2AGYA

Crystal structure of the schiff base intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with tryptamine. monoclinic form
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
360
structure length
360
Chain Sequence
b'REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
molecule tags Oxidoreductase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
total genus 98
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2agyA01
3JRPA 3EI3B 4GZ8A 5TEEA 4L3GD 1MG2A 4K3ID 3J81g 2H9PA 4GM3A 5HQGA 3MKQA 4D6VA 4O3UB 1N6EA 5HE3B 3EI2A 3OL2A 3EI1B 2I3SA 3MKSB 2CE9A 3SVWD 3PE7A 4J82A 2I3TA 3PVUB 3UKUC 4A08B 4O45A 3C99A 5GXIA 3N0DA 3GREA 4J78A 2P9KC 1YFQA 2P9UC 4QQEA 3IKOA 5CXBA 4PXWA 2YB8B 4E5ZA 3MXXA 2HJ4A 4J86A 4A2LA 4XYHA 4LG9A 3DWLC 3OKTA 2HXCA 4JXMA 3JPXA 2IAAA 1U4CA 1N6FA 3RMZD 3SN6B 3EI1A 3VH0A 5H17A 1QNIA 2B5LA 3L4MD 4CI8A 2PBIB 4O9DA 3UVNA 2YNNA 4ES0A 1P22A 4FAVD 3ULEC 3K27A 2P9LC 3VA6A 4ZOXA 3U4YA 4HDJA 5KDOB 2IURA 2AH0A 4Y5RD 2O9KA 3I2NA 4J77A 4FWWA 5FKSA 3SWSD 4GMBA 3RFHA 3IJCA 4A09A 2AGZA 2BCJB 3RN0D 3I8CA 4JSVC 3JZNA 1B9XA 2XL3A 4I79A 3EI2B 4ERYA 4L9OA 4JD2C 4O3TB 1MDAH 5AJAA 1XHMA 2OJYA 5EARA 1L0QA 1B9YA 2H47A 5CXBB 2IUVA 2IWKA 5C2WB 3ODTA 5CYKB 4ESGA 1OLZA 3UVMA 4E5ZB 3EI4A 4CY1A 4ZN4A 3L4OD 1PGUA 2HKMA 3N0EA 4BL0A 4JSPC 3SCYA 1JMZB 2PM9B 5I5JA 3P4FA 5IGQA 2IUQA 5HE1B 2XU7A 3PXWD 2CN3A 3MZLA 4J81A 5K1CC 2PM7B 2XL2A 3ORVD 3SLED 2EBSA 5EM2B 3J80g 1GP2B 5B4WA 4GGAA 2CNXA 3DXMC 1JJUB 4A0BB 2H9LA 2HYEA 4BUJC 4ZOYA 3V7DB 2BBKH 3OW8A 3NVNA 3SMRA 3SHFA 4ERQA 4PC0A 4CZVA 3E0CA 4GQ1A 3I7PA 3V9FA 2W18A 1JOFA 2GNQA 5EMLB 3RFGA 1A0RB 3DSMA 4FA1D 5THAA 2PM9A 3C5MA 3CIKB 3EG6A 4J73A 4X63B 1S4UX 5GMKn 4OWRA 2H6KA 5AFU3 4NSXA 5FKQA 3JAMg 4L3HD 5HE2B 4Z8LA 2P9IC 2AQ5A 2HJBA 4D0KA 1PBYB 5FQDA 3PXSD 4OZUA 4XYIA 2QC5A 2B5NA 2I0RA 5EMKB 2IUPA 5H1MA 4R7AB 2CO0C 4X60B 4A0AA 2I0SA 3RSEC 3UVLA 2H13A 2B5MA 3UVKA 3F3FA 2YMUA 4CY5A 4U1EI 3BG1A 4PSWB 4J0XA 5GSAA 5GXHA 3AH8B 2CE8A 4PSXB 5IJ8E 4K3JB 3FRXA 3V5WB 4CI3A 4PNKB 2AGWA 4O1QD 5H14A 4A7JA 2MTAH 3F3PA 3UKRC 3OKWA 4CY3A 5JWZA 4CI1A 1TYQC 2HKRA 3B7FA 3UR4A 5EMJB 2CO0A 3DXKC 2HESX 4J87A 5SXMA 2PM6B 3OKYB 4J79A 1XKSA 2OK4A 5FA5B 3A0FA 4FA4D 2G99A 3CFVA 3NVXA 5EALA 1JMXB 2H6QA 3BWSA 1K32A 2QXVA 4H5JA 3PSCB 3GFCA 4A09B 2YNOA 4A11B 2H14A 4GGDA 3SJLD 5C9ZB 1N6DA 4JT5C 5FXYA 4FA5D 4FAND 5A2Qg 4E54A 4JT6C 4QRJA 3AFCA 3RN1D 3AL8A 2AGXA 2YNPA 2H6NA 2OIZA 3SBQA 4CY2A 4KFMB 4GQBB 4AEZA 4CC9A 4FB1D 5HE0B 3SBRA 1K8KC 3FGBA 3I7KA 4CI2A 3F3GA 1TBGA 3VGZA 3KRWB 5IC7A 4CZXA 4H5IA 3RLMD 3I8EA 4Y7RA 4X3EA 1RI6A 2H3XA 4JSNC 3ZWLB 5EMMB 3IJ0A 3KRXB 3SFZA 5FKRA 2B4EA 1R5MA 3AL8B 3PVWB 4A11A 2IWFA 4PBYA 5FLXg 1NEXB 4XEIC 2J55H 2UZYB 2H9MA 4J0WA 2AH1A 5EM2A 3SBPA 4ERZA 4IA9A 3OL2B 3I7LA 4GM8A 3IIWA 5TDHB 1NR0A 5I5IA 4GQ2P 1U2VC 2P9NC 5C2VB 5IGOA 4A2MA 2Z2PA 5IJ7E 4A0AB 1VYHC 4J8GA 5EAPA 1SQJA 2AGLA 3FM0A 1GOTB 3JROA 4AOWA 3CFSB 3AL9A 2G9AA 4QL1A 4ZOVA 4N14A 2Z2NA 1FWXA 2GC4A 2I0TA 2J57G 2P9PC 2J56H 2XYIA 4FHLA 3IIYA 3K26A 3I7HA 5HYNB 1SQ9A 4LGNA 2OVQB 4U7AA 4TZ4A 3UVOA 4J8BA 3JZGA 3C9CA 3I7OA 4J84A 4UI9R 3JB9L 3BG0A 5CXCB 3EI3A 5IT9g 1SHYB 1GXRA 5K19A 4BH6A 2YBAA 1GG2B 4PBZA 2CN2A 3MMYA 3OTTA 4LG8A 5FKTA 3PSLA 2OVRB 3NVQA 4JSXC 5EAMA 4EWRA 4MK0B 2TRCB 4QT8A 4L1QD 3DM0A 3EU7A 1ERJA 1XIPA 3I89A 2OVPB 3W15A 1MG3A 5CYKA 3C75H 3OKYA 2OK6A 3EI4B 4ZOZA 3I7NA 3EWEA 4FA9D 2GC7A 3MZKA 2P9SC 5AMSA 3EMHA 3RRMC 1OMWB 5CXCA 3PXTD 5TF2A 4GM9A 1PI6A 4X61B 4YVDA 4A0BA 2UZXB 5TEFA 2Z2OA 3JZHA 4GGCA 2AGYA 4E54B 1Q47A 3SXTD 4CZYA 4G56B 4A08A 3IJ1A 1PEVA 4IMMA 5I5MA 2Q7QA 3HFQA 2H68A 2H9NA
chains in the Genus database with same CATH superfamily
3JRPA 3EI3B 4DNWA 4GZ8A 5TEEA 4WJKA 1QFMA 3ZE0A 4L3GD 1MG2A 4K3ID 3J81g 2H9PA 4GM3A 3MUOA 5HQGA 3MKQA 4D6VA 4O3UB 1N6EA 5HE3B 3IVMA 1TYEA 4IRZA 3EI2A 3OL2A 3EI1B 2I3SA 4L1MA 1A12A 3MKSB 4G1EA 3KCIA 2CE9A 3SVWD 5M5RA 3PE7A 5FFOA 4J82A 2I3TA 3PVUB 3UKUC 4BCCA 4A08B 4BP8A 4O45A 3C99A 5GXIA 3N0DA 3GREA 4J78A 2P9KC 1YFQA 2P9UC 4QQEA 1C9IA 2JKXA 3IKOA 4UM8A 5CXBA 4PXWA 2VDRA 2YB8B 4E5ZA 3GC3B 3MXXA 2HJ4A 4J86A 4A2LA 4XYHA 4LG9A 3IJEA 3DWLC 5E6RA 5M5SA 3OKTA 1E8MA 2HXCA 3JPXA 4JXMA 1UTCA 3VI3A 2IAAA 1U4CA 1N6FA 3RMZD 3IUMA 1U8CA 3SN6B 3EI1A 3VH0A 5H17A 1QNIA 4RE6A 3T3PA 2B5LA 3L4MD 4CI8A 2PBIB 4O9DA 3UVNA 1UOPA 2YNNA 4ES0A 1P22A 4FAVD 3ULEC 1UOQA 2HU5A 3K27A 2P9LC 3VA6A 4ZOXA 3U4YA 3T3MA 3QI0A 2VDLA 4HDJA 5KDOB 2IURA 2AH0A 4Y5RD 3EQ8A 4AN0A 2O9KA 3I2NA 4J77A 4FWWA 5FKSA 3SWSD 4AX4A 4GMBA 3RFHA 4G1MA 3IJCA 4A09A 2AGZA 2BCJB 3RN0D 3I8CA 4JSVC 3JZNA 1B9XA 2XL3A 4I79A 3EI2B 4ERYA 4L9OA 4JD2C 4O3TB 1MDAH 5AJAA 1XHMA 2OJYA 5EARA 1L0QA 1B9YA 2H47A 5CXBB 2IUVA 2IWKA 5C2WB 3ODTA 5CYKB 4ESGA 1OLZA 5E6SA 3UVMA 4E5ZB 3EI4A 3DDUA 4CY1A 4ZN4A 3L4OD 1PGUA 2HKMA 3N0EA 4BL0A 4D9SA 4JSPC 5C92A 4MMZA 3SCYA 2XE4A 1JMZB 2PM9B 5I5JA 3P4FA 5IGQA 2IUQA 3QHYB 5HE1B 5M61A 4WK2A 2XU7A 3PXWD 2CN3A 4O02A 3K6SA 3OF7A 3MZLA 4J81A 5K1CC 2PM7B 2XL2A 3ORVD 2BKLA 3SLED 4O2WA 2EBSA 5EM2B 1VE6A 4AMZA 3J80g 1GP2B 3NIGA 3O4IA 5B4WA 4GGAA 2CNXA 3DXMC 1JJUB 4A0BB 2H9LA 2HYEA 4BUJC 4ZOYA 3ZDZA 1VZ3A 3V7DB 2BBKH 3OW8A 3NVNA 3SMRA 3SHFA 4ERQA 4PC0A 4CZVA 3E0CA 4GQ1A 5C86A 3I7PA 3V9FA 2W18A 1JOFA 2GNQA 2VDOA 5EMLB 4BP9A 3RFGA 1A0RB 3DSMA 4FA1D 5THAA 2PM9A 3C5MA 3CIKB 3EG6A 4J73A 4X63B 4AN1A 1S4UX 3O4HA 5GMKn 4OWRA 4UM9A 2H6KA 5AFU3 4NSXA 5FKQA 3JAMg 4L3HD 5HE2B 4Z8LA 2P9IC 2AQ5A 2HJBA 4D0KA 1PBYB 5FQDA 3PXSD 4OZUA 4XYIA 2QC5A 2B5NA 2I0RA 5EMKB 2HU8A 1JV2A 2IUPA 5H1MA 4R7AB 2CO0C 4X60B 5HDBA 4A0AA 2I0SA 3RSEC 3UVLA 4QAMA 3FCSA 4RE5A 2H13A 2B5MA 5M5VA 3UVKA 3F3FA 2YMUA 2HU7A 4CY5A 4U1EI 3BG1A 2VDQA 4PSWB 4J0XA 5FFGA 2VDKA 5GSAA 5GXHA 3AH8B 3V4PA 2CE8A 4PSXB 5IJ8E 4K3JB 3FRXA 3V5WB 4CI3A 4PNKB 2AGWA 4O1QD 5H14A 1GOFA 4Z7OA 5M5UA 4G55A 4A7JA 2MTAH 3F3PA 3UKRC 3OKWA 4CY3A 3VI4A 5JWZA 4CI1A 1TYQC 2HKRA 3B7FA 3UR4A 5EMJB 2CO0A 3IUNA 3DXKC 2HESX 3IURA 4J87A 4NBMA 5SXMA 2PM6B 3OKYB 4J79A 1XKSA 2OK4A 5FA5B 1O6FA 3A0FA 4FA4D 2G99A 2XZGA 3CFVA 3NVXA 5EALA 1JMXB 2H6QA 3BWSA 1K32A 2QXVA 4H5JA 3PSCB 3GFCA 4DNUA 4A09B 2YNOA 4A11B 2EIEA 2VZ1A 2H14A 4GGDA 3SJLD 2QR5A 2EIBA 5C9ZB 4NC4A 1N6DA 4JT5C 1O6GA 5FXYA 4FA5D 4FAND 5A2Qg 4E54A 4JT6C 2VC2A 4JHNA 3O4JA 4WK4A 4QRJA 4JHPC 3AFCA 3RN1D 1H2XA 1E8NA 3AL8A 2XDWA 2AGXA 2QZPA 2YNPA 1L5GA 1GOGA 2H6NA 2OIZA 4Z7QA 3SBQA 1VZ2A 4CY2A 4KFMB 4GQBB 4AEZA 4CC9A 4FB1D 5HE0B 3SBRA 1E5TA 1K8KC 3FGBA 3I7KA 4CI2A 3F3GA 2VDMA 1TBGA 3VGZA 3MVDK 3KRWB 5IC7A 4CZXA 4H5IA 3RLMD 3I8EA 4Y7RA 3IULA 4X3EA 4MMXA 1RI6A 2H3XA 4JSNC 3ZWLB 4Z7NA 5EMMB 3IJ0A 3KRXB 3SFZA 5FKRA 1H2ZA 2B4EA 1R5MA 1GOHA 4DNVA 3AL8B 3V4VA 4BCDA 3PVWB 4A11A 2IWFA 4PBYA 5FLXg 1NEXB 4XEIC 2J55H 2UZYB 2H9MA 4J0WA 2AH1A 5EM2A 3SBPA 4AMYA 1M1XA 3K72A 4IA9A 2WQ8A 3OL2B 4ERZA 3I7LA 4GM8A 3IIWA 1K3IA 5TDHB 1NR0A 5I5IA 4GQ2P 1H2WA 1U2VC 3ZDYA 4WK0A 2P9NC 5C2VB 5IGOA 4A2MA 3MUNA 2Z2PA 5IJ7E 4A0AB 1VYHC 4J8GA 5EAPA 1SQJA 2AGLA 3FM0A 3ZDXA 1GOTB 3EQ9A 3JROA 4AOWA 3CFSB 3AL9A 2G9AA 4QL1A 4ZOVA 4N14A 2Z2NA 1FWXA 2GC4A 2I0TA 3O4GA 2J57G 2P9PC 5M5TA 2J56H 2XYIA 4FHLA 3IIYA 3K26A 3I7HA 4MMYA 5HYNB 1SQ9A 4LGNA 2OVQB 3IUQA 2VDNA 4U7AA 4TZ4A 3K71A 3UVOA 4J8BA 3JZGA 3C9CA 3I7OA 3FCUA 4J84A 4NENA 4UI9R 3JB9L 3BG0A 1I2MB 5CXCB 2EIDA 3EI3A 5IT9g 1SHYB 4NAAA 1GXRA 5K19A 4BH6A 2YBAA 1GG2B 4PBZA 2CN2A 3ZE2A 3MMYA 3IUJA 4BCBA 3OTTA 4LG8A 5FKTA 3PSLA 2OVRB 3NVQA 4JSXC 5EAMA 4EWRA 4MK0B 2TRCB 4QT8A 4L1QD 3DM0A 3EU7A 1ERJA 1XIPA 3I89A 2OVPB 2VZ3A 3GD1I 3W15A 2VDPA 1MG3A 5CYKA 3C75H 3OKYA 2OK6A 3EI4B 4ZOZA 3I7NA 3EWEA 4FA9D 1QFSA 2GC7A 1T2XA 3MZKA 3NIDA 2P9SC 3ZE1A 1UOOA 3NIFA 5AMSA 3EMHA 3RRMC 1JTDB 1OMWB 2EICA 3PXTD 5CXCA 5TF2A 4GM9A 1PI6A 4X61B 4YVDA 4A0BA 5E6UA 2UZXB 1H2YA 2Z2OA 3JZHA 4GGCA 5TEFA 2AGYA 1YR2A 1C9LA 3EQ7A 4E54B 1Q47A 3SXTD 4CZYA 4G56B 4A08A 3IJ1A 1PEVA 4IMMA 5I5MA 2Q7QA 1VE7A 3HFQA 2H68A 1BPOA 2H9NA
chains in the Genus database with same CATH topology
3JRPA 3EI3B 4GZ8A 5TEEA 4L3GD 1MG2A 4K3ID 3J81g 2H9PA 4GM3A 5HQGA 3MKQA 4D6VA 4O3UB 1N6EA 5HE3B 3EI2A 3OL2A 3EI1B 2I3SA 3MKSB 2CE9A 3SVWD 3PE7A 4J82A 2I3TA 3PVUB 3UKUC 4A08B 4O45A 3C99A 5GXIA 3N0DA 3GREA 4J78A 2P9KC 1YFQA 2P9UC 4QQEA 3IKOA 5CXBA 4PXWA 2YB8B 4E5ZA 3MXXA 2HJ4A 4J86A 4A2LA 4XYHA 4LG9A 3DWLC 3OKTA 2HXCA 4JXMA 3JPXA 2IAAA 1U4CA 1N6FA 3RMZD 3SN6B 3EI1A 3VH0A 5H17A 1QNIA 2B5LA 3L4MD 4CI8A 2PBIB 4O9DA 3UVNA 2YNNA 4ES0A 1P22A 4FAVD 3ULEC 3K27A 2P9LC 3VA6A 4ZOXA 3U4YA 4HDJA 5KDOB 2IURA 2AH0A 4Y5RD 2O9KA 3I2NA 4J77A 4FWWA 5FKSA 3SWSD 4GMBA 3RFHA 3IJCA 4A09A 2AGZA 2BCJB 3RN0D 3I8CA 4JSVC 3JZNA 1B9XA 2XL3A 4I79A 3EI2B 4ERYA 4L9OA 4JD2C 4O3TB 1MDAH 5AJAA 1XHMA 2OJYA 5EARA 1L0QA 1B9YA 2H47A 5CXBB 2IUVA 2IWKA 5C2WB 3ODTA 5CYKB 4ESGA 1OLZA 3UVMA 4E5ZB 3EI4A 4CY1A 4ZN4A 3L4OD 1PGUA 2HKMA 3N0EA 4BL0A 4JSPC 3SCYA 1JMZB 2PM9B 5I5JA 3P4FA 5IGQA 2IUQA 5HE1B 2XU7A 3PXWD 2CN3A 3MZLA 4J81A 5K1CC 2PM7B 2XL2A 3ORVD 3SLED 2EBSA 5EM2B 3J80g 1GP2B 5B4WA 4GGAA 2CNXA 3DXMC 1JJUB 4A0BB 2H9LA 2HYEA 4BUJC 4ZOYA 3V7DB 2BBKH 3OW8A 3NVNA 3SMRA 3SHFA 4ERQA 4PC0A 4CZVA 3E0CA 4GQ1A 3I7PA 3V9FA 2W18A 1JOFA 2GNQA 5EMLB 3RFGA 1A0RB 3DSMA 4FA1D 5THAA 2PM9A 3C5MA 3CIKB 3EG6A 4J73A 4X63B 1S4UX 5GMKn 4OWRA 2H6KA 5AFU3 4NSXA 5FKQA 3JAMg 4L3HD 5HE2B 4Z8LA 2P9IC 2AQ5A 2HJBA 4D0KA 1PBYB 5FQDA 3PXSD 4OZUA 4XYIA 2QC5A 2B5NA 2I0RA 5EMKB 2IUPA 5H1MA 4R7AB 2CO0C 4X60B 4A0AA 2I0SA 3RSEC 3UVLA 2H13A 2B5MA 3UVKA 3F3FA 2YMUA 4CY5A 4U1EI 3BG1A 4PSWB 4J0XA 5GSAA 5GXHA 3AH8B 2CE8A 4PSXB 5IJ8E 4K3JB 3FRXA 3V5WB 4CI3A 4PNKB 2AGWA 4O1QD 5H14A 4A7JA 2MTAH 3F3PA 3UKRC 3OKWA 4CY3A 5JWZA 4CI1A 1TYQC 2HKRA 3B7FA 3UR4A 5EMJB 2CO0A 3DXKC 2HESX 4J87A 5SXMA 2PM6B 3OKYB 4J79A 1XKSA 2OK4A 5FA5B 3A0FA 4FA4D 2G99A 3CFVA 3NVXA 5EALA 1JMXB 2H6QA 3BWSA 1K32A 2QXVA 4H5JA 3PSCB 3GFCA 4A09B 2YNOA 4A11B 2H14A 4GGDA 3SJLD 5C9ZB 1N6DA 4JT5C 5FXYA 4FA5D 4FAND 5A2Qg 4E54A 4JT6C 4QRJA 3AFCA 3RN1D 3AL8A 2AGXA 2YNPA 2H6NA 2OIZA 3SBQA 4CY2A 4KFMB 4GQBB 4AEZA 4CC9A 4FB1D 5HE0B 3SBRA 1K8KC 3FGBA 3I7KA 4CI2A 3F3GA 1TBGA 3VGZA 3KRWB 5IC7A 4CZXA 4H5IA 3RLMD 3I8EA 4Y7RA 4X3EA 1RI6A 2H3XA 4JSNC 3ZWLB 5EMMB 3IJ0A 3KRXB 3SFZA 5FKRA 2B4EA 1R5MA 3AL8B 3PVWB 4A11A 2IWFA 4PBYA 5FLXg 1NEXB 4XEIC 2J55H 2UZYB 2H9MA 4J0WA 2AH1A 5EM2A 3SBPA 4ERZA 4IA9A 3OL2B 3I7LA 4GM8A 3IIWA 5TDHB 1NR0A 5I5IA 4GQ2P 1U2VC 2P9NC 5C2VB 5IGOA 4A2MA 2Z2PA 5IJ7E 4A0AB 1VYHC 4J8GA 5EAPA 1SQJA 2AGLA 3FM0A 1GOTB 3JROA 4AOWA 3CFSB 3AL9A 2G9AA 4QL1A 4ZOVA 4N14A 2Z2NA 1FWXA 2GC4A 2I0TA 2J57G 2P9PC 2J56H 2XYIA 4FHLA 3IIYA 3K26A 3I7HA 5HYNB 1SQ9A 4LGNA 2OVQB 4U7AA 4TZ4A 3UVOA 4J8BA 3JZGA 3C9CA 3I7OA 4J84A 4UI9R 3JB9L 3BG0A 5CXCB 3EI3A 5IT9g 1SHYB 1GXRA 5K19A 4BH6A 2YBAA 1GG2B 4PBZA 2CN2A 3MMYA 3OTTA 4LG8A 5FKTA 3PSLA 2OVRB 3NVQA 4JSXC 5EAMA 4EWRA 4MK0B 2TRCB 4QT8A 4L1QD 3DM0A 3EU7A 1ERJA 1XIPA 3I89A 2OVPB 3W15A 1MG3A 5CYKA 3C75H 3OKYA 2OK6A 3EI4B 4ZOZA 3I7NA 3EWEA 4FA9D 2GC7A 3MZKA 2P9SC 5AMSA 3EMHA 3RRMC 1OMWB 5CXCA 3PXTD 5TF2A 4GM9A 1PI6A 4X61B 4YVDA 4A0BA 2UZXB 5TEFA 2Z2OA 3JZHA 4GGCA 2AGYA 4E54B 1Q47A 3SXTD 4CZYA 4G56B 4A08A 3IJ1A 1PEVA 4IMMA 5I5MA 2Q7QA 3HFQA 2H68A 2H9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRP A;  3EI3 B;  4GZ8 A;  5TEE A;  4L3G D;  1MG2 A;  4K3I D;  3J81 g;  2H9P A;  4GM3 A;  5HQG A;  3MKQ A;  4D6V A;  4O3U B;  1N6E A;  5HE3 B;  3EI2 A;  3OL2 A;  3EI1 B;  2I3S A;  3MKS B;  2CE9 A;  3SVW D;  3PE7 A;  4J82 A;  2I3T A;  3PVU B;  3UKU C;  4A08 B;  4O45 A;  3C99 A;  5GXI A;  3N0D A;  3GRE A;  4J78 A;  2P9K C;  1YFQ A;  2P9U C;  4QQE A;  3IKO A;  5CXB A;  4PXW A;  2YB8 B;  4E5Z A;  3MXX A;  2HJ4 A;  4J86 A;  4A2L A;  4XYH A;  4LG9 A;  3DWL C;  3OKT A;  2HXC A;  4JXM A;  3JPX A;  2IAA A;  1U4C A;  1N6F A;  3RMZ D;  3SN6 B;  3EI1 A;  3VH0 A;  5H17 A;  1QNI A;  2B5L A;  3L4M D;  4CI8 A;  2PBI B;  4O9D A;  3UVN A;  2YNN A;  4ES0 A;  1P22 A;  4FAV D;  3ULE C;  3K27 A;  2P9L C;  3VA6 A;  4ZOX A;  3U4Y A;  4HDJ A;  5KDO B;  2IUR A;  2AH0 A;  4Y5R D;  2O9K A;  3I2N A;  4J77 A;  4FWW A;  5FKS A;  3SWS D;  4GMB A;  3RFH A;  3IJC A;  4A09 A;  2AGZ A;  2BCJ B;  3RN0 D;  3I8C A;  4JSV C;  3JZN A;  1B9X A;  2XL3 A;  4I79 A;  3EI2 B;  4ERY A;  4L9O A;  4JD2 C;  4O3T B;  1MDA H;  5AJA A;  1XHM A;  2OJY A;  5EAR A;  1L0Q A;  1B9Y A;  2H47 A;  5CXB B;  2IUV A;  2IWK A;  5C2W B;  3ODT A;  5CYK B;  4ESG A;  1OLZ A;  3UVM A;  4E5Z B;  3EI4 A;  4CY1 A;  4ZN4 A;  3L4O D;  1PGU A;  2HKM A;  3N0E A;  4BL0 A;  4JSP C;  3SCY A;  1JMZ B;  2PM9 B;  5I5J A;  3P4F A;  5IGQ A;  2IUQ A;  5HE1 B;  2XU7 A;  3PXW D;  2CN3 A;  3MZL A;  4J81 A;  5K1C C;  2PM7 B;  2XL2 A;  3ORV D;  3SLE D;  2EBS A;  5EM2 B;  3J80 g;  1GP2 B;  5B4W A;  4GGA A;  2CNX A;  3DXM C;  1JJU B;  4A0B B;  2H9L A;  2HYE A;  4BUJ C;  4ZOY A;  3V7D B;  2BBK H;  3OW8 A;  3NVN A;  3SMR A;  3SHF A;  4ERQ A;  4PC0 A;  4CZV A;  3E0C A;  4GQ1 A;  3I7P A;  3V9F A;  2W18 A;  1JOF A;  2GNQ A;  5EML B;  3RFG A;  1A0R B;  3DSM A;  4FA1 D;  5THA A;  2PM9 A;  3C5M A;  3CIK B;  3EG6 A;  4J73 A;  4X63 B;  1S4U X;  5GMK n;  4OWR A;  2H6K A;  5AFU 3;  4NSX A;  5FKQ A;  3JAM g;  4L3H D;  5HE2 B;  4Z8L A;  2P9I C;  2AQ5 A;  2HJB A;  4D0K A;  1PBY B;  5FQD A;  3PXS D;  4OZU A;  4XYI A;  2QC5 A;  2B5N A;  2I0R A;  5EMK B;  2IUP A;  5H1M A;  4R7A B;  2CO0 C;  4X60 B;  4A0A A;  2I0S A;  3RSE C;  3UVL A;  2H13 A;  2B5M A;  3UVK A;  3F3F A;  2YMU A;  4CY5 A;  4U1E I;  3BG1 A;  4PSW B;  4J0X A;  5GSA A;  5GXH A;  3AH8 B;  2CE8 A;  4PSX B;  5IJ8 E;  4K3J B;  3FRX A;  3V5W B;  4CI3 A;  4PNK B;  2AGW A;  4O1Q D;  5H14 A;  4A7J A;  2MTA H;  3F3P A;  3UKR C;  3OKW A;  4CY3 A;  5JWZ A;  4CI1 A;  1TYQ C;  2HKR A;  3B7F A;  3UR4 A;  5EMJ B;  2CO0 A;  3DXK C;  2HES X;  4J87 A;  5SXM A;  2PM6 B;  3OKY B;  4J79 A;  1XKS A;  2OK4 A;  5FA5 B;  3A0F A;  4FA4 D;  2G99 A;  3CFV A;  3NVX A;  5EAL A;  1JMX B;  2H6Q A;  3BWS A;  1K32 A;  2QXV A;  4H5J A;  3PSC B;  3GFC A;  4A09 B;  2YNO A;  4A11 B;  2H14 A;  4GGD A;  3SJL D;  5C9Z B;  1N6D A;  4JT5 C;  5FXY A;  4FA5 D;  4FAN D;  5A2Q g;  4E54 A;  4JT6 C;  4QRJ A;  3AFC A;  3RN1 D;  3AL8 A;  2AGX A;  2YNP A;  2H6N A;  2OIZ A;  3SBQ A;  4CY2 A;  4KFM B;  4GQB B;  4AEZ A;  4CC9 A;  4FB1 D;  5HE0 B;  3SBR A;  1K8K C;  3FGB A;  3I7K A;  4CI2 A;  3F3G A;  1TBG A;  3VGZ A;  3KRW B;  5IC7 A;  4CZX A;  4H5I A;  3RLM D;  3I8E A;  4Y7R A;  4X3E A;  1RI6 A;  2H3X A;  4JSN C;  3ZWL B;  5EMM B;  3IJ0 A;  3KRX B;  3SFZ A;  5FKR A;  2B4E A;  1R5M A;  3AL8 B;  3PVW B;  4A11 A;  2IWF A;  4PBY A;  5FLX g;  1NEX B;  4XEI C;  2J55 H;  2UZY B;  2H9M A;  4J0W A;  2AH1 A;  5EM2 A;  3SBP A;  4ERZ A;  4IA9 A;  3OL2 B;  3I7L A;  4GM8 A;  3IIW A;  5TDH B;  1NR0 A;  5I5I A;  4GQ2 P;  1U2V C;  2P9N C;  5C2V B;  5IGO A;  4A2M A;  2Z2P A;  5IJ7 E;  4A0A B;  1VYH C;  4J8G A;  5EAP A;  1SQJ A;  2AGL A;  3FM0 A;  1GOT B;  3JRO A;  4AOW A;  3CFS B;  3AL9 A;  2G9A A;  4QL1 A;  4ZOV A;  4N14 A;  2Z2N A;  1FWX A;  2GC4 A;  2I0T A;  2J57 G;  2P9P C;  2J56 H;  2XYI A;  4FHL A;  3IIY A;  3K26 A;  3I7H A;  5HYN B;  1SQ9 A;  4LGN A;  2OVQ B;  4U7A A;  4TZ4 A;  3UVO A;  4J8B A;  3JZG A;  3C9C A;  3I7O A;  4J84 A;  4UI9 R;  3JB9 L;  3BG0 A;  5CXC B;  3EI3 A;  5IT9 g;  1SHY B;  1GXR A;  5K19 A;  4BH6 A;  2YBA A;  1GG2 B;  4PBZ A;  2CN2 A;  3MMY A;  3OTT A;  4LG8 A;  5FKT A;  3PSL A;  2OVR B;  3NVQ A;  4JSX C;  5EAM A;  4EWR A;  4MK0 B;  2TRC B;  4QT8 A;  4L1Q D;  3DM0 A;  3EU7 A;  1ERJ A;  1XIP A;  3I89 A;  2OVP B;  3W15 A;  1MG3 A;  5CYK A;  3C75 H;  3OKY A;  2OK6 A;  3EI4 B;  4ZOZ A;  3I7N A;  3EWE A;  4FA9 D;  2GC7 A;  3MZK A;  2P9S C;  5AMS A;  3EMH A;  3RRM C;  1OMW B;  5CXC A;  3PXT D;  5TF2 A;  4GM9 A;  1PI6 A;  4X61 B;  4YVD A;  4A0B A;  2UZX B;  5TEF A;  2Z2O A;  3JZH A;  4GGC A;  2AGY A;  4E54 B;  1Q47 A;  3SXT D;  4CZY A;  4G56 B;  4A08 A;  3IJ1 A;  1PEV A;  4IMM A;  5I5M A;  2Q7Q A;  3HFQ A;  2H68 A;  2H9N A; 
#chains in the Genus database with same CATH topology
 3JRP A;  3EI3 B;  4DNW A;  4GZ8 A;  5TEE A;  4WJK A;  1QFM A;  3ZE0 A;  4L3G D;  1MG2 A;  4K3I D;  3J81 g;  2H9P A;  4GM3 A;  3MUO A;  5HQG A;  3MKQ A;  4D6V A;  4O3U B;  1N6E A;  5HE3 B;  3IVM A;  1TYE A;  4IRZ A;  3EI2 A;  3OL2 A;  3EI1 B;  2I3S A;  4L1M A;  1A12 A;  3MKS B;  4G1E A;  3KCI A;  2CE9 A;  3SVW D;  5M5R A;  3PE7 A;  5FFO A;  4J82 A;  2I3T A;  3PVU B;  3UKU C;  4BCC A;  4A08 B;  4BP8 A;  4O45 A;  3C99 A;  5GXI A;  3N0D A;  3GRE A;  4J78 A;  2P9K C;  1YFQ A;  2P9U C;  4QQE A;  1C9I A;  2JKX A;  3IKO A;  4UM8 A;  5CXB A;  4PXW A;  2VDR A;  2YB8 B;  4E5Z A;  3GC3 B;  3MXX A;  2HJ4 A;  4J86 A;  4A2L A;  4XYH A;  4LG9 A;  3IJE A;  3DWL C;  5E6R A;  5M5S A;  3OKT A;  1E8M A;  2HXC A;  3JPX A;  4JXM A;  1UTC A;  3VI3 A;  2IAA A;  1U4C A;  1N6F A;  3RMZ D;  3IUM A;  1U8C A;  3SN6 B;  3EI1 A;  3VH0 A;  5H17 A;  1QNI A;  4RE6 A;  3T3P A;  2B5L A;  3L4M D;  4CI8 A;  2PBI B;  4O9D A;  3UVN A;  1UOP A;  2YNN A;  4ES0 A;  1P22 A;  4FAV D;  3ULE C;  1UOQ A;  2HU5 A;  3K27 A;  2P9L C;  3VA6 A;  4ZOX A;  3U4Y A;  3T3M A;  3QI0 A;  2VDL A;  4HDJ A;  5KDO B;  2IUR A;  2AH0 A;  4Y5R D;  3EQ8 A;  4AN0 A;  2O9K A;  3I2N A;  4J77 A;  4FWW A;  5FKS A;  3SWS D;  4AX4 A;  4GMB A;  3RFH A;  4G1M A;  3IJC A;  4A09 A;  2AGZ A;  2BCJ B;  3RN0 D;  3I8C A;  4JSV C;  3JZN A;  1B9X A;  2XL3 A;  4I79 A;  3EI2 B;  4ERY A;  4L9O A;  4JD2 C;  4O3T B;  1MDA H;  5AJA A;  1XHM A;  2OJY A;  5EAR A;  1L0Q A;  1B9Y A;  2H47 A;  5CXB B;  2IUV A;  2IWK A;  5C2W B;  3ODT A;  5CYK B;  4ESG A;  1OLZ A;  5E6S A;  3UVM A;  4E5Z B;  3EI4 A;  3DDU A;  4CY1 A;  4ZN4 A;  3L4O D;  1PGU A;  2HKM A;  3N0E A;  4BL0 A;  4D9S A;  4JSP C;  5C92 A;  4MMZ A;  3SCY A;  2XE4 A;  1JMZ B;  2PM9 B;  5I5J A;  3P4F A;  5IGQ A;  2IUQ A;  3QHY B;  5HE1 B;  5M61 A;  4WK2 A;  2XU7 A;  3PXW D;  2CN3 A;  4O02 A;  3K6S A;  3OF7 A;  3MZL A;  4J81 A;  5K1C C;  2PM7 B;  2XL2 A;  3ORV D;  2BKL A;  3SLE D;  4O2W A;  2EBS A;  5EM2 B;  1VE6 A;  4AMZ A;  3J80 g;  1GP2 B;  3NIG A;  3O4I A;  5B4W A;  4GGA A;  2CNX A;  3DXM C;  1JJU B;  4A0B B;  2H9L A;  2HYE A;  4BUJ C;  4ZOY A;  3ZDZ A;  1VZ3 A;  3V7D B;  2BBK H;  3OW8 A;  3NVN A;  3SMR A;  3SHF A;  4ERQ A;  4PC0 A;  4CZV A;  3E0C A;  4GQ1 A;  5C86 A;  3I7P A;  3V9F A;  2W18 A;  1JOF A;  2GNQ A;  2VDO A;  5EML B;  4BP9 A;  3RFG A;  1A0R B;  3DSM A;  4FA1 D;  5THA A;  2PM9 A;  3C5M A;  3CIK B;  3EG6 A;  4J73 A;  4X63 B;  4AN1 A;  1S4U X;  3O4H A;  5GMK n;  4OWR A;  4UM9 A;  2H6K A;  5AFU 3;  4NSX A;  5FKQ A;  3JAM g;  4L3H D;  5HE2 B;  4Z8L A;  2P9I C;  2AQ5 A;  2HJB A;  4D0K A;  1PBY B;  5FQD A;  3PXS D;  4OZU A;  4XYI A;  2QC5 A;  2B5N A;  2I0R A;  5EMK B;  2HU8 A;  1JV2 A;  2IUP A;  5H1M A;  4R7A B;  2CO0 C;  4X60 B;  5HDB A;  4A0A A;  2I0S A;  3RSE C;  3UVL A;  4QAM A;  3FCS A;  4RE5 A;  2H13 A;  2B5M A;  5M5V A;  3UVK A;  3F3F A;  2YMU A;  2HU7 A;  4CY5 A;  4U1E I;  3BG1 A;  2VDQ A;  4PSW B;  4J0X A;  5FFG A;  2VDK A;  5GSA A;  5GXH A;  3AH8 B;  3V4P A;  2CE8 A;  4PSX B;  5IJ8 E;  4K3J B;  3FRX A;  3V5W B;  4CI3 A;  4PNK B;  2AGW A;  4O1Q D;  5H14 A;  1GOF A;  4Z7O A;  5M5U A;  4G55 A;  4A7J A;  2MTA H;  3F3P A;  3UKR C;  3OKW A;  4CY3 A;  3VI4 A;  5JWZ A;  4CI1 A;  1TYQ C;  2HKR A;  3B7F A;  3UR4 A;  5EMJ B;  2CO0 A;  3IUN A;  3DXK C;  2HES X;  3IUR A;  4J87 A;  4NBM A;  5SXM A;  2PM6 B;  3OKY B;  4J79 A;  1XKS A;  2OK4 A;  5FA5 B;  1O6F A;  3A0F A;  4FA4 D;  2G99 A;  2XZG A;  3CFV A;  3NVX A;  5EAL A;  1JMX B;  2H6Q A;  3BWS A;  1K32 A;  2QXV A;  4H5J A;  3PSC B;  3GFC A;  4DNU A;  4A09 B;  2YNO A;  4A11 B;  2EIE A;  2VZ1 A;  2H14 A;  4GGD A;  3SJL D;  2QR5 A;  2EIB A;  5C9Z B;  4NC4 A;  1N6D A;  4JT5 C;  1O6G A;  5FXY A;  4FA5 D;  4FAN D;  5A2Q g;  4E54 A;  4JT6 C;  2VC2 A;  4JHN A;  3O4J A;  4WK4 A;  4QRJ A;  4JHP C;  3AFC A;  3RN1 D;  1H2X A;  1E8N A;  3AL8 A;  2XDW A;  2AGX A;  2QZP A;  2YNP A;  1L5G A;  1GOG A;  2H6N A;  2OIZ A;  4Z7Q A;  3SBQ A;  1VZ2 A;  4CY2 A;  4KFM B;  4GQB B;  4AEZ A;  4CC9 A;  4FB1 D;  5HE0 B;  3SBR A;  1E5T A;  1K8K C;  3FGB A;  3I7K A;  4CI2 A;  3F3G A;  2VDM A;  1TBG A;  3VGZ A;  3MVD K;  3KRW B;  5IC7 A;  4CZX A;  4H5I A;  3RLM D;  3I8E A;  4Y7R A;  3IUL A;  4X3E A;  4MMX A;  1RI6 A;  2H3X A;  4JSN C;  3ZWL B;  4Z7N A;  5EMM B;  3IJ0 A;  3KRX B;  3SFZ A;  5FKR A;  1H2Z A;  2B4E A;  1R5M A;  1GOH A;  4DNV A;  3AL8 B;  3V4V A;  4BCD A;  3PVW B;  4A11 A;  2IWF A;  4PBY A;  5FLX g;  1NEX B;  4XEI C;  2J55 H;  2UZY B;  2H9M A;  4J0W A;  2AH1 A;  5EM2 A;  3SBP A;  4AMY A;  1M1X A;  3K72 A;  4IA9 A;  2WQ8 A;  3OL2 B;  4ERZ A;  3I7L A;  4GM8 A;  3IIW A;  1K3I A;  5TDH B;  1NR0 A;  5I5I A;  4GQ2 P;  1H2W A;  1U2V C;  3ZDY A;  4WK0 A;  2P9N C;  5C2V B;  5IGO A;  4A2M A;  3MUN A;  2Z2P A;  5IJ7 E;  4A0A B;  1VYH C;  4J8G A;  5EAP A;  1SQJ A;  2AGL A;  3FM0 A;  3ZDX A;  1GOT B;  3EQ9 A;  3JRO A;  4AOW A;  3CFS B;  3AL9 A;  2G9A A;  4QL1 A;  4ZOV A;  4N14 A;  2Z2N A;  1FWX A;  2GC4 A;  2I0T A;  3O4G A;  2J57 G;  2P9P C;  5M5T A;  2J56 H;  2XYI A;  4FHL A;  3IIY A;  3K26 A;  3I7H A;  4MMY A;  5HYN B;  1SQ9 A;  4LGN A;  2OVQ B;  3IUQ A;  2VDN A;  4U7A A;  4TZ4 A;  3K71 A;  3UVO A;  4J8B A;  3JZG A;  3C9C A;  3I7O A;  3FCU A;  4J84 A;  4NEN A;  4UI9 R;  3JB9 L;  3BG0 A;  1I2M B;  5CXC B;  2EID A;  3EI3 A;  5IT9 g;  1SHY B;  4NAA A;  1GXR A;  5K19 A;  4BH6 A;  2YBA A;  1GG2 B;  4PBZ A;  2CN2 A;  3ZE2 A;  3MMY A;  3IUJ A;  4BCB A;  3OTT A;  4LG8 A;  5FKT A;  3PSL A;  2OVR B;  3NVQ A;  4JSX C;  5EAM A;  4EWR A;  4MK0 B;  2TRC B;  4QT8 A;  4L1Q D;  3DM0 A;  3EU7 A;  1ERJ A;  1XIP A;  3I89 A;  2OVP B;  2VZ3 A;  3GD1 I;  3W15 A;  2VDP A;  1MG3 A;  5CYK A;  3C75 H;  3OKY A;  2OK6 A;  3EI4 B;  4ZOZ A;  3I7N A;  3EWE A;  4FA9 D;  1QFS A;  2GC7 A;  1T2X A;  3MZK A;  3NID A;  2P9S C;  3ZE1 A;  1UOO A;  3NIF A;  5AMS A;  3EMH A;  3RRM C;  1JTD B;  1OMW B;  2EIC A;  3PXT D;  5CXC A;  5TF2 A;  4GM9 A;  1PI6 A;  4X61 B;  4YVD A;  4A0B A;  5E6U A;  2UZX B;  1H2Y A;  2Z2O A;  3JZH A;  4GGC A;  5TEF A;  2AGY A;  1YR2 A;  1C9L A;  3EQ7 A;  4E54 B;  1Q47 A;  3SXT D;  4CZY A;  4G56 B;  4A08 A;  3IJ1 A;  1PEV A;  4IMM A;  5I5M A;  2Q7Q A;  1VE7 A;  3HFQ A;  2H68 A;  1BPO A;  2H9N A; 
#chains in the Genus database with same CATH homology
 3JRP A;  3EI3 B;  4GZ8 A;  5TEE A;  4L3G D;  1MG2 A;  4K3I D;  3J81 g;  2H9P A;  4GM3 A;  5HQG A;  3MKQ A;  4D6V A;  4O3U B;  1N6E A;  5HE3 B;  3EI2 A;  3OL2 A;  3EI1 B;  2I3S A;  3MKS B;  2CE9 A;  3SVW D;  3PE7 A;  4J82 A;  2I3T A;  3PVU B;  3UKU C;  4A08 B;  4O45 A;  3C99 A;  5GXI A;  3N0D A;  3GRE A;  4J78 A;  2P9K C;  1YFQ A;  2P9U C;  4QQE A;  3IKO A;  5CXB A;  4PXW A;  2YB8 B;  4E5Z A;  3MXX A;  2HJ4 A;  4J86 A;  4A2L A;  4XYH A;  4LG9 A;  3DWL C;  3OKT A;  2HXC A;  4JXM A;  3JPX A;  2IAA A;  1U4C A;  1N6F A;  3RMZ D;  3SN6 B;  3EI1 A;  3VH0 A;  5H17 A;  1QNI A;  2B5L A;  3L4M D;  4CI8 A;  2PBI B;  4O9D A;  3UVN A;  2YNN A;  4ES0 A;  1P22 A;  4FAV D;  3ULE C;  3K27 A;  2P9L C;  3VA6 A;  4ZOX A;  3U4Y A;  4HDJ A;  5KDO B;  2IUR A;  2AH0 A;  4Y5R D;  2O9K A;  3I2N A;  4J77 A;  4FWW A;  5FKS A;  3SWS D;  4GMB A;  3RFH A;  3IJC A;  4A09 A;  2AGZ A;  2BCJ B;  3RN0 D;  3I8C A;  4JSV C;  3JZN A;  1B9X A;  2XL3 A;  4I79 A;  3EI2 B;  4ERY A;  4L9O A;  4JD2 C;  4O3T B;  1MDA H;  5AJA A;  1XHM A;  2OJY A;  5EAR A;  1L0Q A;  1B9Y A;  2H47 A;  5CXB B;  2IUV A;  2IWK A;  5C2W B;  3ODT A;  5CYK B;  4ESG A;  1OLZ A;  3UVM A;  4E5Z B;  3EI4 A;  4CY1 A;  4ZN4 A;  3L4O D;  1PGU A;  2HKM A;  3N0E A;  4BL0 A;  4JSP C;  3SCY A;  1JMZ B;  2PM9 B;  5I5J A;  3P4F A;  5IGQ A;  2IUQ A;  5HE1 B;  2XU7 A;  3PXW D;  2CN3 A;  3MZL A;  4J81 A;  5K1C C;  2PM7 B;  2XL2 A;  3ORV D;  3SLE D;  2EBS A;  5EM2 B;  3J80 g;  1GP2 B;  5B4W A;  4GGA A;  2CNX A;  3DXM C;  1JJU B;  4A0B B;  2H9L A;  2HYE A;  4BUJ C;  4ZOY A;  3V7D B;  2BBK H;  3OW8 A;  3NVN A;  3SMR A;  3SHF A;  4ERQ A;  4PC0 A;  4CZV A;  3E0C A;  4GQ1 A;  3I7P A;  3V9F A;  2W18 A;  1JOF A;  2GNQ A;  5EML B;  3RFG A;  1A0R B;  3DSM A;  4FA1 D;  5THA A;  2PM9 A;  3C5M A;  3CIK B;  3EG6 A;  4J73 A;  4X63 B;  1S4U X;  5GMK n;  4OWR A;  2H6K A;  5AFU 3;  4NSX A;  5FKQ A;  3JAM g;  4L3H D;  5HE2 B;  4Z8L A;  2P9I C;  2AQ5 A;  2HJB A;  4D0K A;  1PBY B;  5FQD A;  3PXS D;  4OZU A;  4XYI A;  2QC5 A;  2B5N A;  2I0R A;  5EMK B;  2IUP A;  5H1M A;  4R7A B;  2CO0 C;  4X60 B;  4A0A A;  2I0S A;  3RSE C;  3UVL A;  2H13 A;  2B5M A;  3UVK A;  3F3F A;  2YMU A;  4CY5 A;  4U1E I;  3BG1 A;  4PSW B;  4J0X A;  5GSA A;  5GXH A;  3AH8 B;  2CE8 A;  4PSX B;  5IJ8 E;  4K3J B;  3FRX A;  3V5W B;  4CI3 A;  4PNK B;  2AGW A;  4O1Q D;  5H14 A;  4A7J A;  2MTA H;  3F3P A;  3UKR C;  3OKW A;  4CY3 A;  5JWZ A;  4CI1 A;  1TYQ C;  2HKR A;  3B7F A;  3UR4 A;  5EMJ B;  2CO0 A;  3DXK C;  2HES X;  4J87 A;  5SXM A;  2PM6 B;  3OKY B;  4J79 A;  1XKS A;  2OK4 A;  5FA5 B;  3A0F A;  4FA4 D;  2G99 A;  3CFV A;  3NVX A;  5EAL A;  1JMX B;  2H6Q A;  3BWS A;  1K32 A;  2QXV A;  4H5J A;  3PSC B;  3GFC A;  4A09 B;  2YNO A;  4A11 B;  2H14 A;  4GGD A;  3SJL D;  5C9Z B;  1N6D A;  4JT5 C;  5FXY A;  4FA5 D;  4FAN D;  5A2Q g;  4E54 A;  4JT6 C;  4QRJ A;  3AFC A;  3RN1 D;  3AL8 A;  2AGX A;  2YNP A;  2H6N A;  2OIZ A;  3SBQ A;  4CY2 A;  4KFM B;  4GQB B;  4AEZ A;  4CC9 A;  4FB1 D;  5HE0 B;  3SBR A;  1K8K C;  3FGB A;  3I7K A;  4CI2 A;  3F3G A;  1TBG A;  3VGZ A;  3KRW B;  5IC7 A;  4CZX A;  4H5I A;  3RLM D;  3I8E A;  4Y7R A;  4X3E A;  1RI6 A;  2H3X A;  4JSN C;  3ZWL B;  5EMM B;  3IJ0 A;  3KRX B;  3SFZ A;  5FKR A;  2B4E A;  1R5M A;  3AL8 B;  3PVW B;  4A11 A;  2IWF A;  4PBY A;  5FLX g;  1NEX B;  4XEI C;  2J55 H;  2UZY B;  2H9M A;  4J0W A;  2AH1 A;  5EM2 A;  3SBP A;  4ERZ A;  4IA9 A;  3OL2 B;  3I7L A;  4GM8 A;  3IIW A;  5TDH B;  1NR0 A;  5I5I A;  4GQ2 P;  1U2V C;  2P9N C;  5C2V B;  5IGO A;  4A2M A;  2Z2P A;  5IJ7 E;  4A0A B;  1VYH C;  4J8G A;  5EAP A;  1SQJ A;  2AGL A;  3FM0 A;  1GOT B;  3JRO A;  4AOW A;  3CFS B;  3AL9 A;  2G9A A;  4QL1 A;  4ZOV A;  4N14 A;  2Z2N A;  1FWX A;  2GC4 A;  2I0T A;  2J57 G;  2P9P C;  2J56 H;  2XYI A;  4FHL A;  3IIY A;  3K26 A;  3I7H A;  5HYN B;  1SQ9 A;  4LGN A;  2OVQ B;  4U7A A;  4TZ4 A;  3UVO A;  4J8B A;  3JZG A;  3C9C A;  3I7O A;  4J84 A;  4UI9 R;  3JB9 L;  3BG0 A;  5CXC B;  3EI3 A;  5IT9 g;  1SHY B;  1GXR A;  5K19 A;  4BH6 A;  2YBA A;  1GG2 B;  4PBZ A;  2CN2 A;  3MMY A;  3OTT A;  4LG8 A;  5FKT A;  3PSL A;  2OVR B;  3NVQ A;  4JSX C;  5EAM A;  4EWR A;  4MK0 B;  2TRC B;  4QT8 A;  4L1Q D;  3DM0 A;  3EU7 A;  1ERJ A;  1XIP A;  3I89 A;  2OVP B;  3W15 A;  1MG3 A;  5CYK A;  3C75 H;  3OKY A;  2OK6 A;  3EI4 B;  4ZOZ A;  3I7N A;  3EWE A;  4FA9 D;  2GC7 A;  3MZK A;  2P9S C;  5AMS A;  3EMH A;  3RRM C;  1OMW B;  5CXC A;  3PXT D;  5TF2 A;  4GM9 A;  1PI6 A;  4X61 B;  4YVD A;  4A0B A;  2UZX B;  5TEF A;  2Z2O A;  3JZH A;  4GGC A;  2AGY A;  4E54 B;  1Q47 A;  3SXT D;  4CZY A;  4G56 B;  4A08 A;  3IJ1 A;  1PEV A;  4IMM A;  5I5M A;  2Q7Q A;  3HFQ A;  2H68 A;  2H9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...