2AGXA

Crystal structure of the schiff base intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with tryptamine. p212121 form
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
359
structure length
359
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
total genus 92
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2agxA01
2YMUA 5EM2A 3I8EA 4J84A 4J87A 2CN3A 4CI3A 4J73A 3NVNA 5EARA 4L1QD 2Z2NA 1N6DA 4A0AA 3PVWB 3V7DB 2I3SA 1JJUB 4FA9D 3AFCA 5CXCB 3EMHA 4D0KA 5H17A 2P9KC 4PC0A 4PBZA 4XEIC 3OKWA 3EI1A 3P4FA 1OMWB 3IIWA 4CZVA 5EM2B 2GNQA 2G99A 4GM3A 2H9LA 4J8GA 3IIYA 3OKTA 3MKQA 4I79A 1PI6A 1XKSA 2YB8B 1ERJA 3I7PA 3C75H 3MZKA 2Z2PA 2XL2A 3OKYA 1B9XA 4IA9A 3I2NA 4MK0B 4X60B 2P9LC 2TRCB 4GQ2P 4PNKB 4K3JB 5THAA 4O9DA 4CI1A 3U4YA 4BL0A 1L0QA 3JZGA 2HJ4A 2W18A 2AH0A 3SVWD 3SXTD 1PEVA 3SLED 4K3ID 4BUJC 3C99A 4CZYA 5FKSA 5CYKA 4JT6C 3KRXB 2PM7B 2YNOA 3GREA 4X3EA 5FLXg 1N6FA 5FXYA 3GFCA 4AEZA 4E54A 1MG2A 2B5MA 5CXBB 1YFQA 4FA5D 5HE3B 2O9KA 1GG2B 3RSEC 3UVNA 3NVQA 2OJYA 1FWXA 4G56B 1XHMA 2IUPA 4A08A 3J81g 4ZOZA 3HFQA 1GXRA 4A0BA 1RI6A 3B7FA 4Z8LA 3VA6A 5I5IA 4E54B 3IJCA 4O3UB 3I7KA 3F3PA 3SWSD 5A2Qg 4J0XA 1U2VC 2UZXB 2AQ5A 2IUVA 4FAND 5IT9g 3SN6B 3BWSA 3IJ1A 5H1MA 3EG6A 3DM0A 3AL8A 3C9CA 2IWKA 5GSAA 4A11B 2H3XA 3RFGA 3NVXA 3PE7A 4ES0A 1QNIA 5CXBA 4CY5A 4PBYA 2AGLA 4J8BA 1VYHC 2J56H 3UVKA 3BG1A 2EBSA 4TZ4A 1OLZA 4XYHA 3OL2B 4YVDA 4CI2A 1NR0A 4JSXC 4GGAA 4LGNA 4QT8A 5FQDA 2HJBA 5EAPA 5C2VB 1A0RB 3EI2B 1JOFA 3RN1D 3L4OD 2CNXA 3DXKC 1MG3A 4A09B 5EMJB 3JRPA 2XL3A 4X61B 2B5LA 4QRJA 3FRXA 1SQ9A 2AGXA 3BG0A 3RRMC 4FHLA 2P9IC 1SQJA 4CI8A 3DXMC 2IWFA 5H14A 2GC4A 5HYNB 2QXVA 2OVQB 3JB9L 4LG9A 4BH6A 4A0AB 2UZYB 4OZUA 3ZWLB 4ERYA 5FKQA 2HYEA 5HE0B 4HDJA 4Y5RD 2H14A 3EI2A 2OK6A 1GOTB 5FA5B 3SJLD 3UVMA 2B5NA 2CO0C 4U1EI 3MXXA 2CE8A 4JT5C 1XIPA 4GQBB 5HQGA 3RMZD 3DSMA 4O45A 2IURA 4PSXB 1R5MA 4GGDA 4CC9A 2P9SC 3SCYA 5I5JA 2MTAH 5I5MA 3OW8A 4ZOYA 5TEFA 3UVLA 1TYQC 4OWRA 4CY1A 4FWWA 3A0FA 4FA1D 3IJ0A 3OTTA 4XYIA 5IC7A 3I7HA 4U7AA 5EMKB 5IJ7E 3JAMg 2I0TA 1JMZB 3MKSB 4LG8A 2BCJB 2QC5A 5EMMB 4ERQA 3EU7A 4ESGA 4O1QD 3RN0D 4NSXA 1K8KC 2HKMA 2H47A 2H6QA 4A09A 2OIZA 5KDOB 3PXWD 3C5MA 5TEEA 2CE9A 2YBAA 5CYKB 3SFZA 4JSNC 3JROA 2PM9A 3I7OA 4J78A 4A7JA 4ZOXA 2BBKH 4GZ8A 3CIKB 5AFU3 1SHYB 3VH0A 2YNNA 4KFMB 2H13A 1Q47A 5SXMA 4L9OA 2AGYA 4ZOVA 1U4CA 2XYIA 2H9NA 2H6KA 4ZN4A 3F3GA 4FB1D 3OKYB 1TBGA 4E5ZA 4CY2A 3I8CA 2AH1A 3E0CA 3OL2A 4GM8A 5EALA 4JSPC 2CN2A 2P9UC 5IGOA 3UKUC 4J79A 1S4UX 4Y7RA 3SBQA 5IJ8E 3ORVD 5GXHA 1N6EA 2PM9B 4FAVD 1PBYB 3PSCB 3UVOA 4R7AB 4X63B 2J57G 3EI3B 4JXMA 3J80g 4GMBA 4CZXA 4J0WA 4J82A 2J55H 3AH8B 4A0BB 4L3HD 2B4EA 2GC7A 4CY3A 4N14A 2H68A 5B4WA 2H9MA 5K19A 3JPXA 2I0RA 3K27A 3SHFA 3UR4A 2AGZA 3PXTD 3EI3A 3W15A 5FKRA 1MDAH 2PM6B 3EI4A 3EWEA 1P22A 4J86A 4O3TB 2OVPB 4GM9A 3PSLA 5TDHB 4A11A 4PSWB 2YNPA 4D6VA 3F3FA 1B9YA 2XU7A 3I7LA 4QQEA 3V9FA 2H6NA 2OK4A 5IGQA 3VGZA 4A08B 3MMYA 4FA4D 4J77A 5C9ZB 5CXCA 5GMKn 3JZHA 2I0SA 2PBIB 3I89A 1GP2B 5K1CC 3JZNA 5C2WB 3EI1B 4JSVC 2IAAA 3CFSB 3ODTA 5EAMA 4UI9R 5AMSA 3I7NA 4GGCA 4ERZA 2P9NC 3FM0A 4H5JA 2IUQA 4H5IA 3UKRC 4PXWA 5HE2B 3K26A 2HXCA 5AJAA 2HKRA 2G9AA 5JWZA 3PXSD 2I3TA 3N0DA 3CFVA 4QL1A 2Q7QA 4AOWA 5GXIA 3AL8B 3MZLA 3L4MD 3DWLC 1K32A 4L3GD 5HE1B 3RLMD 3ULEC 2P9PC 4A2MA 3V5WB 2HESX 3AL9A 4E5ZB 3RFHA 3SBPA 1PGUA 3FGBA 4J81A 3KRWB 3SMRA 1JMXB 1NEXB 3EI4B 4A2LA 5EMLB 2OVRB 4JD2C 4IMMA 3SBRA 2H9PA 2CO0A 3N0EA 2AGWA 4GQ1A 2Z2OA 5FKTA 3PVUB 3IKOA 4EWRA 5TF2A
chains in the Genus database with same CATH superfamily
4WK4A 2YMUA 5EM2A 1E8MA 3I8EA 3ZE1A 4J84A 4J87A 2CN3A 4CI3A 4J73A 3NVNA 5EARA 4MMXA 4L1QD 2Z2NA 1N6DA 4A0AA 1L5GA 3PVWB 3V7DB 2I3SA 1JJUB 1O6GA 1C9IA 4FA9D 3AFCA 5CXCB 1YR2A 3EMHA 4D0KA 5H17A 2P9KC 4PC0A 4PBZA 4XEIC 3OKWA 3EI1A 2EIDA 3P4FA 1OMWB 3IIWA 4CZVA 5EM2B 3K6SA 2GNQA 2G99A 4GM3A 2H9LA 3T3PA 4J8GA 3IIYA 3OKTA 3MKQA 4G55A 4I79A 4UM8A 1PI6A 1XKSA 3QI0A 2YB8B 1ERJA 3EQ8A 3I7PA 3C75H 3MZKA 2Z2PA 2XL2A 2QZPA 3OKYA 1B9XA 4IA9A 3I2NA 4MK0B 4X60B 2P9LC 2TRCB 4GQ2P 2VDRA 4PNKB 4K3JB 1VE6A 2VDPA 3VI4A 3NIDA 5THAA 4O9DA 4CI1A 1UOPA 4G1EA 3U4YA 1GOGA 4BL0A 2QR5A 1L0QA 5HDBA 1QFMA 3JZGA 2HJ4A 2W18A 3O4JA 2AH0A 3SVWD 3SXTD 1PEVA 3SLED 4K3ID 4BUJC 3C99A 4CZYA 2VDMA 5FKSA 5CYKA 4JT6C 3KRXB 2PM7B 2YNOA 3GREA 3IVMA 4X3EA 5FLXg 4NBMA 4AN0A 1VZ3A 1N6FA 5FXYA 2WQ8A 3GFCA 4AEZA 4E54A 2VDNA 1MG2A 2B5MA 5CXBB 1QFSA 1YFQA 4FA5D 1TYEA 5HE3B 2O9KA 1GG2B 3RSEC 3UVNA 3NVQA 2OJYA 3GD1I 3K72A 1FWXA 4G56B 1XHMA 2IUPA 3FCSA 4A08A 3J81g 4ZOZA 1E8NA 3HFQA 3O4IA 4RE6A 1GXRA 1GOFA 3ZE0A 4A0BA 5E6RA 1RI6A 3B7FA 3IURA 4NENA 4Z8LA 3VA6A 5I5IA 2VC2A 3IJCA 3IUNA 4O3UB 3I7KA 3ZDYA 3F3PA 3SWSD 5A2Qg 1U8CA 4J0XA 1U2VC 2UZXB 2AQ5A 2IUVA 4FAND 5IT9g 3SN6B 3BWSA 3IJ1A 4AMZA 5H1MA 3EG6A 3DM0A 3AL8A 3C9CA 2IWKA 5GSAA 4A11B 2H3XA 3RFGA 4MMZA 3NVXA 3PE7A 4ES0A 1QNIA 5CXBA 4CY5A 4PBYA 2AGLA 4J8BA 1VYHC 2J56H 3UVKA 3BG1A 4RE5A 2EBSA 4TZ4A 3IJEA 4DNWA 2EICA 1OLZA 4XYHA 1JTDB 1VZ2A 3OL2B 4YVDA 4CI2A 5M5UA 1NR0A 4JSXC 4GGAA 4LGNA 4QT8A 5FQDA 2HJBA 5EAPA 5C2VB 1A0RB 3EI2B 4Z7OA 1JOFA 1JV2A 3IUJA 3RN1D 4MMYA 3L4OD 2CNXA 3DXKC 1MG3A 3FCUA 3MUNA 5EMJB 3JRPA 4A09B 2XL3A 4X61B 2B5LA 4QRJA 3FRXA 1SQ9A 2JKXA 2AGXA 3BG0A 5FFGA 3RRMC 4FHLA 3QHYB 3V4PA 4IRZA 2P9IC 1SQJA 4CI8A 3DXMC 2IWFA 5H14A 2GC4A 5HYNB 2QXVA 2OVQB 3JB9L 4LG9A 4BH6A 2VZ1A 4A0AB 2UZYB 4OZUA 3ZWLB 3MUOA 3MVDK 4ERYA 5FKQA 2HYEA 5HE0B 4HDJA 4Y5RD 1K3IA 2H14A 3EI2A 2OK6A 1GOTB 2BKLA 5FA5B 3SJLD 3UVMA 2B5NA 2CO0C 4U1EI 3MXXA 2CE8A 4JT5C 1XIPA 4GQBB 5HQGA 5M5RA 3RMZD 3DSMA 4O45A 2IURA 4PSXB 1R5MA 4GGDA 4CC9A 2P9SC 3SCYA 5I5JA 2MTAH 1C9LA 5I5MA 3OW8A 4ZOYA 5TEFA 3UVLA 3K71A 1TYQC 4OWRA 4CY1A 4FWWA 3A0FA 4FA1D 5M5SA 3IJ0A 3OTTA 4XYIA 5IC7A 3I7HA 4U7AA 5EMKB 5IJ7E 3JAMg 2I0TA 1JMZB 3MKSB 4LG8A 2BCJB 2QC5A 5EMMB 4ERQA 5M61A 3EU7A 3IULA 4O1QD 3RN0D 4NSXA 4ESGA 1K8KC 2HKMA 2H47A 2H6QA 4A09A 2OIZA 5KDOB 3PXWD 3NIGA 3C5MA 5TEEA 2CE9A 1O6FA 2YBAA 3VI3A 5CYKB 3SFZA 3V4VA 4JHPC 4JSNC 3JROA 3DDUA 4Z7QA 2PM9A 3I7OA 3IUQA 4J78A 2VZ3A 4A7JA 4AX4A 4ZOXA 2BBKH 4GZ8A 3CIKB 5AFU3 2VDQA 1BPOA 1SHYB 3VH0A 2YNNA 4O02A 4KFMB 3NIFA 2H13A 4WJKA 1Q47A 5E6UA 5SXMA 4L9OA 4BCCA 2AGYA 4ZOVA 1U4CA 2XYIA 2H9NA 4DNVA 1H2WA 2H6KA 4DNUA 4ZN4A 3F3GA 3T3MA 4FB1D 3OKYB 1TBGA 4NC4A 4NAAA 4E5ZA 4CY2A 3I8CA 2AH1A 2HU8A 3E0CA 2VDKA 3OL2A 4GM8A 2XZGA 5EALA 4JSPC 2CN2A 1VE7A 2P9UC 5IGOA 1H2XA 4QAMA 2XDWA 3UKUC 4J79A 1S4UX 4Y7RA 1M1XA 1I2MB 5C86A 3SBQA 2HU7A 5IJ8E 3ORVD 4BCBA 5GXHA 1N6EA 5C92A 2PM9B 4FAVD 1PBYB 3EQ9A 4D9SA 4AMYA 3PSCB 3OF7A 4R7AB 3UVOA 4X63B 2J57G 3EI3B 3EQ7A 4JXMA 4AN1A 3J80g 4GMBA 1E5TA 4CZXA 4J0WA 2J55H 4J82A 3AH8B 4BP9A 4A0BB 4L3HD 2B4EA 2GC7A 4CY3A 4N14A 2H68A 5B4WA 1H2ZA 2H9MA 5K19A 2XE4A 4Z7NA 3JPXA 2I0RA 3K27A 3SHFA 3UR4A 2AGZA 3PXTD 3EI3A 4L1MA 3W15A 5FKRA 1MDAH 2PM6B 3EI4A 1H2YA 3EWEA 1P22A 4J86A 4O3TB 2OVPB 1UOQA 4GM9A 3PSLA 1A12A 5TDHB 4A11A 3IUMA 4PSWB 2YNPA 4D6VA 3KCIA 5E6SA 3F3FA 1B9YA 2XU7A 3I7LA 4QQEA 3V9FA 2H6NA 2OK4A 5IGQA 2EIBA 3VGZA 4A08B 2VDLA 3O4HA 3MMYA 4FA4D 4J77A 4G1MA 5C9ZB 5CXCA 5GMKn 1GOHA 3JZHA 2I0SA 2PBIB 1UTCA 4BCDA 3I89A 1GP2B 5K1CC 3JZNA 5C2WB 3EI1B 2HU5A 4O2WA 4JSVC 3ZDZA 2IAAA 2VDOA 3CFSB 3ODTA 5EAMA 3GC3B 1UOOA 4UI9R 5AMSA 3I7NA 3O4GA 4GGCA 4ERZA 2P9NC 3FM0A 4H5JA 2IUQA 4H5IA 3UKRC 4PXWA 4WK2A 4BP8A 5HE2B 3K26A 2HXCA 5AJAA 2HKRA 2G9AA 5JWZA 3PXSD 2I3TA 3N0DA 3CFVA 4QL1A 4JHNA 2Q7QA 4AOWA 5GXIA 3AL8B 3MZLA 3L4MD 5M5VA 3DWLC 1K32A 4L3GD 4WK0A 5HE1B 3RLMD 3ULEC 2P9PC 4A2MA 3V5WB 1T2XA 2HESX 3AL9A 4E5ZB 3RFHA 3SBPA 1PGUA 3FGBA 4J81A 3KRWB 3SMRA 3ZE2A 1JMXB 1NEXB 2EIEA 3EI4B 5EMLB 2OVRB 4A2LA 5M5TA 4E54B 4JD2C 5FFOA 4IMMA 3SBRA 2H9PA 2CO0A 3N0EA 2AGWA 4GQ1A 2Z2OA 5FKTA 3PVUB 3ZDXA 3IKOA 4UM9A 4EWRA 5TF2A
chains in the Genus database with same CATH topology
2YMUA 5EM2A 3I8EA 4J84A 4J87A 2CN3A 4CI3A 4J73A 3NVNA 5EARA 4L1QD 2Z2NA 1N6DA 4A0AA 3PVWB 3V7DB 2I3SA 1JJUB 4FA9D 3AFCA 5CXCB 3EMHA 4D0KA 5H17A 2P9KC 4PC0A 4PBZA 4XEIC 3OKWA 3EI1A 3P4FA 1OMWB 3IIWA 4CZVA 5EM2B 2GNQA 2G99A 4GM3A 2H9LA 4J8GA 3IIYA 3OKTA 3MKQA 4I79A 1PI6A 1XKSA 2YB8B 1ERJA 3I7PA 3C75H 3MZKA 2Z2PA 2XL2A 3OKYA 1B9XA 4IA9A 3I2NA 4MK0B 4X60B 2P9LC 2TRCB 4GQ2P 4PNKB 4K3JB 5THAA 4O9DA 4CI1A 3U4YA 4BL0A 1L0QA 3JZGA 2HJ4A 2W18A 2AH0A 3SVWD 3SXTD 1PEVA 3SLED 4K3ID 4BUJC 3C99A 4CZYA 5FKSA 5CYKA 4JT6C 3KRXB 2PM7B 2YNOA 3GREA 4X3EA 5FLXg 1N6FA 5FXYA 3GFCA 4AEZA 4E54A 1MG2A 2B5MA 5CXBB 1YFQA 4FA5D 5HE3B 2O9KA 1GG2B 3RSEC 3UVNA 3NVQA 2OJYA 1FWXA 4G56B 1XHMA 2IUPA 4A08A 3J81g 4ZOZA 3HFQA 1GXRA 4A0BA 1RI6A 3B7FA 4Z8LA 3VA6A 5I5IA 4E54B 3IJCA 4O3UB 3I7KA 3F3PA 3SWSD 5A2Qg 4J0XA 1U2VC 2UZXB 2AQ5A 2IUVA 4FAND 5IT9g 3SN6B 3BWSA 3IJ1A 5H1MA 3EG6A 3DM0A 3AL8A 3C9CA 2IWKA 5GSAA 4A11B 2H3XA 3RFGA 3NVXA 3PE7A 4ES0A 1QNIA 5CXBA 4CY5A 4PBYA 2AGLA 4J8BA 1VYHC 2J56H 3UVKA 3BG1A 2EBSA 4TZ4A 1OLZA 4XYHA 3OL2B 4YVDA 4CI2A 1NR0A 4JSXC 4GGAA 4LGNA 4QT8A 5FQDA 2HJBA 5EAPA 5C2VB 1A0RB 3EI2B 1JOFA 3RN1D 3L4OD 2CNXA 3DXKC 1MG3A 4A09B 5EMJB 3JRPA 2XL3A 4X61B 2B5LA 4QRJA 3FRXA 1SQ9A 2AGXA 3BG0A 3RRMC 4FHLA 2P9IC 1SQJA 4CI8A 3DXMC 2IWFA 5H14A 2GC4A 5HYNB 2QXVA 2OVQB 3JB9L 4LG9A 4BH6A 4A0AB 2UZYB 4OZUA 3ZWLB 4ERYA 5FKQA 2HYEA 5HE0B 4HDJA 4Y5RD 2H14A 3EI2A 2OK6A 1GOTB 5FA5B 3SJLD 3UVMA 2B5NA 2CO0C 4U1EI 3MXXA 2CE8A 4JT5C 1XIPA 4GQBB 5HQGA 3RMZD 3DSMA 4O45A 2IURA 4PSXB 1R5MA 4GGDA 4CC9A 2P9SC 3SCYA 5I5JA 2MTAH 5I5MA 3OW8A 4ZOYA 5TEFA 3UVLA 1TYQC 4OWRA 4CY1A 4FWWA 3A0FA 4FA1D 3IJ0A 3OTTA 4XYIA 5IC7A 3I7HA 4U7AA 5EMKB 5IJ7E 3JAMg 2I0TA 1JMZB 3MKSB 4LG8A 2BCJB 2QC5A 5EMMB 4ERQA 3EU7A 4ESGA 4O1QD 3RN0D 4NSXA 1K8KC 2HKMA 2H47A 2H6QA 4A09A 2OIZA 5KDOB 3PXWD 3C5MA 5TEEA 2CE9A 2YBAA 5CYKB 3SFZA 4JSNC 3JROA 2PM9A 3I7OA 4J78A 4A7JA 4ZOXA 2BBKH 4GZ8A 3CIKB 5AFU3 1SHYB 3VH0A 2YNNA 4KFMB 2H13A 1Q47A 5SXMA 4L9OA 2AGYA 4ZOVA 1U4CA 2XYIA 2H9NA 2H6KA 4ZN4A 3F3GA 4FB1D 3OKYB 1TBGA 4E5ZA 4CY2A 3I8CA 2AH1A 3E0CA 3OL2A 4GM8A 5EALA 4JSPC 2CN2A 2P9UC 5IGOA 3UKUC 4J79A 1S4UX 4Y7RA 3SBQA 5IJ8E 3ORVD 5GXHA 1N6EA 2PM9B 4FAVD 1PBYB 3PSCB 3UVOA 4R7AB 4X63B 2J57G 3EI3B 4JXMA 3J80g 4GMBA 4CZXA 4J0WA 4J82A 2J55H 3AH8B 4A0BB 4L3HD 2B4EA 2GC7A 4CY3A 4N14A 2H68A 5B4WA 2H9MA 5K19A 3JPXA 2I0RA 3K27A 3SHFA 3UR4A 2AGZA 3PXTD 3EI3A 3W15A 5FKRA 1MDAH 2PM6B 3EI4A 3EWEA 1P22A 4J86A 4O3TB 2OVPB 4GM9A 3PSLA 5TDHB 4A11A 4PSWB 2YNPA 4D6VA 3F3FA 1B9YA 2XU7A 3I7LA 4QQEA 3V9FA 2H6NA 2OK4A 5IGQA 3VGZA 4A08B 3MMYA 4FA4D 4J77A 5C9ZB 5CXCA 5GMKn 3JZHA 2I0SA 2PBIB 3I89A 1GP2B 5K1CC 3JZNA 5C2WB 3EI1B 4JSVC 2IAAA 3CFSB 3ODTA 5EAMA 4UI9R 5AMSA 3I7NA 4GGCA 4ERZA 2P9NC 3FM0A 4H5JA 2IUQA 4H5IA 3UKRC 4PXWA 5HE2B 3K26A 2HXCA 5AJAA 2HKRA 2G9AA 5JWZA 3PXSD 2I3TA 3N0DA 3CFVA 4QL1A 2Q7QA 4AOWA 5GXIA 3AL8B 3MZLA 3L4MD 3DWLC 1K32A 4L3GD 5HE1B 3RLMD 3ULEC 2P9PC 4A2MA 3V5WB 2HESX 3AL9A 4E5ZB 3RFHA 3SBPA 1PGUA 3FGBA 4J81A 3KRWB 3SMRA 1JMXB 1NEXB 3EI4B 4A2LA 5EMLB 2OVRB 4JD2C 4IMMA 3SBRA 2H9PA 2CO0A 3N0EA 2AGWA 4GQ1A 2Z2OA 5FKTA 3PVUB 3IKOA 4EWRA 5TF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YMU A;  5EM2 A;  3I8E A;  4J84 A;  4J87 A;  2CN3 A;  4CI3 A;  4J73 A;  3NVN A;  5EAR A;  4L1Q D;  2Z2N A;  1N6D A;  4A0A A;  3PVW B;  3V7D B;  2I3S A;  1JJU B;  4FA9 D;  3AFC A;  5CXC B;  3EMH A;  4D0K A;  5H17 A;  2P9K C;  4PC0 A;  4PBZ A;  4XEI C;  3OKW A;  3EI1 A;  3P4F A;  1OMW B;  3IIW A;  4CZV A;  5EM2 B;  2GNQ A;  2G99 A;  4GM3 A;  2H9L A;  4J8G A;  3IIY A;  3OKT A;  3MKQ A;  4I79 A;  1PI6 A;  1XKS A;  2YB8 B;  1ERJ A;  3I7P A;  3C75 H;  3MZK A;  2Z2P A;  2XL2 A;  3OKY A;  1B9X A;  4IA9 A;  3I2N A;  4MK0 B;  4X60 B;  2P9L C;  2TRC B;  4GQ2 P;  4PNK B;  4K3J B;  5THA A;  4O9D A;  4CI1 A;  3U4Y A;  4BL0 A;  1L0Q A;  3JZG A;  2HJ4 A;  2W18 A;  2AH0 A;  3SVW D;  3SXT D;  1PEV A;  3SLE D;  4K3I D;  4BUJ C;  3C99 A;  4CZY A;  5FKS A;  5CYK A;  4JT6 C;  3KRX B;  2PM7 B;  2YNO A;  3GRE A;  4X3E A;  5FLX g;  1N6F A;  5FXY A;  3GFC A;  4AEZ A;  4E54 A;  1MG2 A;  2B5M A;  5CXB B;  1YFQ A;  4FA5 D;  5HE3 B;  2O9K A;  1GG2 B;  3RSE C;  3UVN A;  3NVQ A;  2OJY A;  1FWX A;  4G56 B;  1XHM A;  2IUP A;  4A08 A;  3J81 g;  4ZOZ A;  3HFQ A;  1GXR A;  4A0B A;  1RI6 A;  3B7F A;  4Z8L A;  3VA6 A;  5I5I A;  4E54 B;  3IJC A;  4O3U B;  3I7K A;  3F3P A;  3SWS D;  5A2Q g;  4J0X A;  1U2V C;  2UZX B;  2AQ5 A;  2IUV A;  4FAN D;  5IT9 g;  3SN6 B;  3BWS A;  3IJ1 A;  5H1M A;  3EG6 A;  3DM0 A;  3AL8 A;  3C9C A;  2IWK A;  5GSA A;  4A11 B;  2H3X A;  3RFG A;  3NVX A;  3PE7 A;  4ES0 A;  1QNI A;  5CXB A;  4CY5 A;  4PBY A;  2AGL A;  4J8B A;  1VYH C;  2J56 H;  3UVK A;  3BG1 A;  2EBS A;  4TZ4 A;  1OLZ A;  4XYH A;  3OL2 B;  4YVD A;  4CI2 A;  1NR0 A;  4JSX C;  4GGA A;  4LGN A;  4QT8 A;  5FQD A;  2HJB A;  5EAP A;  5C2V B;  1A0R B;  3EI2 B;  1JOF A;  3RN1 D;  3L4O D;  2CNX A;  3DXK C;  1MG3 A;  4A09 B;  5EMJ B;  3JRP A;  2XL3 A;  4X61 B;  2B5L A;  4QRJ A;  3FRX A;  1SQ9 A;  2AGX A;  3BG0 A;  3RRM C;  4FHL A;  2P9I C;  1SQJ A;  4CI8 A;  3DXM C;  2IWF A;  5H14 A;  2GC4 A;  5HYN B;  2QXV A;  2OVQ B;  3JB9 L;  4LG9 A;  4BH6 A;  4A0A B;  2UZY B;  4OZU A;  3ZWL B;  4ERY A;  5FKQ A;  2HYE A;  5HE0 B;  4HDJ A;  4Y5R D;  2H14 A;  3EI2 A;  2OK6 A;  1GOT B;  5FA5 B;  3SJL D;  3UVM A;  2B5N A;  2CO0 C;  4U1E I;  3MXX A;  2CE8 A;  4JT5 C;  1XIP A;  4GQB B;  5HQG A;  3RMZ D;  3DSM A;  4O45 A;  2IUR A;  4PSX B;  1R5M A;  4GGD A;  4CC9 A;  2P9S C;  3SCY A;  5I5J A;  2MTA H;  5I5M A;  3OW8 A;  4ZOY A;  5TEF A;  3UVL A;  1TYQ C;  4OWR A;  4CY1 A;  4FWW A;  3A0F A;  4FA1 D;  3IJ0 A;  3OTT A;  4XYI A;  5IC7 A;  3I7H A;  4U7A A;  5EMK B;  5IJ7 E;  3JAM g;  2I0T A;  1JMZ B;  3MKS B;  4LG8 A;  2BCJ B;  2QC5 A;  5EMM B;  4ERQ A;  3EU7 A;  4ESG A;  4O1Q D;  3RN0 D;  4NSX A;  1K8K C;  2HKM A;  2H47 A;  2H6Q A;  4A09 A;  2OIZ A;  5KDO B;  3PXW D;  3C5M A;  5TEE A;  2CE9 A;  2YBA A;  5CYK B;  3SFZ A;  4JSN C;  3JRO A;  2PM9 A;  3I7O A;  4J78 A;  4A7J A;  4ZOX A;  2BBK H;  4GZ8 A;  3CIK B;  5AFU 3;  1SHY B;  3VH0 A;  2YNN A;  4KFM B;  2H13 A;  1Q47 A;  5SXM A;  4L9O A;  2AGY A;  4ZOV A;  1U4C A;  2XYI A;  2H9N A;  2H6K A;  4ZN4 A;  3F3G A;  4FB1 D;  3OKY B;  1TBG A;  4E5Z A;  4CY2 A;  3I8C A;  2AH1 A;  3E0C A;  3OL2 A;  4GM8 A;  5EAL A;  4JSP C;  2CN2 A;  2P9U C;  5IGO A;  3UKU C;  4J79 A;  1S4U X;  4Y7R A;  3SBQ A;  5IJ8 E;  3ORV D;  5GXH A;  1N6E A;  2PM9 B;  4FAV D;  1PBY B;  3PSC B;  3UVO A;  4R7A B;  4X63 B;  2J57 G;  3EI3 B;  4JXM A;  3J80 g;  4GMB A;  4CZX A;  4J0W A;  4J82 A;  2J55 H;  3AH8 B;  4A0B B;  4L3H D;  2B4E A;  2GC7 A;  4CY3 A;  4N14 A;  2H68 A;  5B4W A;  2H9M A;  5K19 A;  3JPX A;  2I0R A;  3K27 A;  3SHF A;  3UR4 A;  2AGZ A;  3PXT D;  3EI3 A;  3W15 A;  5FKR A;  1MDA H;  2PM6 B;  3EI4 A;  3EWE A;  1P22 A;  4J86 A;  4O3T B;  2OVP B;  4GM9 A;  3PSL A;  5TDH B;  4A11 A;  4PSW B;  2YNP A;  4D6V A;  3F3F A;  1B9Y A;  2XU7 A;  3I7L A;  4QQE A;  3V9F A;  2H6N A;  2OK4 A;  5IGQ A;  3VGZ A;  4A08 B;  3MMY A;  4FA4 D;  4J77 A;  5C9Z B;  5CXC A;  5GMK n;  3JZH A;  2I0S A;  2PBI B;  3I89 A;  1GP2 B;  5K1C C;  3JZN A;  5C2W B;  3EI1 B;  4JSV C;  2IAA A;  3CFS B;  3ODT A;  5EAM A;  4UI9 R;  5AMS A;  3I7N A;  4GGC A;  4ERZ A;  2P9N C;  3FM0 A;  4H5J A;  2IUQ A;  4H5I A;  3UKR C;  4PXW A;  5HE2 B;  3K26 A;  2HXC A;  5AJA A;  2HKR A;  2G9A A;  5JWZ A;  3PXS D;  2I3T A;  3N0D A;  3CFV A;  4QL1 A;  2Q7Q A;  4AOW A;  5GXI A;  3AL8 B;  3MZL A;  3L4M D;  3DWL C;  1K32 A;  4L3G D;  5HE1 B;  3RLM D;  3ULE C;  2P9P C;  4A2M A;  3V5W B;  2HES X;  3AL9 A;  4E5Z B;  3RFH A;  3SBP A;  1PGU A;  3FGB A;  4J81 A;  3KRW B;  3SMR A;  1JMX B;  1NEX B;  3EI4 B;  4A2L A;  5EML B;  2OVR B;  4JD2 C;  4IMM A;  3SBR A;  2H9P A;  2CO0 A;  3N0E A;  2AGW A;  4GQ1 A;  2Z2O A;  5FKT A;  3PVU B;  3IKO A;  4EWR A;  5TF2 A; 
#chains in the Genus database with same CATH topology
 4WK4 A;  2YMU A;  5EM2 A;  1E8M A;  3I8E A;  3ZE1 A;  4J84 A;  4J87 A;  2CN3 A;  4CI3 A;  4J73 A;  3NVN A;  5EAR A;  4MMX A;  4L1Q D;  2Z2N A;  1N6D A;  4A0A A;  1L5G A;  3PVW B;  3V7D B;  2I3S A;  1JJU B;  1O6G A;  1C9I A;  4FA9 D;  3AFC A;  5CXC B;  1YR2 A;  3EMH A;  4D0K A;  5H17 A;  2P9K C;  4PC0 A;  4PBZ A;  4XEI C;  3OKW A;  3EI1 A;  2EID A;  3P4F A;  1OMW B;  3IIW A;  4CZV A;  5EM2 B;  3K6S A;  2GNQ A;  2G99 A;  4GM3 A;  2H9L A;  3T3P A;  4J8G A;  3IIY A;  3OKT A;  3MKQ A;  4G55 A;  4I79 A;  4UM8 A;  1PI6 A;  1XKS A;  3QI0 A;  2YB8 B;  1ERJ A;  3EQ8 A;  3I7P A;  3C75 H;  3MZK A;  2Z2P A;  2XL2 A;  2QZP A;  3OKY A;  1B9X A;  4IA9 A;  3I2N A;  4MK0 B;  4X60 B;  2P9L C;  2TRC B;  4GQ2 P;  2VDR A;  4PNK B;  4K3J B;  1VE6 A;  2VDP A;  3VI4 A;  3NID A;  5THA A;  4O9D A;  4CI1 A;  1UOP A;  4G1E A;  3U4Y A;  1GOG A;  4BL0 A;  2QR5 A;  1L0Q A;  5HDB A;  1QFM A;  3JZG A;  2HJ4 A;  2W18 A;  3O4J A;  2AH0 A;  3SVW D;  3SXT D;  1PEV A;  3SLE D;  4K3I D;  4BUJ C;  3C99 A;  4CZY A;  2VDM A;  5FKS A;  5CYK A;  4JT6 C;  3KRX B;  2PM7 B;  2YNO A;  3GRE A;  3IVM A;  4X3E A;  5FLX g;  4NBM A;  4AN0 A;  1VZ3 A;  1N6F A;  5FXY A;  2WQ8 A;  3GFC A;  4AEZ A;  4E54 A;  2VDN A;  1MG2 A;  2B5M A;  5CXB B;  1QFS A;  1YFQ A;  4FA5 D;  1TYE A;  5HE3 B;  2O9K A;  1GG2 B;  3RSE C;  3UVN A;  3NVQ A;  2OJY A;  3GD1 I;  3K72 A;  1FWX A;  4G56 B;  1XHM A;  2IUP A;  3FCS A;  4A08 A;  3J81 g;  4ZOZ A;  1E8N A;  3HFQ A;  3O4I A;  4RE6 A;  1GXR A;  1GOF A;  3ZE0 A;  4A0B A;  5E6R A;  1RI6 A;  3B7F A;  3IUR A;  4NEN A;  4Z8L A;  3VA6 A;  5I5I A;  2VC2 A;  3IJC A;  3IUN A;  4O3U B;  3I7K A;  3ZDY A;  3F3P A;  3SWS D;  5A2Q g;  1U8C A;  4J0X A;  1U2V C;  2UZX B;  2AQ5 A;  2IUV A;  4FAN D;  5IT9 g;  3SN6 B;  3BWS A;  3IJ1 A;  4AMZ A;  5H1M A;  3EG6 A;  3DM0 A;  3AL8 A;  3C9C A;  2IWK A;  5GSA A;  4A11 B;  2H3X A;  3RFG A;  4MMZ A;  3NVX A;  3PE7 A;  4ES0 A;  1QNI A;  5CXB A;  4CY5 A;  4PBY A;  2AGL A;  4J8B A;  1VYH C;  2J56 H;  3UVK A;  3BG1 A;  4RE5 A;  2EBS A;  4TZ4 A;  3IJE A;  4DNW A;  2EIC A;  1OLZ A;  4XYH A;  1JTD B;  1VZ2 A;  3OL2 B;  4YVD A;  4CI2 A;  5M5U A;  1NR0 A;  4JSX C;  4GGA A;  4LGN A;  4QT8 A;  5FQD A;  2HJB A;  5EAP A;  5C2V B;  1A0R B;  3EI2 B;  4Z7O A;  1JOF A;  1JV2 A;  3IUJ A;  3RN1 D;  4MMY A;  3L4O D;  2CNX A;  3DXK C;  1MG3 A;  3FCU A;  3MUN A;  5EMJ B;  3JRP A;  4A09 B;  2XL3 A;  4X61 B;  2B5L A;  4QRJ A;  3FRX A;  1SQ9 A;  2JKX A;  2AGX A;  3BG0 A;  5FFG A;  3RRM C;  4FHL A;  3QHY B;  3V4P A;  4IRZ A;  2P9I C;  1SQJ A;  4CI8 A;  3DXM C;  2IWF A;  5H14 A;  2GC4 A;  5HYN B;  2QXV A;  2OVQ B;  3JB9 L;  4LG9 A;  4BH6 A;  2VZ1 A;  4A0A B;  2UZY B;  4OZU A;  3ZWL B;  3MUO A;  3MVD K;  4ERY A;  5FKQ A;  2HYE A;  5HE0 B;  4HDJ A;  4Y5R D;  1K3I A;  2H14 A;  3EI2 A;  2OK6 A;  1GOT B;  2BKL A;  5FA5 B;  3SJL D;  3UVM A;  2B5N A;  2CO0 C;  4U1E I;  3MXX A;  2CE8 A;  4JT5 C;  1XIP A;  4GQB B;  5HQG A;  5M5R A;  3RMZ D;  3DSM A;  4O45 A;  2IUR A;  4PSX B;  1R5M A;  4GGD A;  4CC9 A;  2P9S C;  3SCY A;  5I5J A;  2MTA H;  1C9L A;  5I5M A;  3OW8 A;  4ZOY A;  5TEF A;  3UVL A;  3K71 A;  1TYQ C;  4OWR A;  4CY1 A;  4FWW A;  3A0F A;  4FA1 D;  5M5S A;  3IJ0 A;  3OTT A;  4XYI A;  5IC7 A;  3I7H A;  4U7A A;  5EMK B;  5IJ7 E;  3JAM g;  2I0T A;  1JMZ B;  3MKS B;  4LG8 A;  2BCJ B;  2QC5 A;  5EMM B;  4ERQ A;  5M61 A;  3EU7 A;  3IUL A;  4O1Q D;  3RN0 D;  4NSX A;  4ESG A;  1K8K C;  2HKM A;  2H47 A;  2H6Q A;  4A09 A;  2OIZ A;  5KDO B;  3PXW D;  3NIG A;  3C5M A;  5TEE A;  2CE9 A;  1O6F A;  2YBA A;  3VI3 A;  5CYK B;  3SFZ A;  3V4V A;  4JHP C;  4JSN C;  3JRO A;  3DDU A;  4Z7Q A;  2PM9 A;  3I7O A;  3IUQ A;  4J78 A;  2VZ3 A;  4A7J A;  4AX4 A;  4ZOX A;  2BBK H;  4GZ8 A;  3CIK B;  5AFU 3;  2VDQ A;  1BPO A;  1SHY B;  3VH0 A;  2YNN A;  4O02 A;  4KFM B;  3NIF A;  2H13 A;  4WJK A;  1Q47 A;  5E6U A;  5SXM A;  4L9O A;  4BCC A;  2AGY A;  4ZOV A;  1U4C A;  2XYI A;  2H9N A;  4DNV A;  1H2W A;  2H6K A;  4DNU A;  4ZN4 A;  3F3G A;  3T3M A;  4FB1 D;  3OKY B;  1TBG A;  4NC4 A;  4NAA A;  4E5Z A;  4CY2 A;  3I8C A;  2AH1 A;  2HU8 A;  3E0C A;  2VDK A;  3OL2 A;  4GM8 A;  2XZG A;  5EAL A;  4JSP C;  2CN2 A;  1VE7 A;  2P9U C;  5IGO A;  1H2X A;  4QAM A;  2XDW A;  3UKU C;  4J79 A;  1S4U X;  4Y7R A;  1M1X A;  1I2M B;  5C86 A;  3SBQ A;  2HU7 A;  5IJ8 E;  3ORV D;  4BCB A;  5GXH A;  1N6E A;  5C92 A;  2PM9 B;  4FAV D;  1PBY B;  3EQ9 A;  4D9S A;  4AMY A;  3PSC B;  3OF7 A;  4R7A B;  3UVO A;  4X63 B;  2J57 G;  3EI3 B;  3EQ7 A;  4JXM A;  4AN1 A;  3J80 g;  4GMB A;  1E5T A;  4CZX A;  4J0W A;  2J55 H;  4J82 A;  3AH8 B;  4BP9 A;  4A0B B;  4L3H D;  2B4E A;  2GC7 A;  4CY3 A;  4N14 A;  2H68 A;  5B4W A;  1H2Z A;  2H9M A;  5K19 A;  2XE4 A;  4Z7N A;  3JPX A;  2I0R A;  3K27 A;  3SHF A;  3UR4 A;  2AGZ A;  3PXT D;  3EI3 A;  4L1M A;  3W15 A;  5FKR A;  1MDA H;  2PM6 B;  3EI4 A;  1H2Y A;  3EWE A;  1P22 A;  4J86 A;  4O3T B;  2OVP B;  1UOQ A;  4GM9 A;  3PSL A;  1A12 A;  5TDH B;  4A11 A;  3IUM A;  4PSW B;  2YNP A;  4D6V A;  3KCI A;  5E6S A;  3F3F A;  1B9Y A;  2XU7 A;  3I7L A;  4QQE A;  3V9F A;  2H6N A;  2OK4 A;  5IGQ A;  2EIB A;  3VGZ A;  4A08 B;  2VDL A;  3O4H A;  3MMY A;  4FA4 D;  4J77 A;  4G1M A;  5C9Z B;  5CXC A;  5GMK n;  1GOH A;  3JZH A;  2I0S A;  2PBI B;  1UTC A;  4BCD A;  3I89 A;  1GP2 B;  5K1C C;  3JZN A;  5C2W B;  3EI1 B;  2HU5 A;  4O2W A;  4JSV C;  3ZDZ A;  2IAA A;  2VDO A;  3CFS B;  3ODT A;  5EAM A;  3GC3 B;  1UOO A;  4UI9 R;  5AMS A;  3I7N A;  3O4G A;  4GGC A;  4ERZ A;  2P9N C;  3FM0 A;  4H5J A;  2IUQ A;  4H5I A;  3UKR C;  4PXW A;  4WK2 A;  4BP8 A;  5HE2 B;  3K26 A;  2HXC A;  5AJA A;  2HKR A;  2G9A A;  5JWZ A;  3PXS D;  2I3T A;  3N0D A;  3CFV A;  4QL1 A;  4JHN A;  2Q7Q A;  4AOW A;  5GXI A;  3AL8 B;  3MZL A;  3L4M D;  5M5V A;  3DWL C;  1K32 A;  4L3G D;  4WK0 A;  5HE1 B;  3RLM D;  3ULE C;  2P9P C;  4A2M A;  3V5W B;  1T2X A;  2HES X;  3AL9 A;  4E5Z B;  3RFH A;  3SBP A;  1PGU A;  3FGB A;  4J81 A;  3KRW B;  3SMR A;  3ZE2 A;  1JMX B;  1NEX B;  2EIE A;  3EI4 B;  5EML B;  2OVR B;  4A2L A;  5M5T A;  4E54 B;  4JD2 C;  5FFO A;  4IMM A;  3SBR A;  2H9P A;  2CO0 A;  3N0E A;  2AGW A;  4GQ1 A;  2Z2O A;  5FKT A;  3PVU B;  3ZDX A;  3IKO A;  4UM9 A;  4EWR A;  5TF2 A; 
#chains in the Genus database with same CATH homology
 2YMU A;  5EM2 A;  3I8E A;  4J84 A;  4J87 A;  2CN3 A;  4CI3 A;  4J73 A;  3NVN A;  5EAR A;  4L1Q D;  2Z2N A;  1N6D A;  4A0A A;  3PVW B;  3V7D B;  2I3S A;  1JJU B;  4FA9 D;  3AFC A;  5CXC B;  3EMH A;  4D0K A;  5H17 A;  2P9K C;  4PC0 A;  4PBZ A;  4XEI C;  3OKW A;  3EI1 A;  3P4F A;  1OMW B;  3IIW A;  4CZV A;  5EM2 B;  2GNQ A;  2G99 A;  4GM3 A;  2H9L A;  4J8G A;  3IIY A;  3OKT A;  3MKQ A;  4I79 A;  1PI6 A;  1XKS A;  2YB8 B;  1ERJ A;  3I7P A;  3C75 H;  3MZK A;  2Z2P A;  2XL2 A;  3OKY A;  1B9X A;  4IA9 A;  3I2N A;  4MK0 B;  4X60 B;  2P9L C;  2TRC B;  4GQ2 P;  4PNK B;  4K3J B;  5THA A;  4O9D A;  4CI1 A;  3U4Y A;  4BL0 A;  1L0Q A;  3JZG A;  2HJ4 A;  2W18 A;  2AH0 A;  3SVW D;  3SXT D;  1PEV A;  3SLE D;  4K3I D;  4BUJ C;  3C99 A;  4CZY A;  5FKS A;  5CYK A;  4JT6 C;  3KRX B;  2PM7 B;  2YNO A;  3GRE A;  4X3E A;  5FLX g;  1N6F A;  5FXY A;  3GFC A;  4AEZ A;  4E54 A;  1MG2 A;  2B5M A;  5CXB B;  1YFQ A;  4FA5 D;  5HE3 B;  2O9K A;  1GG2 B;  3RSE C;  3UVN A;  3NVQ A;  2OJY A;  1FWX A;  4G56 B;  1XHM A;  2IUP A;  4A08 A;  3J81 g;  4ZOZ A;  3HFQ A;  1GXR A;  4A0B A;  1RI6 A;  3B7F A;  4Z8L A;  3VA6 A;  5I5I A;  4E54 B;  3IJC A;  4O3U B;  3I7K A;  3F3P A;  3SWS D;  5A2Q g;  4J0X A;  1U2V C;  2UZX B;  2AQ5 A;  2IUV A;  4FAN D;  5IT9 g;  3SN6 B;  3BWS A;  3IJ1 A;  5H1M A;  3EG6 A;  3DM0 A;  3AL8 A;  3C9C A;  2IWK A;  5GSA A;  4A11 B;  2H3X A;  3RFG A;  3NVX A;  3PE7 A;  4ES0 A;  1QNI A;  5CXB A;  4CY5 A;  4PBY A;  2AGL A;  4J8B A;  1VYH C;  2J56 H;  3UVK A;  3BG1 A;  2EBS A;  4TZ4 A;  1OLZ A;  4XYH A;  3OL2 B;  4YVD A;  4CI2 A;  1NR0 A;  4JSX C;  4GGA A;  4LGN A;  4QT8 A;  5FQD A;  2HJB A;  5EAP A;  5C2V B;  1A0R B;  3EI2 B;  1JOF A;  3RN1 D;  3L4O D;  2CNX A;  3DXK C;  1MG3 A;  4A09 B;  5EMJ B;  3JRP A;  2XL3 A;  4X61 B;  2B5L A;  4QRJ A;  3FRX A;  1SQ9 A;  2AGX A;  3BG0 A;  3RRM C;  4FHL A;  2P9I C;  1SQJ A;  4CI8 A;  3DXM C;  2IWF A;  5H14 A;  2GC4 A;  5HYN B;  2QXV A;  2OVQ B;  3JB9 L;  4LG9 A;  4BH6 A;  4A0A B;  2UZY B;  4OZU A;  3ZWL B;  4ERY A;  5FKQ A;  2HYE A;  5HE0 B;  4HDJ A;  4Y5R D;  2H14 A;  3EI2 A;  2OK6 A;  1GOT B;  5FA5 B;  3SJL D;  3UVM A;  2B5N A;  2CO0 C;  4U1E I;  3MXX A;  2CE8 A;  4JT5 C;  1XIP A;  4GQB B;  5HQG A;  3RMZ D;  3DSM A;  4O45 A;  2IUR A;  4PSX B;  1R5M A;  4GGD A;  4CC9 A;  2P9S C;  3SCY A;  5I5J A;  2MTA H;  5I5M A;  3OW8 A;  4ZOY A;  5TEF A;  3UVL A;  1TYQ C;  4OWR A;  4CY1 A;  4FWW A;  3A0F A;  4FA1 D;  3IJ0 A;  3OTT A;  4XYI A;  5IC7 A;  3I7H A;  4U7A A;  5EMK B;  5IJ7 E;  3JAM g;  2I0T A;  1JMZ B;  3MKS B;  4LG8 A;  2BCJ B;  2QC5 A;  5EMM B;  4ERQ A;  3EU7 A;  4ESG A;  4O1Q D;  3RN0 D;  4NSX A;  1K8K C;  2HKM A;  2H47 A;  2H6Q A;  4A09 A;  2OIZ A;  5KDO B;  3PXW D;  3C5M A;  5TEE A;  2CE9 A;  2YBA A;  5CYK B;  3SFZ A;  4JSN C;  3JRO A;  2PM9 A;  3I7O A;  4J78 A;  4A7J A;  4ZOX A;  2BBK H;  4GZ8 A;  3CIK B;  5AFU 3;  1SHY B;  3VH0 A;  2YNN A;  4KFM B;  2H13 A;  1Q47 A;  5SXM A;  4L9O A;  2AGY A;  4ZOV A;  1U4C A;  2XYI A;  2H9N A;  2H6K A;  4ZN4 A;  3F3G A;  4FB1 D;  3OKY B;  1TBG A;  4E5Z A;  4CY2 A;  3I8C A;  2AH1 A;  3E0C A;  3OL2 A;  4GM8 A;  5EAL A;  4JSP C;  2CN2 A;  2P9U C;  5IGO A;  3UKU C;  4J79 A;  1S4U X;  4Y7R A;  3SBQ A;  5IJ8 E;  3ORV D;  5GXH A;  1N6E A;  2PM9 B;  4FAV D;  1PBY B;  3PSC B;  3UVO A;  4R7A B;  4X63 B;  2J57 G;  3EI3 B;  4JXM A;  3J80 g;  4GMB A;  4CZX A;  4J0W A;  4J82 A;  2J55 H;  3AH8 B;  4A0B B;  4L3H D;  2B4E A;  2GC7 A;  4CY3 A;  4N14 A;  2H68 A;  5B4W A;  2H9M A;  5K19 A;  3JPX A;  2I0R A;  3K27 A;  3SHF A;  3UR4 A;  2AGZ A;  3PXT D;  3EI3 A;  3W15 A;  5FKR A;  1MDA H;  2PM6 B;  3EI4 A;  3EWE A;  1P22 A;  4J86 A;  4O3T B;  2OVP B;  4GM9 A;  3PSL A;  5TDH B;  4A11 A;  4PSW B;  2YNP A;  4D6V A;  3F3F A;  1B9Y A;  2XU7 A;  3I7L A;  4QQE A;  3V9F A;  2H6N A;  2OK4 A;  5IGQ A;  3VGZ A;  4A08 B;  3MMY A;  4FA4 D;  4J77 A;  5C9Z B;  5CXC A;  5GMK n;  3JZH A;  2I0S A;  2PBI B;  3I89 A;  1GP2 B;  5K1C C;  3JZN A;  5C2W B;  3EI1 B;  4JSV C;  2IAA A;  3CFS B;  3ODT A;  5EAM A;  4UI9 R;  5AMS A;  3I7N A;  4GGC A;  4ERZ A;  2P9N C;  3FM0 A;  4H5J A;  2IUQ A;  4H5I A;  3UKR C;  4PXW A;  5HE2 B;  3K26 A;  2HXC A;  5AJA A;  2HKR A;  2G9A A;  5JWZ A;  3PXS D;  2I3T A;  3N0D A;  3CFV A;  4QL1 A;  2Q7Q A;  4AOW A;  5GXI A;  3AL8 B;  3MZL A;  3L4M D;  3DWL C;  1K32 A;  4L3G D;  5HE1 B;  3RLM D;  3ULE C;  2P9P C;  4A2M A;  3V5W B;  2HES X;  3AL9 A;  4E5Z B;  3RFH A;  3SBP A;  1PGU A;  3FGB A;  4J81 A;  3KRW B;  3SMR A;  1JMX B;  1NEX B;  3EI4 B;  4A2L A;  5EML B;  2OVR B;  4JD2 C;  4IMM A;  3SBR A;  2H9P A;  2CO0 A;  3N0E A;  2AGW A;  4GQ1 A;  2Z2O A;  5FKT A;  3PVU B;  3IKO A;  4EWR A;  5TF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...