A 2NQHA 3BMWA 2PDGA 3M0ZA 2DT3A 3CEUA 4PL2A 1XBXA 4LBUA 1K8ZA 1U5HA 1SMAA 1RJRA 3TH6A 3DKJA 1XQLA 2ZZ3A 3EOOA 2QIIA 2WAGA 3WN6A 3G3DA 1BRLA 4UXDA 3R89A 2W4XA 4GNVA 1K7EA 1R2RA 4DEFA 4GI6A 4Q6XA 1E4IA 3A47A 2FMNA 3UW6A 4CKQA 1W9VA 3TNOA 4ZE5A 3RPMA 4Q8OA 1JCLA 3GH5A 4GABA 3QFWA 3GDTA 1OFPA 1VS1A 4FX7A 3URAA 4GUHA 1YNQA 4Y2WA 4UNLA 4Q4SA 3HJZA 4M5PA 5C55A 3NSMA 3K8MA 2OKOA 4XZMX 3ZYZA 2ZZ7A 3N19B 3HFTA 3BH4A 1ICQA 4XAPA 3Q4DA 4LAOA 4XZBA 3M0XA 3NQ6A 3I3BA 3TC3A 3B05A 4N9CA 3WMCA 3N4EA 3UG5A 2HE5A 5A8PA 3WUGA 2POTA 5IBXC 4JIPA 3GAYA 3LUTA 3O1NA 3RPTA 2CYGA 5DT7A 1N82A 2ADAA 3GUGA 3KS6A 3GHUA 4LEFA 3C56A 2GQ9A 4XV0A 4LUJA 2V6AA 1OABA 3C3NA 3R11A 1IWBA 3FXGA 3AHTA 3L0NA 1E4MM 3B8IA 1V93A 5HNUA 1P7TB 2CLFA 1Q6RA 1SW7A 5F1UA 4WQ6A 3U2ZA 3GBDA 4U2YA 4EE9A 1XYMA 1GOOA 4JEQA 2F2KA 3B9OA 4GUFA 3L5LA 3AZTA 5F2MA 1VFHA 1XLBA 2JKPA 2PBGA 1FX6A 2FFIA 3NEHA 4WRHA 1EJRC 1GK8A 4GE8A 1U1JA 1PKMA 2RDTA 3CUFA 4DWSC 1UZ1A 2QVHA 3RMJA 2ISVA 5E9XA 3OGVA 3NVDA 1UWSA 1KBBA 5DN1A 3KZPA 4HZMA 1KR0A 4ADUA 1SSDA 3JR2A 5GPRA 4XISA 1UZ4A 3OLDA 3PNZA 4ZENA 1LOLA 3C0SA 2YIHA 3FFSA 4W8AA 4AUBA 3P60A 4GQBA 4AYGA 4IT1A 1CGWA 4CCEA 3SIMA 1FH8A 4AD3A 3NR0A 2X0SA 1MRAA 5FF7A 3MKCA 5CXPA 4UFLA 1SFLA 3ENLA 3CC1A 2VVNA 4H9MA 2GGHA 1QCWA 4A05A 2ZXDA 1NP0A 4N9DA 4J7RA 1BG9A 1PVNA 4Y90A 1W5NA 1HJWA 4K39A 1DQWA 1J12A 1HFBA 3SB0A 2IQTA 3LZ5A 3EXTA 3PAJA 2PZ0A 4HK7A 4HZ6A 4MGGA 3IJ8A 1UJQA 1ITUA 2IUZA 5E6ZA 1P6BA 2NWSA 1GKPA 1GQIA 2FJKA 1UR0A 2VT0A 4OTKA 3NO1A 4YMZA 4P8UA 4C1NA 3KEHA 2WQPA 4MAVA 3EBVA 5REQA 1EO7A 2Z7GA 5FJOA 3QHOA 1X1OA 4JQAA 2ZX9A 1KGXA 3QFEA 4YIWA 1OK6A 1WOAA 1WZMA 3WQ4A 3U2EA 4QTGA 3G1SA 2Z1BA 1EZ2A 3ITTA 4MIMA 3PBMA 4FIRA 1KO0A 2EAWA 3TFCA 1KV8A 4JCLA 1KC7A 4QFUA 1X8FA 1ZSXA 3DC0A 4M6VA 4O8AA 5GNZA 3EOSA 2BSLA 5T26A 1JNEA 1MQRA 4I5UA 2VWTA 4U33A 4A3RA 2ATSA 3AHXA 3RK8A 1A5LC 2WHKA 3K5XA 2AL2A 4OBTA 1LROA 1M7XA 1E4NA 2J9XA 3HG3A 2Y7GA 1EF3A 4P5UA 1ICSA 1XDJA 3Q2DA 4XUYA 1GZJA 4Q8WA 2Z1SA 3VIHA 3KL0A 3LERA 1EGVA 4BQ3A 3GNDA 3AFBA 1UMYA 4LNCA 1MXDA 1WBHA 3CTLA 3TN4A 2Z0IA 3T55A 3W7KA 3M0HA 1TQJA 1M3UA 3IANA 4GIRA 4LQ1A 3W1PA 3T09A 2FGZA 1UD6A 4AIBA 1POKA 2Y5JA 3E38A 3TJXA 1W9BM 3E1F1 1WDWA 1EFZA 2V5BA 3G6LA 2JE8A 4GX8A 2XINA 4IICA 4ZOEA 3PB2A 1Q6FA 3B9EA 4Q4QA 1HVXA 3HG4A 3AICA 5TIMA 2PDBA 1S5TA 3BLPX 3PTQA 1EHNA 2WXDM 3NZPA 1VCFA 2A4AA 3VKJA 3W22A 3SCNA 4ENLA 1ML1A 4AZ7A 3R1ZA 1XIMA 3T2QA 3AIBA 3MMDA 2PLCA 4ICCX 4GVGA 1UA3A 2VUYA 4C6OA 3STEA 4CN1A 1NWTA 4G7EA 3CH0A 3XISA 3S1GA 1FKXA 3N2BA 4UMBA 4YTQA 4DQWA 5GVJA 1F73A 1XDMA 3VNLA 4X0VA 2QF8A 1VRDA 3D3AA 2D24A 1WDDA 1DJQA 3NPWA 3LRKA 3QQ0A 4WVXA 2GUUA 3UJRA 1RK5A 4EPKA 1A5UA 4DO7A 2ACQA 4I7WA 3PJWA 4XD6A 3CQ0A 1W9PA 5LGXA 1J0HA 4FOJA 3WLKX 4HNLA 3EEGA 4RXGA 1VCVA 5C7HA 1MSSA 2ZWYA 4ZO7A 3SGZA 3FJLA 1MFUA 3AXIA 1NWUA 3FVDA 3W7DA 4LXFA 4O1EA 2J13A 4C60A 2G4FA 4E4UA 3GR8A 3V7PA 1V3JA 1DYSA 4JHZA 2QGHA 2WJDA 3GUWA 2VC6A 1DJIA 5FF0A 1RR2A 1XLIA 1EX1A 3THQA 3SSJA 2HDJA 1SW3A 2YB4A 3ATZA 1LL6A 2YCJA 3VFLA 1IYXA 3CHEA 3CLWA 3I65A 4FNRA 4HNCA 4CN6A 1CLVA 5I03A 1LORA 4HPXA 4DF1A 5G4HC 2JKAA 1IIHA 3IK2A 5EA9A 1Q8JA 3VD4A 4NUWA 1REQB 5HUOA 4Z17A 4Z2GA 1YBQB 4RZ4A 3GX9A 1CT5A 4UUIA 1KGUA 3BLOA 2JKEA 2R82A 3LEPA 1JR1A 1VAHA 2PTWA 1K6AA 4CU8A 1FDJA 4X60A 1H7XA 1AMYA 2FDMA 1F3EA 1TMQA 4AHPA 4GJIA 4GK8A 4ZZ9A 1TVNA 3W24A 1H7NA 3G24A 3ALFA 1XRFA 4ZXOA 5AYZA 2G3NA 2RFGA 1KBLA 2YSWA 4QX4A 1E4LA 3WLQA 2E5DA 1KBKA 5BMXA 3S1UA 1J93A 2UY3A 4KEMA 4UTTA 1C7SA 2CLLA 2DUXA 6A3HA 3VU2A 1QOXA 4TU1A 2GVLA 1QXLA 3ABQA 1F61A 2X30A 2C7FA 2ACSA 5A6AA 4QROA 5AC7A 2VX5A 1GVFA 3H4WA 4PMRA 2FPTA 3WQEA 1XRTA 1ZAJA 1A5KC 3EX2A 4P8XA 4FI4A 2W9MA 4JYEA 4GACA 1GONA 4LAUA 2B7QA 3WLOA 4DXVA 1KLYA 3HF3A 5T9BG 2ZDRA 3PC0A 1H1ZA 2ZE0A 1RCOB 1CXLA 3EWBX 3QXBA 3A3XA 4FAMA 3LZ3A 3S5OA 2XH2A 4DJFD 4AXKA 3BE7A 2PDXA 4S3JA 3P84A 4DPPA 4TTUA 3E0VA 2J74A 3MO4A 4NAFA 2CWNA 1F6PA 5I78A 3KOWA 4KCWA 3U5UA 3D47A 5FJPA 3GH4A 2Z1VA 4X2RA 1BVWA 3RM8A 3HZ3A 4QJ5B 3W1LA 3WJXA 4AD0A 2VC9A 2CPUA 2ZXQA 1GJWA 3CZ8A 3EB3A 3CPUA 3DCPA 2VENA 3GYEA 3WFZA 3KVMA 1R85A 4URIA 1K70A 1HF6A 5CKSA 3NZQA 4HNTA 1J0KA 1PBGA 1Q6DA 4OFCA 2V3DA 2F61A 1XV8A 2UZ9A 3EWUA 4PUKA 3C2FA 3MPGA 3CNYA 2VDIA 4DI9A 1HVQA 2NQZA 1TELA 4LJ3A 4EPDC 2YFNA 2Z28A 1TFVA 1EQCA 1VHCA 4NZ3A 3BMVA 4IIDA 4XG1A 2R8WA 4LT9A 4DYJA 1H41A 1TV5A 1TG7A 3FNDA 4DIAA 3NZ1A 2WJFA 3L2MA 2VRQA 4R27A 2PMQA 1R8LA 3H8AA 5HMSA 5HNTA 3UYCA 2ZZ5A 4HOWA 1OJXA 3MUAA 3MKKA 4M82A 3M07A 1J8VA 3PBGA 4JKLA 3W27A 1LBLA 3UU0A 2YCLA 2YL6A 1BYBA 1KFLA 2VZOA 3TCSA 4PMNA 3WK0A 4U31A 4Y8FA 5BRPA 3R6IA 3JZEA 3FEQA 2CHOA 4IISA 1PS9A 3IJIA 3RF9A 1ZS2A 1VYPX 2XG9A 3KLLA 1OF8A 3O6CA 2DSVA 3EGJA 4EXAA 4LBRA 4D6GA 4O10A 2DT1A 3GNRA 3LSCA 4KWSA 4GYKA 4MZYA 1O68A 2XGIA 1YTEA 7A3HA 1OZMA 3H26A 3QGAC 3UNTA 4XIAA 4IGHA 4L9XA 3VMPA 3RJXA 4HMDA 2PDPA 4Z2KA 2V63A 1CXEA 1W3LA 3HA1A 2P0IA 2ACUA 3K4AA 2WCSA 1DJYA 2BZNA 2A7NA 2ZVRA 1FWFC 4UQAA 2VFHA 1RSCA 1BWKA 1EPXA 4M6QA 1DHKA 5C6MA 2BGQA 5AOUA 4LVDA 2BY1A 4LB4A 3EMQA 1S5MA 3WQGA 3RO8A 4J3TA 1W54A 3H21A 3FLUA 3LLXA 4CNPA 5IM51 3TMLA 3NFUA 1ZAIA 3W00A 4ZFCA 4WSHA 5BWAA 1FH9A 1KRCC 3ES7A 4PC8A 2DZWA 3KTSA 4S2BA 5FJJA 2P5NA 4M81A 3ZR4A 1WV2A 1OG0A 2EPKX 1DP0A 3WKZA 2Y63A 3QH2A 4JKKA 3KTXA 4RK8A 1UZDA 1Q45A 1CIUA 4EP8C 3KUMA 3GYCA 3BV4A 1DIOA 3FW6A 3II1A 4M7TA 4BQ5A 2CWXA 1XGDA 2GWNA 4RDYA 2CZ5A 4Q8MA 1XDLA 4Z2HA 3M7SA 5FESA 3PWIA 3M9YA 4DZIA 4H3DA 4CVUA 1WXJA 3DUGA 3CMFA 3S6DA 3ARWA 3KWSA 4O50A 4A29A 3WNKA 1UB3A 5TAOA 3CUGA 4PCTA 3VD3A 1K6WA 4RDZA 1CXKA 8XIMA 2PWHA 3OZYA 4H4IA 2BB0A 1JPIA 1UCWA 4GJJA 3AU2A 1QDSA 3G77A 3TTSA 3LHZA 3GHSA 3KBVA 2ESCA 1TIWA 3WQPA 2C19A 5E9AA 1S5NA 1UUMA 4S3GA 2W0UA 1E40A 4UTJA 5FF2A 3NYDA 3M44A 5F2IA 4UQBA 5D9PA 4DLFA 1VFOA 1I8JA 5A2AA 1PB0A 4HSOA 3LXBA 4RCXA 4PA8A 3OZPA 3SCOA 3HPAA 1IR2A 3IVSA 4PMJA 4IX2A 3W38A 1XLGA 3VKKA 6REQB 1I60A 3PWGA 1QPKA 3CL7A 3ITYA 3NPVA 2EKGA 1CB2A 1U1HA 4MWAA 3GIPA 3BW4A 4PTMA 4DWDA 2D2HA 1UD2A 1XG4A 3PZIA 4Q4RA 1HO4A 2YA0A 4NZJA 1SQ7A 1XS2A 2DGAA 2OLAA 4L1XA 1U83A 4PFHA 3SJNA 1Q6CA 1AG1O 3QKZA 3ZVHA 1OQFA 1W8GA 2ZRWA 4O17A 1YW1A 3CHDA 2DT0A 3LPOA 1NDVA 2Y62A 2WVVA 3KZSA 3G1DA 1VLIA 3APTA 4P7RA 3VOHA 1XYAA 3A64A 4TMBA 3BAJA 2CLEA 2YCEA 3EX1A 4OIFA 5A95A 3N15A 5E0CA 1W3JA 2J7DA 4C7GA 4NYYA 3LDVA 1IV8A 5FSDC 5L9FA 2X8RA 3TFXA 1JNDA 4UCGA 1W8SA 3MSGA 3G1YA 3USBA 4LF2A 2GJNA 1EWDA 1FWHC 3FEMA 4MG4A 3GZAA 3WNPA 1CGVA 2BG5A 4V15A 1YPFA 1SFSA 3ARUA 5HMEA 3RNDA 5IRPA 4GCAA 4LV4A 4L4LA 1MNZA 3I6RA 4A4AA 1V02A 3OP2A 1QBAA 3SDOA 1HL2A 3V3WA 3VDBA 1VFSA 2ON3A 4Q4MA 4YWIA 1UBPC 4XTIA 2OEMA 5A8OA 1EUAA 4ORIA 4ADSA 1GKRA 3W7LA 2QCNA 3WMSA 4E5TA 5JBFA 3E2RA 3PBUA 1VF8A 4HNNA 3S47A 5D2YA 3BOLA 3T0CA 1JYWA 3GG7A 1K77A 3BQ6A 2ZWZA 1QW9A 4IPLA 4PN2A 2ZUSA 1L6FA 4C7DA 4UMAA 4S2CA 3W2NA 5ENLA 1EJUC 1BFNA 3EWXA 2JFEX 5C8BB 1MNSA 1SSGA 3GVVA 3NIYA 1PAMA 1QPNA 3H53A 3SEPA 2W67A 5IOBA 2VXNA 2OZ8A 4U3CA 3Q58A 2QEZA 3G2GA 1GG0A 1SGJA 2Z29A 2YDSA 4DYEA 3PZNA 4OWGA 2G37A 2WOQA 1FXPA 1XSIA 1GHRA 1OFOA 2WNZA 8XIAA 5BOFA 3B8SA 1SR0A 2HE8A 1PDZA 1E6QM 2IQ0A 5HDRA 2FHBA 5AY7A 3AQUA 3LENA 2BXVA 1EBGA 1SU5A 1NOWA 1FHVA 5K4XA 1XIBA 4UWMA 4JL2A 4AY7A 1DJHA 2BOEX 5D33A 1LRTA 1E9IA 3VIOA 2OLHA 1H0IA 1T99A 3KCJA 3LM3A 1EEPA 4FNUA 1KBIA 4CNTA 4OBRA 3JRKA 4Y7EA 3TJ4A 3TLLA 1U1UA 1J79A 2TRSA 4RUBA 2V81A 3WMLA 5M03A 1X6UA 4HTBA 1CWYA 1KKRA 2PDIA 4AZ6A 3UT0A 3UR7A 3AMKA 3MANA 3FA4A 3FYPA 3EKGA 3NSNA 2H3DA 1D8CA 1UASA 1FCQA 2PTDA 4C6IA 4F40A 3WQVA 1V4YA 3EB2A 3FOKA 1WBJA 1OC7A 3IVUA 3HU7A 5B7ZA 5FACA 3OB8A 2BY3A 4AEFA 1GNXA 1ODUA 1P7TA 5I3DA 1OEPA 3NGJA 4JQ1A 1O6IA 4MWAE 3P81A 1LG2A 1FWEC 1I75A 4HP5A 3UR8A 2DSZA 4MYXA 1J10A 1K9DA 1H1NA 3WD4A 1E5NA 2YW4A 4GUGA 3NO3A 3ES8A 2VRKA 1DIEA 1JZ4A 5BROA 3W2LA 1PZ1A 3M0YA 1P0KA 4I5RA 3IJ7A 2XH7A 3PM6A 3VIMA 2QGYA 5MHBA 4K3ZA 3CBWA 3PY2A 4TXEA 3QKEA 5BXPA 1G4SA 5D05A 3MHUA 4EKJA 1XJBA 1QR7A 5GJNA 2XIIA 2YA1A 3UXLA 2PRLA 4L9YA 5I79A 3CZJA 2I57A 2L5HA 2BMBA 2I56A 2PWUA 4LUSA 5HMDA 4RE3A 3CUZA 1DXIA 4BWLA 3EMZA 4WOZA 3TV8A 1UBSA 3TX9A 4MB5A 4F0RA 5AC6A 4MM1A 3POCA 2ISFA 3IIPA 2KAUC 4AC1X 2ZCGA 3PZTA 2J4GA 2PD9A 3AYRA 2D1ZA 2Q3OA 3EXRA 4DZHA 3TN3A 1UHVA 1YNYA 3OGRA 4O54A 4MKSA 1R3YA 5DMYA 3KXQA 4UFHA 1WDQA 3CTTA 4O1DA 5LIUX 3W7CA 1VPQA 1VP5A 1R38A 5JQ9A 1JCYA 1JDDA 2PDNA 3VNIA 4JFSA 4PSRA 5G2WA 1OIFA 1XSJA 1V02E 2FPYA 5T9CE 1QWKA 1TPFA 3PZMA 3QY7A 1O5RA 2Z6IA 3DG3A 2HS6A 3EDFA 3XIMA 3V35A 4PBFA 4CEXC 1NDZA 3HJEA 1R6WA 1G0CA 2I17A 3N2TA 2J6XA 7TAAA 3KDOA 3BSMA 3CZLA 1EP2A 1ZU8A 1BEUA 1O94A 2ZRZA 3TLQA 1H51A 5C7VA 1ZTVA 1DJWA 4NILA 4HHPA 3E0LA 4LGXA 1I2PA 3NM1A 1SYTA 2C0HA 3P62A 2AGTA 3UEQA 5AB3A 1SZFA 1B31A 2FZBA 3W87A 4IFKA 2QZRA 1AQHA 4J3ZA 2D3LA 3MSYA 4ZQPA 2FMOA 2GSEA 3B8TA 2CLHA 1QHOA 5EMUA 1OCJA 2VRJA 2B31A 1J4EA 2ODOA 3LQLA 1CPUA 4RDWA 4B9YA 4CUCA 4LUTA 2X16A 3EA2A 3VC5A 4EACA 2BTMA 3M46A 5EBUA 3OLIA 3VOJA 3QF0A 3F5LA 3CAQA 4EAMA 3FAWA 1ZHAA 3UXIA 1NELA 3ZM8A 2VOMA 2JGQA 1VFTA 2PODA 1XLCA 1UWIA 4ORMA 3ABZA 3ZJ8A 3OIXA 2I16A 3UYIA 4O0ZA 1HKWA 3PFRA 4PGLA 1DEDA 4O11A 3W73A 2CZVA 4JICA 1BAGA 3WQ6A 4RDVA 4FLOA 2XH0A 4JFUA 4WR3A 3RPDA 5EL1A 2X0YA 3KRBA 3TAOA 2X1RA 3EXSA 3CWHA 3JUGA 4LPCA 4E8CA 4LC6A 1DQUA 2GOKA 3A9BA 3TYCA 4ZQNA 4R85A 3A6OA 3VNZA 6ALDA 3WK1A 3R12A 1W56A 3W9ZA 3MUIA 3W4RA 5IFPA 2VGBA 5AHIA 3ZMRA 1JRBA 3WUBA 4LS1A 3BWWA 3GDMA 4XD4A 1MUWA 2YX0A 2GQ3A 2EJAA 4D6HA 3PFMA 4IQLA 3WBYA 4E3VA 1F7BA 4K7VA 2WNQA 1TPVA 2QDDA 4Q4PA 1O60A 1FUYA 1ONWA 3W2MA 1US0A 4ES4A 1UYQA 2D22A 1M41A 4UZUA 4DF2A 1QNQA 1KM4A 3BXWA 5DCEA 1JXKA 1FVPA 3TTYA 8A3HA 3QGKC 4JNMA 1BXBA 1J01A 4EAYA 5AC4A 1G7VA 3LCXA 5A6SA 1OFAA 2VTFA 3OOQA 1PO9A 2WMKA 3MJMA 4A3UA 3ARRA 9CGTA 4YJ5A 2XSXA 3N34A 2ASHA 2JEQA 1FXQA 1QK0A 2DJXA 1SO5A 1V3HA 4MB1A 4DRSA 2OYKA 4TVDA 1TV7A 3VILA 3WD1A 1XHGA 3UZXA 1PEZA 3KX6A 3REQB 4ZSTA 5CBIA 3M0JA 3F1QA 1XD0A 1HKIA 1FDYA 4UTTC 2HXUA 1JQVA 3CEPA 4IUGA 4UFMA 3CK5A 3CS2A 3UVAA 4JGDA 4FPSA 3OPSA 2WZTA 3V5FA 1WE5A 3GAKA 1TE1A 1GVRA 3MW7A 3TU9A 2J7GA 3LRMA 3IV3A 4PUJA 3G22A 3G8RA 4QE4A 5LIXX 1OFDA 3DYOA 1SZGA 3SFWA 1MUMA 5T8GA 2Y7EA 1REQA 3FIGA 5IHSA 1C8VA 3EEZA 4F2UA 3WF3A 4WLCA 3WLRA 1HKKA 1UD8A 1PL9A 5G4WA 3STFA 2J78A 3IJDA 3PWAA 2XVLA 1H11A 1HT6A 1ITQA 1DTNA 1HJUA 4TV5A 3P80A 1RJPA 1YPIA 4Z1YA 4FF7A 4AZGA 1F6YA 4W93A 1GGOA 3THDA 4HTYA 1GQNA 1NVMA 1Y0EA 3K1GA 4NQ1A 3P0WA 3L67A 3DFPA 4JYDA 4DUOA 4K6AA 3N17A 1L6YA 3LB0A 5DX7A 4ZXLA 1EJXC 4ZSUA 3N18A 3GY1A 1IHIA 4HYRA 4B5SA 4GIAA 3WH7A 4W5UA 2H9AB 4I9MA 4QG6A 3SQMA 3GTXA 5A1AA 2Z2AA 2P3ZA 4YXGA 1NQKA 4OOZA 1S3HA 3K30A 2ZXBA 3JVAA 1DWFM 5AHNA 5RUBA 1IR1A 2WZMA 3BMXA 3C2OA 5M3WA 2XM1A 4NX0A 2CC0A 1V3MA 4ZO9A 5L6UA 4C6NA 1A3HA 3BZJA 3AIQA 2RH9A 4FXSA 3CIVA 3L7RA 4EANA 4IGNA 1KM1A 4NJHA 3VOCA 4FLQA 4YVXA 4Q6JA 2DVUA 1DQXA 4GO9A 2JEPA 5C71A 1DORA 3WH5A 1LQAA 3NQ7A 3L65A 5JBEA 3Q37A 1V3IA 1SM9A 3FAXA 2Q71A 1TZ7A 1E1CB 3NZGA 2FTYA 4MJMA 2WBKA 5LIWX 1H60A 4DJDA 5KMYA 2OYLA 5BZAA 4KEVA 1F4AA 3GQYA 1NWSA 3NL2A 1Z9AA 3FHAA 4JFWA 4LB3A 2J62A 1QI5A 2W5FA 3SUTA 4JDBA 2RAGA 5FJRA 1UKPA 2HPIA 1DBTA 1GYNA 2J7FA 2ZX7A 2VR4A 1TWWA 2XFRA 4NNAA 2R1PA 2YL9A 4NI8A 2PDFA 1ALDA 3OA3A 5CPMA 2AQOA 4AFYA 3N13A 4AZIA 1CXFA 2B7OA 3QHNA 2EPNA 3MQTA 4RV8A 3ARXA 2OQHA 3TONA 1Z3NA 1J2WA 4F2BA 4BR1A 1RALA 1XD1A 2IMRA 2VOTA 3ELFA 4WZHA 3VMOA 5BRBA 3SRKA 3A3HA 3A5VA 4PZVA 1BYAA 2C91A 2HK1A 2XFFA 2X0HA 2WMIB 2XIMA 1QOQA 3OHIA 3QQWA 5J04A 2ZADA 4TV6A 1OK4A 3SY1A 2W6RA 2ZYFA 3UPMA 2ICSA 1XH0A 3VNMA 2RDWA 3VKDA 1A5NC 1UJPA 3BSGA 5CSYA 1QHPA 3LHWA 3E3HA 3W7PA 2OO0A 3GXNA 4B91A 1JVNA 1X39A 3PBYA 3CHVA 1OIMA 1V8EA 1UKQA 1S2VA 5EB8A 1VLWA 3SADA 1TWDA 3KBWA 2E8YA 4D6IA 5D2WA 1JULA 3UVIA 2NT1A 3UWQA 1UP2A 3GU9A 3M1ZA 2YBUA 2ABBA 3EDKA 5CC5A 1B4EA 4O0KA 4JQ3A 1NOFA 5D9MA 4MY8A 3T7VA 1E72M 4IJBA 2ZUUA 4KIRA 4M3PA 2Q3RA 3RJYA 3ZT7A 2HCVA 5CGTA 1TTQA 4U4MA 1SZEA 3R0KA 4IIEA 4M6UA 2E77A 3U4FA 2VEPA 1R9XA 1V3KA 4JY9A 1B2YA 3BK0A 3LSBA 3T9PA 1MXSA 2E9LA 2BOFX 1BVZA 3BLFA 5TF0A 1JZ5A 3LQGA 1UKSA 4PTDA 2Z26A 4HJWA 1TVLA 1UWAA 3QBUA 2E40A 3N73A 2CEQA 4US5A 4Q7IA 3BTNA 4QLKA 2ZVIA 2JGYA 1TSIA 1TRIA 3BAYA 2V3GA 5K9XA 4HPNA 3PZQA 2HWGA 3VM5A 4R88A 3SY8A 1JF6A 4JQ4A 3N4AA 1OY0A 5HUPA 4S38A 1E5JA 4HJFA 1KGWA 5HR6A 3LCIA 2BY0A 2DV0A 2P50A 2V2CA 1TTJA 4NXSA 1QI2A 2DZTA 3MSRA 3ZLGA 3INPA 4GPNA 1AQ0A 1NWRA 5HK4A 4HZ8A 1XG3A 2XVKA 4MB4A 4MTVA 3WBAA 4JIRA 2FHCA 3D5HA 4ZVJA 1LDCA 1NM9A 5CJNA 4GD0A 3OVGA 2GK1A 3N14A 1WXZA 5LXXA 3CWNA 1JAKA 5AFDA 5M2FX 4MWAC 2VQTA 1LRQA 3TWBA 4D9PA 3ISIX 2NZLA 5BYWA 1SZNA 1KCKA 4HN4A 2G4JA 4JX6A 5F1VA 1P0BA 4DJEA 5FCZA 4AISA 3B8VA 1E43A 2ANUA 3COTA 6PTDA 4P8WA 4QR6A 4UTWC 1MUCA 2HVMA 5IBXA 1AJ0A 1T0OA 3N2OA 1OCNA 2YOCA 5AHLA 2NSOA 3RX2A 3S1WA 2VGIA 3FN9A 4IG2B 3W7RA 3IGXA 1LG1A 4S3CA 1JZ2A 3EOEA 1QTWA 1UQYA 1Q6LA 4JTUA 3UGRA 2DSWA 3PUOA 1NDWA 3OTRA 4AVFA 1WZAA 1CGYA 3FA3A 3HMCA 3UWZA 1VR6A 3O6YX 1AVAA 3BVJA 4LALA 4JTLA 1MRQA 1JZ8A 4QCFA 1IWPA 3DFOA 1D2KA 1M7OA 5CH9A 1YEYA 3RHGA 4WCJA 3LMZA 4NXKA 4NYUA 1K7FA 4DWSA 5FF4A 3LV6A 4B5NA 5HJYA 3R10A 3U2CA 3C61A 3F4WA 4G1KA 2Y2WA 3VABA 3KP1A 2NT0A 4QIUA 3M5XA 2A3HA 4GYFA 1KQZA 4QE1A 4WDUA 3T0DA 1B5TA 3QLLA 4X3ZA 3SRHA 2D20A 2FVKA 5IDZA 4UIOA 1KM2A 5C54A 4PULA 3PSWA 5LYRA 3N4FA 2OXNA 3E0WA 3WQOA 1IZCA 3NM3A 4IH3A 4GX9A 4MMWA 4GC4A 4KWWA 3R94A 4O4VA 4DO5A 1A5SA 2PC4A 4GY7A 2VZSA 1R3RA 1BQCA 2WMFA 1J0JA 3BDKA 4G7FA 2VFDA 5I23A 2F6UA 2E7FA 3QZ6A 2XIOA 3CL6A 2WMJA 4L4MA 1CW2A 4C1KA 3GDBA 3EPMA 2G3MA 3DFNA 3OG3A 3NDYA 4X9YA 5FEZA 2CBUA 1O5XA 3WLIA 1F07A 1UR9A 2CERA 1A0CA 4TX8A 4ZCWA 2TSYA 3WK2A 4MNLA 1NU5A 2VQUA 3DHUA 1U33A 1TWIA 3C2VA 3S5YA 1E1EA 3QY8A 3SCVA 1N8WA 1AL7A 5FIPA 1QUMA 3GVGA 2XSAA 4C5YA 3V36A 3QC0A 1JIBA 1HO1A 4PEEA 3WQWA 1XI3A 4GINA 4Q8UA 4GRSA 5F2GA 2VD9A 1Q7ZA 3DBPA 4B92A 3QN3A 3V1HA 3QJAA 1IEXA 4AW7A 1R9YA 1LUCB 3TZFA 3H2MA 1XW8A 2OPJA 1SVDA 3FKRA 3WLJA 4IGSA 2J8GA 2WV8A 3W7NA 2WKJA 5LHFA 5JMUA 1MWOA 4B5XA 5TD4A 2PWEA 1PIFA 3WBEA 2BXZA 4S3FA 1GW1A 1NF7A 4Q7NA 1MXGA 2H6RA 2Y7FA 1E0UA 4HNOA 3URNA 2RGLA 1V0NA 2BHYA 1S39A 3SCUA 2V9DA 3FYYA 2J7HA 2C8NA 3BICA 1XRVA 4HA4A 1S3TC 4XUGA 3VKAA 1L0PA 5K4ZA 4OHQA 2WZIA 2VCBA 3GXFA 3WO8A 1TPUA 3GZ3A 1HQTA 3FHQA 4KKXA 3BG9A 1K9FA 3VC6A 4BI5A 5KZEA 1UG6A 3LY0A 4JS3A 1T96A 2E9BA 3LCGA 1PTAA 3TP4A 2V68A 4L6DA 3WF1A 4YYCA 3NNTA 3KS5A 3W3OA 2OR2A 1TJ0A 3F2BA 4J40A 4W5ZA 4UTLA 4OZOA 4KRTA 3AWOA 6TIMA 1R2TA 2HV5A 1PHQA 5G2IA 1Q63A 2CKRA 2BBFA 4UR7A 2ZC1A 1EJSC 2I5QA 4FOUA 3CUXA 3WNNA 3GO2A 1K8CA 4UQEA 5LSMA 4K8GA 3UR5A 1GVEA 1XYFA 1DJNA 4UFKA 3W88A 2GDUA 5CZSA 2PWGA 3BAWA 4FO4A 2OOGA 3MUCA 4BWLC 1H7WA 3W1NA 1DWGM 3NL6A 4PMZA 2NVAA 4C6CA 3BURA 1ZGDA 4R5EA 4MUPA 3WH9A 2F6KA 4IFRA 3B0UX 4GQQA 4D6CA 4GCXA 2HPMA 5I24A 4MVAA 4MDOA 1UWRA 4Z08A 3CPRA 3ARZA 3RLUA 4WJEA 5ABFA 2WC7A 4AVOA 3QV6A 3MDWA 4R7OA 5G1TA 4D8AA 2I5IA 1JUKA 1MDRA 2WVSA 1B3ZA 2QAPA 1S38A 3OZMA 4GH3A 4DF0A 3DGRA 1AH3A 3G0UA 3UETA 3T4CA 3EKLA 3WBWA 4MSSA 1VEMA 4P7NA 4GHRA 3QYSA 3WYZA 4GC3A 3A12A 3MYOA 1XIIA 3RITA 1H61A 4A2SA 4ALDA 4DVOA 4ZQMA 4NP7A 1F6KA 1K4HA 1XYLA 4CQ9A 4N9EA 4RNJA 4AU0A 3PB0A 1TA3B 3RU6A 4A6GA 1W1A1 1RCQA 1KRAC 4YVVA 2Y70A 4OBSA 2OFJA 1OCBA 3S3GA 1U30A 1CNVA 3O15A 1B3WA 4LEQA 1A0EA 3UG4A 1Q65A 4Q8VA 3GDLA 1R0MA 4JN6A 2Z1XA 3W84A 1AD4A 2Y8VA 4N9BA 3IIOA 3TZNA 5I2UA 1RK6A 2JK2A 2PTXA 5AHMA 2IXUA 3SAZA 3U4AA 3R2GA 2B7PA 3ZLHA 3S2CA 3TJLA 4PUUA 2PRHA 4GI8A 4NU7A 3DENA 4DUXA 1B9BA 3PUDA 1SZRA 4MNJA 4FOKA 4DI8A 4ZQOA 4HU0A 3T8QA 3TSMA 1JPHA 2QLYA 1G4TA 1IEIA 1NJJA 3CO8A 3MBDA 1VFFA 4S39A 2X2YA 2XIJA 4QE5A 1X1ZA 3V4BA 4GY1A 5E0KA 4TOQA 3B8WA 3LTPA 1UR1A 1UH3A 2G96A 3TQVA 2DY3A 4MADA 2G0WA 2EEXA 3R25A 3F7JA 2NSXA 4HOZA 1I2RA 2E8ZA 2VDGA 4GG9A 1YQ2A 3UESA 1LZOA 2CBVA 2CHRA 4LCRA 2X05A 3KOXA 1GVSA 4L65A 1WX0A 6XIAA 3GD6A 1J5TA 4IFOA 2OG9A 4H2CA 3G1XA 1SJDA 3T40A 1XIHA 1RV8A 2XN1A 1AFSA 3VUSA 3L4UA 1UP3A 3B0XA 3C52A 4K1WA 4IMCA 5C2CA 5U4NA 3BOFA 4FX6M 3RN6A 2W63A 4QG9A 2GJLA 1FDZA 3ARYA 3H22A 3AAMA 3URQA 4IHCA 5AYYA 2A0NA 4A22A 3U48A 3SN0A 3ONBA 1GCYA 1AD1A 1H5VA 3IJ6A 1GVQA 2ZZ1A 4ZEPA 3L0KA 3UG8A 3TW7A 5CSRA 5EMKA 2P53A 2XHYA 1Q4WA 1P0EA 3W6MA 5FEXA 5DCBA 2XZ7A 1Z41A 2BVYA 2GGJA 3NEVA 4L1GA 4KESA 5DQPA 4JX4A 4J35A 2QT3A 4GBUA 1JI1A 2YZ5A 4ACZA 4X63A 1KTNA 3VD7A 1W3NA 3L4ZA 1H1YA 4PSPA 1VYRA 3TIMA 2C16A 2KX9A 2YL8A 1BWVA 3ZR5A 3V75A 3B8UA 3OA5A 2WZHA 3CO4A 4O12A 3UP8A 5AVNA 4HGXA 3SCQA 3KRSA 1SO3A 4RZ6A 4KIEA 1TWZA 5FL1A 5CZKA 1ISWA 3VOGA 1OG6A 4F0MA 4LFYA 3TOPA 3WJWA 2DU2A 4KCTA 3WDQA 4U3AA 3GTHA 3H2NA 2ZRUA 1ONRA 4F9DA 2DZSA 1ME8A 1LCOA 3G0XA 1ADSA 2AL1A 3RAOA 1LQ2A 4I7VA 2CLMA 4JTIA 3APYA 5JVLA 1N2VA 3PUGA 1Q5MA 2JQXA 1ESWA 3CUJA 1JGMA 3CQIA 1KA9F 3M6YA 3HIJA 1PZ2A 2WSRA 3CV2A 1FWTA 4ZQRA 3PG9A 3F4NA 4AHOA 3S2LA 4Z1BA 1CGXA 3REQA 4I5XA 1OT2A 3QQ1A 1Y5VA 4JIEA 4F4RA 3NA8A 3VGGA 4CD7A 1T6MA 2WVTA 2WPGA 2E67A 5HXMA 4JTHA 2GDVA 3AOFA 5DELA 3G1FA 3W7MA 4KT2A 4GNJA 2CFFA 3WLHA 3GWQA 5DRCA 1H09A 1FQ0A 5LA2A 1ELSA 2YZRA 4CVWA 5LNSA 4E4PA 1WOBA 3MHGA 3WG6A 4GZJA 5CGMA 3E2VA 1W2PA 3AIUA 3QR3A 1KM6A 4YTRA 4L64A 5LNRA 1Y7VA 3ONCA 4QEEA 1XCWA 3WY1A 3DECA 2PBOA 5KZDA 1P6WA 3AUOA 3C5QA 1EDQA 3RLGA 3NQDA 1HN1A 3BJFA 4I7UA 4YVPA 3BCJA 3RX4A 4AZ5A 1AZ2A 2VEFA 2PTYA 3A22A 2D0FA 3KHJA 3V0UA 1EJWC 5G2HA 3WX7A 1VQTA 3I3EA 2IPFA 5EBAA 4K8HA 3TXZA 3CZKA 2OEJA 1GVIA 2VFIA 2EKCA 4C91A 4OGZA 1SJAA 1G4PA 1SW0A 1R7OA 2GWGA 1RCXB 4DJED 1JQXA 1WKFA 4GI4A 4AZBA 1HJVA 4DJDC 1L6SA 5LKYA 3PANA 5I3GA 3AYTA 1DXFA 3GNNA 3AYVA 4QSFA 2P0OA 2WCAA 1TREA 4MDPA 4DXXA 4IIBA 1R30A 4B5WA 3M16A 4CQAA 1KFKA 3NO5A 1KD0A 2X7VA 4M1RA 2PGEA 3W75A 3GXIA 3MT1A 3PZVA 4Y96A 4JBRA 2TPSA 2C6QA 3H4XA 3QSRA 3RO6A 1LLOA 2Q8XA 1WNOA 4H7CA 2NUWA 3W7HA 1LOSA 4RXFA 1KXHA 2E4TA 4G9PA 2GQAA 4M8UA 3NDZA 3URBA 2ZIDA 3P74A 3BW2A 3GU1A 3UG3A 2Y5EA 5GNXA 3AYSA 4DWSD 5D2TA 3DHPA 1W1VA 3MYPA 2Y8KA 3G5EA 1CCWB 3ALGA 3A4AA