2AGLD

Crystal structure of the phenylhydrazine adduct of aromatic amine dehydrogenase from alcaligenes faecalis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
Knots found
sequence length
109
structure length
108
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 26
structure length 108
sequence length 109
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2aglD00
1MAEL 3RLMC 4FANC 2J56L 4O1QC 2I0SD 4FA9C 3PXTC 4Y5RC 2H3XB 2HXCD 2MTAL 4L1QC 2AGXD 3L4OC 2Q7QD 4FB1C 1MG3B 1MAFL 2HKMD 4L3GC 2AGWD 2GC7B 4FA1C 3PXWC 3SXTC 3PXSC 4FA5C 2AGYD 2BBKL 2AH1D 4FA4C 2HJBD 2I0TD 2AGZD 2IAAB 2OK6D 3SLEC 3C75L 3RN0C 4K3IC 2J57K 2HJ4D 2AGLD 1MDAL 3RN1C 3ORVC 1MG2B 3SWSC 3L4MC 2OJYD 2OIZD 2I0RD 4FAVC 2H47B 2MADL 2OK4D 2J55L 2IUVD 3RMZC 4L3HC 3SVWC 2IUPD 2AH0D 2IUQD 2HKRD 2IURD 3SJLC 2GC4B
chains in the Genus database with same CATH superfamily
1MAEL 3RLMC 4FANC 2J56L 4O1QC 2I0SD 4FA9C 3PXTC 4Y5RC 2H3XB 2HXCD 2MTAL 4L1QC 2AGXD 3L4OC 2Q7QD 4FB1C 1MG3B 1MAFL 2HKMD 4L3GC 2AGWD 2GC7B 4FA1C 3PXWC 3SXTC 3PXSC 4FA5C 2AGYD 2BBKL 2AH1D 4FA4C 2HJBD 2I0TD 2AGZD 2IAAB 2OK6D 3SLEC 3C75L 3RN0C 4K3IC 2J57K 2HJ4D 2AGLD 1MDAL 3RN1C 3ORVC 1MG2B 3SWSC 3L4MC 2OJYD 2OIZD 2I0RD 4FAVC 2H47B 2MADL 2OK4D 2J55L 2IUVD 3RMZC 4L3HC 3SVWC 2IUPD 2AH0D 2IUQD 2HKRD 2IURD 3SJLC 2GC4B
chains in the Genus database with same CATH topology
1MAEL 3RLMC 4FANC 2J56L 4O1QC 2I0SD 4FA9C 3PXTC 4Y5RC 2H3XB 2HXCD 2MTAL 4L1QC 2AGXD 3L4OC 2Q7QD 4FB1C 1MG3B 1MAFL 2HKMD 4L3GC 2AGWD 2GC7B 4FA1C 3PXWC 3SXTC 3PXSC 4FA5C 2AGYD 2BBKL 2AH1D 4FA4C 2HJBD 2I0TD 2AGZD 2IAAB 2OK6D 3SLEC 3C75L 3RN0C 4K3IC 2J57K 2HJ4D 2AGLD 1MDAL 3RN1C 3ORVC 1MG2B 3SWSC 3L4MC 2OJYD 2OIZD 2I0RD 4FAVC 2H47B 2MADL 2OK4D 2J55L 2IUVD 3RMZC 4L3HC 3SVWC 2IUPD 2AH0D 2IUQD 2HKRD 2IURD 3SJLC 2GC4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MAE L;  3RLM C;  4FAN C;  2J56 L;  4O1Q C;  2I0S D;  4FA9 C;  3PXT C;  4Y5R C;  2H3X B;  2HXC D;  2MTA L;  4L1Q C;  2AGX D;  3L4O C;  2Q7Q D;  4FB1 C;  1MG3 B;  1MAF L;  2HKM D;  4L3G C;  2AGW D;  2GC7 B;  4FA1 C;  3PXW C;  3SXT C;  3PXS C;  4FA5 C;  2AGY D;  2BBK L;  2AH1 D;  4FA4 C;  2HJB D;  2I0T D;  2AGZ D;  2IAA B;  2OK6 D;  3SLE C;  3C75 L;  3RN0 C;  4K3I C;  2J57 K;  2HJ4 D;  2AGL D;  1MDA L;  3RN1 C;  3ORV C;  1MG2 B;  3SWS C;  3L4M C;  2OJY D;  2OIZ D;  2I0R D;  4FAV C;  2H47 B;  2MAD L;  2OK4 D;  2J55 L;  2IUV D;  3RMZ C;  4L3H C;  3SVW C;  2IUP D;  2AH0 D;  2IUQ D;  2HKR D;  2IUR D;  3SJL C;  2GC4 B; 
#chains in the Genus database with same CATH topology
 1MAE L;  3RLM C;  4FAN C;  2J56 L;  4O1Q C;  2I0S D;  4FA9 C;  3PXT C;  4Y5R C;  2H3X B;  2HXC D;  2MTA L;  4L1Q C;  2AGX D;  3L4O C;  2Q7Q D;  4FB1 C;  1MG3 B;  1MAF L;  2HKM D;  4L3G C;  2AGW D;  2GC7 B;  4FA1 C;  3PXW C;  3SXT C;  3PXS C;  4FA5 C;  2AGY D;  2BBK L;  2AH1 D;  4FA4 C;  2HJB D;  2I0T D;  2AGZ D;  2IAA B;  2OK6 D;  3SLE C;  3C75 L;  3RN0 C;  4K3I C;  2J57 K;  2HJ4 D;  2AGL D;  1MDA L;  3RN1 C;  3ORV C;  1MG2 B;  3SWS C;  3L4M C;  2OJY D;  2OIZ D;  2I0R D;  4FAV C;  2H47 B;  2MAD L;  2OK4 D;  2J55 L;  2IUV D;  3RMZ C;  4L3H C;  3SVW C;  2IUP D;  2AH0 D;  2IUQ D;  2HKR D;  2IUR D;  3SJL C;  2GC4 B; 
#chains in the Genus database with same CATH homology
 1MAE L;  3RLM C;  4FAN C;  2J56 L;  4O1Q C;  2I0S D;  4FA9 C;  3PXT C;  4Y5R C;  2H3X B;  2HXC D;  2MTA L;  4L1Q C;  2AGX D;  3L4O C;  2Q7Q D;  4FB1 C;  1MG3 B;  1MAF L;  2HKM D;  4L3G C;  2AGW D;  2GC7 B;  4FA1 C;  3PXW C;  3SXT C;  3PXS C;  4FA5 C;  2AGY D;  2BBK L;  2AH1 D;  4FA4 C;  2HJB D;  2I0T D;  2AGZ D;  2IAA B;  2OK6 D;  3SLE C;  3C75 L;  3RN0 C;  4K3I C;  2J57 K;  2HJ4 D;  2AGL D;  1MDA L;  3RN1 C;  3ORV C;  1MG2 B;  3SWS C;  3L4M C;  2OJY D;  2OIZ D;  2I0R D;  4FAV C;  2H47 B;  2MAD L;  2OK4 D;  2J55 L;  2IUV D;  3RMZ C;  4L3H C;  3SVW C;  2IUP D;  2AH0 D;  2IUQ D;  2HKR D;  2IUR D;  3SJL C;  2GC4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...