2AGMA

Solution structure of the r-module from alge4
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
167
structure length
167
Chain Sequence
GSDGEPLVGGDTDDQLQGGSGADRLDGGAGDDILDGGAGRDRLSGGAGADTFVFSAREDSYRTDTAVFNDLILDFEASEDRIDLSALGFSGLGDGYGGTLLLKTNAEGTRTYLKSFEADAEGRRFEVALDGDHTGDLSAANVVFAATGTTTELEVLGDSGTQAGAIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(beta-D-mannuronate) C5 epimerase 4
publication title NMR structure of the R-module: a parallel beta-roll subunit from an Azotobacter vinelandii mannuronan C-5 epimerase.
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Isomerase
total genus 22
structure length 167
sequence length 167
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 2agmA01
2ZJ7A 3HB2P 3WP8A 2ML2A 2ZJ6A 1OMJA 1OM6A 2Z8XA 2YO1A 3VI1A 4I35A 2YO0A 1G9KA 1OM8A 1O0TA 2Z8ZA 2QUAA 3HBVP 3NTNA 3LAAA 5D7WA 1SRPA 2QUBA 5CXLA 3A70A 1JIWP 1K7IA 1K7QA 1P9HA 3HBUP 1GO8P 1H71P 1SATA 3U1RA 3S6LA 3ULTA 1O0QA 2ZVDA 3HDAP 1AKLA 1K7GA 3A6ZA 1OM7A 1KAPP 2XQHA 2AGMA 3LA9A 1SMPA 1AF0A 5CVWA 1GO7P
chains in the Genus database with same CATH superfamily
2ZJ7A 3HB2P 3WP8A 2ML2A 2ZJ6A 1OMJA 1OM6A 2Z8XA 2YO1A 3VI1A 4I35A 2YO0A 1G9KA 1OM8A 1O0TA 2Z8ZA 2QUAA 3HBVP 3NTNA 3LAAA 5D7WA 1SRPA 2QUBA 4DT5A 5CXLA 3A70A 1JIWP 1K7IA 1K7QA 1P9HA 3HBUP 1GO8P 1H71P 1SATA 3U1RA 3S6LA 3ULTA 1O0QA 2ZVDA 3HDAP 1AKLA 1K7GA 3A6ZA 1OM7A 1KAPP 2XQHA 2AGMA 3LA9A 1SMPA 1AF0A 5CVWA 1GO7P
chains in the Genus database with same CATH topology
2ZJ7A 3HB2P 3WP8A 2ML2A 2ZJ6A 1OMJA 1OM6A 2Z8XA 2YO1A 3VI1A 4I35A 2YO0A 1G9KA 1OM8A 1O0TA 2Z8ZA 2QUAA 3HBVP 3NTNA 3LAAA 5D7WA 1SRPA 2QUBA 5CXLA 3A70A 1JIWP 1K7IA 1K7QA 1P9HA 3HBUP 1GO8P 1H71P 1SATA 3U1RA 3S6LA 3ULTA 1O0QA 2ZVDA 3HDAP 1AKLA 1K7GA 3A6ZA 1OM7A 1KAPP 2XQHA 2AGMA 3LA9A 1SMPA 1AF0A 5CVWA 1GO7P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJ7 A;  3HB2 P;  3WP8 A;  2ML2 A;  2ZJ6 A;  1OMJ A;  1OM6 A;  2Z8X A;  2YO1 A;  3VI1 A;  4I35 A;  2YO0 A;  1G9K A;  1OM8 A;  1O0T A;  2Z8Z A;  2QUA A;  3HBV P;  3NTN A;  3LAA A;  5D7W A;  1SRP A;  2QUB A;  5CXL A;  3A70 A;  1JIW P;  1K7I A;  1K7Q A;  1P9H A;  3HBU P;  1GO8 P;  1H71 P;  1SAT A;  3U1R A;  3S6L A;  3ULT A;  1O0Q A;  2ZVD A;  3HDA P;  1AKL A;  1K7G A;  3A6Z A;  1OM7 A;  1KAP P;  2XQH A;  2AGM A;  3LA9 A;  1SMP A;  1AF0 A;  5CVW A;  1GO7 P; 
#chains in the Genus database with same CATH topology
 2ZJ7 A;  3HB2 P;  3WP8 A;  2ML2 A;  2ZJ6 A;  1OMJ A;  1OM6 A;  2Z8X A;  2YO1 A;  3VI1 A;  4I35 A;  2YO0 A;  1G9K A;  1OM8 A;  1O0T A;  2Z8Z A;  2QUA A;  3HBV P;  3NTN A;  3LAA A;  5D7W A;  1SRP A;  2QUB A;  4DT5 A;  5CXL A;  3A70 A;  1JIW P;  1K7I A;  1K7Q A;  1P9H A;  3HBU P;  1GO8 P;  1H71 P;  1SAT A;  3U1R A;  3S6L A;  3ULT A;  1O0Q A;  2ZVD A;  3HDA P;  1AKL A;  1K7G A;  3A6Z A;  1OM7 A;  1KAP P;  2XQH A;  2AGM A;  3LA9 A;  1SMP A;  1AF0 A;  5CVW A;  1GO7 P; 
#chains in the Genus database with same CATH homology
 2ZJ7 A;  3HB2 P;  3WP8 A;  2ML2 A;  2ZJ6 A;  1OMJ A;  1OM6 A;  2Z8X A;  2YO1 A;  3VI1 A;  4I35 A;  2YO0 A;  1G9K A;  1OM8 A;  1O0T A;  2Z8Z A;  2QUA A;  3HBV P;  3NTN A;  3LAA A;  5D7W A;  1SRP A;  2QUB A;  5CXL A;  3A70 A;  1JIW P;  1K7I A;  1K7Q A;  1P9H A;  3HBU P;  1GO8 P;  1H71 P;  1SAT A;  3U1R A;  3S6L A;  3ULT A;  1O0Q A;  2ZVD A;  3HDA P;  1AKL A;  1K7G A;  3A6Z A;  1OM7 A;  1KAP P;  2XQH A;  2AGM A;  3LA9 A;  1SMP A;  1AF0 A;  5CVW A;  1GO7 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...