2AH8A

Rogfp1-r7. cystal structure analysis of a rate-enhanced variant of redox-sensitive green fluorescent protein in the oxidized form.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
234
structure length
233
Chain Sequence
KGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFISTTGKLPVPWPTLVTTFVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNCHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLKTCSALSKDPNEKRDHMVLLERVTAAGITHGMDELYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Re-engineering redox-sensitive green fluorescent protein for improved response rate.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein
total genus 57
structure length 233
sequence length 234
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 2ah8A00
3VK1A 3SVCA 3U8PA 3VHTA 4ZF3A 2O2BA 3LVAA 5F9GA 4R6DA 4W6PA 3GJ2A 5DRFA 3SVUA 3CBEA 3P8UA 4H48A 4KF5A 4LJCA 4IZNA 1H6RA 3EK4A 1G7KA 4W69A 2HPWA 4KGEA 4W7EA 4XGYA 2IE2A 4OY4A 4OGSA 4RTCA 2OTBA 1Q4AA 4HQ9A 3EVRA 2A56B 4W6RA 4EN1A 1Q4EA 2Z6XA 2Z1OA 2AHAA 3DQHA 3PJ5A 1QYFA 2G6YA 2IB5A 1MOVA 4TZAA 1ZGPA 4W6LA 1OXEA 2AWLA 3DQNA 3AI5A 4ZB1A 4W6FA 4W7CA 5DTZA 3SRYA 4XL5A 4XOWA 4KF5C 2Q6PA 4DKMA 2WHUA 2DDDA 3SVOA 2WSNA 3SG4A 3VHTB 3ST4A 4DXPA 4W76A 4DXMA 1YHIA 4ZIOA 5LK4A 4JC2A 5KTGA 2BTJA 4PFEA 3DPWA 2YE0A 3H1RA 1C4FA 3U8AA 5EXCI 3SG7A 1W7SA 4W73A 4DXOA 2B3PA 1EMLA 2VADA 5DTXA 5HZTA 4R6BA 2YE1A 4H3LA 3V3DA 3NEZA 4RYWA 1W7UA 4JEOA 3LVDA 1JC0A 4GF6B 3DQ9A 2HQKA 5EB6A 3CB9A 4Q7UA 1S6ZA 3ZULA 3LS3A 5FVIA 2A48A 2C9JA 5H88A 4GESB 4JRBA 1F09A 5LTRA 5HW9A 1GGXA 1HCJA 5J2OA 2GX0A 3ED8A 4W6UA 2G6EA 1MOUA 2G3DB 1W7TA 1OXFA 1XMZA 4LJBA 2DUHA 4DXIA 2G5ZB 2QRFA 1H4UA 3SSKA 4PPJA 3MGFA 4IK9A 2HRSA 1KYRA 2DUGA 3SVNA 4IK4A 2HFCA 4W74A 5FVGA 3E5WA 1GFLA 4W6JA 1EMAA 2V4EA 4HE4A 4N3DA 2A52B 4HQCA 3OSRA 5T3IA 5HGEA 4H3MA 2G6XA 4Z4KA 3EVVA 2VVHA 1JBYA 4JGEA 4LQUA 4W7AA 3SS0A 3GJ1A 1ZGOA 1HUYA 3SG2A 4W75A 3SSLA 3DQ1A 3SSTA 1YHHA 3P28A 1YFPA 4W6MA 4Q9XA 2QLHA 5DU0A 1RMPA 1QYQA 3OGOA 2G3OA 2QZ0A 4L13A 3ZUJA 3EVUA 2HGYA 2P4MA 3UG0A 2AWMA 3EVPA 1GL4A 3CD9A 2H8QA 2EMNA 2Y0GA 4LJDA 4RYSA 4XOVA 3SG3A 3ADFA 3E5VA 3NEDA 2V4EB 3DQ5A 2FWQA 3U0KA 5DTLA 1RMOA 5EXBA 3DQ6A 3U0MA 2FZUA 3RWTA 4W6IA 3PJBA 5DRGA 1Q4BA 5HZSA 3BXBA 5LTPA 3SVDA 3IP2A 2HGDA 3CFHA 4W7XA 4KW9A 4PPLA 5AQBB 4L12A 3U8CA 3DQMA 2HQZA 5BTTA 2H5QA 2IOVA 4KGFA 3SSYA 4LJDC 1KYSA 3O78A 3A8SA 4W6GA 3DQ3A 3SVEA 5H87A 3SG6A 4DXNA 4KA9A 2G16B 4W72A 1XQMA 1EMFA 2YFPA 1Z1PA 1YJ2A 3ST0A 2WHTA 3NF0A 5EHUA 3W1CA 3CD1A 4AR7A 1YJFA 3DQKA 4B5YA 2ARLA 3DQEA 1QYOA 3DQ4A 2DD7A 3G9AA 2HCGA 2WURA 2EMOA 3DQOA 4H3NA 1Q73A 1RM9A 3NT3A 4B30B 2H6VA 4Z4MA 2QLEA 2WISA 1UISA 4OQWA 4BDUA 2AWKA 2QLIA 4Q7TA 2ICRA 3RWAA 5BTTB 2YDZA 2G2SB 3BX9A 4W6HA 1RMMA 3DPXA 3UFZA 4JFGA 4W7DA 1EMCA 3DQ8A 3E5TA 4XVPA 3WCKA 1KP5A 4ZF4A 2PXSA 4ANJA 3OSQA 2FL1A 1EMBA 2DDCA 3EKHA 2H5PA 3H1OA 5H89A 5DY6A 3AI4A 1EMEA 4IK5A 3EK7A 2H5RA 4J89A 4W6DA 5DTYA 4J8AA 3DQAA 4P76A 4W77A 4LW5A 3W1DA 2VZXA 5DQBA 1BFPA 3CFFA 2C9IA 3S05A 2H9WA 2QT2A 2PXWA 4W6SA 4EMQA 2ZMWA 2OJKA 3SV5A 5EB7A 4I2YA 3WLDA 3K1KA 4ORNA 1EMGA 1XA9A 2V4EC 3LF4B 3SSHA 2DUFA 1QXTA 1F0BA 1Z1QA 3SVBA 4AS8A 3BXAA 2A50B 3BXCA 5HBDA 4OJ0A 4EDOA 4KPIA 3U0LA 2OTEA 3LA1A 2A54B 5HZOA 1MYWA 2ZMUA 4KEXA 4P1QA 3ZTFA 2OGRA 4Q9WA 4B30A 3EKJA 4LQTA 4W6KA 2Q57A 4Q7RA 2VVIA 2ZO6A 4NWSA 3CGLA 3LF3A 2H5OA 4J88A 3U0NA 2JADA 4OHSA 2A53B 4IK1A 4H47A 4ZFSA 4KW8A 4L1IA 3ZUFA 3PJ7A 3DPZA 4ZINA 3SVSA 4KW4A 5FVFA 1ZGQA 2IB6A 5EBJA 2O24A 3KCSA 3LVCA 5LTQA 1JBZA 3SVRA 3GB3A 2QU1A 3EK8A 5EJUA 1XSSA 2O29A 4U2VA 1RRXA 3SSPA 2OKWA 2POXA 5FHVA 2HJOA 3DQIA 3ST2A 5DPIA 2AH8A 3TMRA 2AWJA 3DQ7A 2A46A 4W6NA 4IK8A 2B3QA 4W7FA 3M22A 1EMMA 3DQJA 1Q4CA 5DPGA 3O77A 2EMDA 4W6CA 2DUIA 2WSOA 2Z6YA 3TMTA 5DPHA 2A47A 4GOBA 2GW4B 3ST3A 4PPKA 1XAEA 1Q4DA 4TZGA 1JC1A 2QLGA 4KF4A 5DQMA 3IR8A 4DXQA 4W6BA 5HZUA 2WIQA 3M24A 4UTSA 4KAGA 3WLCA 1OXDA 2RH7A 4HVFA 3DQUA 1YHGA 3PIBA 2GW3A 5EXUA 5BQLA 2VVJA 3I19A 3DQLA 4W6OA 1KYPA 3GL4A 1YZWA 3SG5A 2Z6ZA 2DUEA 4W6TA 2ZO7A 3VICA 4EDSA 4ZBLA 2WHSA 3CFAA 3SSVA 4W7RA 1EMKA 4ZF5A 3KCTA 3LSAA 3DQDA 1QY3A 3DQ2A 5BT0A 3NT9A 2OKYA 3DQFA 1B9CA 3GEXA 3AKOA 2VAEA 3DQCA 2GX2A 2QLGB 1ZUXA 4EULA 4IK3A 4HQ8A 4DKNA 2DD9A 4W6AA 1CV7A 4JF9A 5DPJA
chains in the Genus database with same CATH superfamily
3VK1A 3SVCA 3U8PA 3VHTA 4ZF3A 2O2BA 3LVAA 5F9GA 4R6DA 4W6PA 3GJ2A 5DRFA 3SVUA 3CBEA 3P8UA 4H48A 4KF5A 4LJCA 4IZNA 1H6RA 3EK4A 1G7KA 4W69A 2HPWA 4KGEA 4W7EA 4XGYA 2IE2A 4OY4A 4OGSA 4RTCA 2OTBA 1Q4AA 4HQ9A 3EVRA 2A56B 4W6RA 4EN1A 1Q4EA 2Z6XA 2Z1OA 2AHAA 3DQHA 3PJ5A 1QYFA 2G6YA 2IB5A 1MOVA 4TZAA 1ZGPA 4W6LA 1OXEA 2AWLA 3DQNA 3AI5A 4ZB1A 4W6FA 4W7CA 5DTZA 3SRYA 4XL5A 4XOWA 4KF5C 2Q6PA 4DKMA 2WHUA 2DDDA 3SVOA 2WSNA 3SG4A 3VHTB 3ST4A 4DXPA 4W76A 4DXMA 1YHIA 4ZIOA 5LK4A 4JC2A 5KTGA 2BTJA 4PFEA 3DPWA 2YE0A 3H1RA 1C4FA 3U8AA 5EXCI 3SG7A 1W7SA 4W73A 4DXOA 2B3PA 1EMLA 2VADA 5DTXA 5HZTA 4R6BA 2YE1A 4H3LA 3V3DA 3NEZA 4RYWA 1W7UA 4JEOA 3LVDA 1JC0A 4GF6B 3DQ9A 2HQKA 5EB6A 3CB9A 4Q7UA 1S6ZA 3ZULA 3LS3A 5FVIA 2A48A 2C9JA 5H88A 4GESB 4JRBA 1F09A 5LTRA 5HW9A 1GGXA 1HCJA 5J2OA 2GX0A 3ED8A 4W6UA 2G6EA 1MOUA 2G3DB 1W7TA 1OXFA 1XMZA 4LJBA 2DUHA 4DXIA 2G5ZB 2QRFA 1H4UA 3SSKA 4PPJA 3MGFA 4IK9A 2HRSA 1KYRA 2DUGA 3SVNA 4IK4A 2HFCA 4W74A 5FVGA 3E5WA 1GFLA 4W6JA 1EMAA 2V4EA 4HE4A 4N3DA 2A52B 4HQCA 3OSRA 5T3IA 5HGEA 4H3MA 2G6XA 4Z4KA 3EVVA 2VVHA 1JBYA 4JGEA 4LQUA 4W7AA 3SS0A 3GJ1A 1ZGOA 1HUYA 3SG2A 4W75A 3SSLA 3DQ1A 3SSTA 1YHHA 3P28A 1YFPA 4W6MA 4Q9XA 2QLHA 5DU0A 1RMPA 1QYQA 3OGOA 2G3OA 2QZ0A 4L13A 3ZUJA 3EVUA 2HGYA 2P4MA 3UG0A 2AWMA 3EVPA 1GL4A 3CD9A 2H8QA 2EMNA 2Y0GA 4LJDA 4RYSA 4XOVA 3SG3A 3ADFA 3E5VA 3NEDA 2V4EB 3DQ5A 2FWQA 3U0KA 5DTLA 1RMOA 5EXBA 3DQ6A 3U0MA 2FZUA 3RWTA 4W6IA 3PJBA 5DRGA 1Q4BA 5HZSA 3BXBA 5LTPA 3SVDA 3IP2A 2HGDA 3CFHA 4W7XA 4KW9A 4PPLA 5AQBB 4L12A 3U8CA 3DQMA 2HQZA 5BTTA 2H5QA 2IOVA 4KGFA 3SSYA 4LJDC 1KYSA 3O78A 3A8SA 4W6GA 3DQ3A 3SVEA 5H87A 3SG6A 4DXNA 4KA9A 2G16B 4W72A 1XQMA 1EMFA 2YFPA 1Z1PA 1YJ2A 3ST0A 2WHTA 3NF0A 5EHUA 3W1CA 3CD1A 4AR7A 1YJFA 3DQKA 4B5YA 2ARLA 3DQEA 1QYOA 3DQ4A 2DD7A 3G9AA 2HCGA 2WURA 2EMOA 3DQOA 4H3NA 1Q73A 1RM9A 3NT3A 4B30B 2H6VA 4Z4MA 2QLEA 2WISA 1UISA 4OQWA 4BDUA 2AWKA 2QLIA 4Q7TA 2ICRA 3RWAA 5BTTB 2YDZA 2G2SB 3BX9A 4W6HA 1RMMA 3DPXA 3UFZA 4JFGA 4W7DA 1EMCA 3DQ8A 3E5TA 4XVPA 3WCKA 1KP5A 4ZF4A 2PXSA 4ANJA 3OSQA 2FL1A 1EMBA 2DDCA 3EKHA 2H5PA 3H1OA 5H89A 5DY6A 3AI4A 1EMEA 4IK5A 3EK7A 2H5RA 4J89A 4W6DA 5DTYA 4J8AA 3DQAA 4P76A 4W77A 4LW5A 3W1DA 2VZXA 5DQBA 1BFPA 3CFFA 2C9IA 3S05A 2H9WA 2QT2A 2PXWA 4W6SA 4EMQA 2ZMWA 2OJKA 3SV5A 5EB7A 4I2YA 3WLDA 3K1KA 4ORNA 1EMGA 1XA9A 2V4EC 3LF4B 3SSHA 2DUFA 1QXTA 1F0BA 1Z1QA 3SVBA 4AS8A 3BXAA 2A50B 3BXCA 5HBDA 4OJ0A 4EDOA 4KPIA 3U0LA 2OTEA 3LA1A 2A54B 5HZOA 1MYWA 2ZMUA 4KEXA 4P1QA 3ZTFA 2OGRA 4Q9WA 4B30A 3EKJA 4LQTA 4W6KA 2Q57A 4Q7RA 2VVIA 2ZO6A 4NWSA 3CGLA 3LF3A 2H5OA 4J88A 3U0NA 2JADA 4OHSA 2A53B 4IK1A 4H47A 4ZFSA 4KW8A 4L1IA 3ZUFA 3PJ7A 3DPZA 4ZINA 3SVSA 4KW4A 5FVFA 1ZGQA 2IB6A 5EBJA 2O24A 3KCSA 3LVCA 5LTQA 1JBZA 3SVRA 3GB3A 2QU1A 3EK8A 5EJUA 1XSSA 2O29A 4U2VA 1RRXA 3SSPA 2OKWA 2POXA 5FHVA 2HJOA 3DQIA 3ST2A 5DPIA 2AH8A 3TMRA 2AWJA 3DQ7A 2A46A 4W6NA 4IK8A 2B3QA 4W7FA 3M22A 1EMMA 3DQJA 1Q4CA 5DPGA 3O77A 2EMDA 4W6CA 2DUIA 2WSOA 2Z6YA 3TMTA 5DPHA 2A47A 4GOBA 2GW4B 3ST3A 4PPKA 1XAEA 1Q4DA 4TZGA 1JC1A 2QLGA 4KF4A 5DQMA 3IR8A 4DXQA 4W6BA 5HZUA 2WIQA 3M24A 4UTSA 4KAGA 3WLCA 1OXDA 2RH7A 4HVFA 3DQUA 1YHGA 3PIBA 2GW3A 5EXUA 5BQLA 2VVJA 3I19A 3DQLA 4W6OA 1KYPA 3GL4A 1YZWA 3SG5A 2Z6ZA 2DUEA 4W6TA 2ZO7A 3VICA 4EDSA 4ZBLA 2WHSA 3CFAA 3SSVA 4W7RA 1EMKA 4ZF5A 3KCTA 3LSAA 3DQDA 1QY3A 3DQ2A 5BT0A 3NT9A 2OKYA 3DQFA 1B9CA 3GEXA 3AKOA 2VAEA 3DQCA 2GX2A 2QLGB 1ZUXA 4EULA 4IK3A 4HQ8A 4DKNA 2DD9A 4W6AA 1CV7A 4JF9A 5DPJA
chains in the Genus database with same CATH topology
3VK1A 3SVCA 3U8PA 3VHTA 4ZF3A 2O2BA 3LVAA 5F9GA 4R6DA 4W6PA 3GJ2A 5DRFA 3SVUA 3CBEA 3P8UA 4H48A 4KF5A 4LJCA 4IZNA 1H6RA 3EK4A 1G7KA 4W69A 2HPWA 4KGEA 4W7EA 4XGYA 2IE2A 4OY4A 4OGSA 4RTCA 2OTBA 1Q4AA 4HQ9A 3EVRA 2A56B 4W6RA 4EN1A 1Q4EA 2Z6XA 2Z1OA 2AHAA 3DQHA 3PJ5A 1QYFA 2G6YA 2IB5A 1MOVA 4TZAA 1ZGPA 4W6LA 1OXEA 2AWLA 3DQNA 3AI5A 4ZB1A 4W6FA 4W7CA 5DTZA 3SRYA 4XL5A 4XOWA 4KF5C 2Q6PA 4DKMA 2WHUA 2DDDA 3SVOA 2WSNA 3SG4A 3VHTB 3ST4A 4DXPA 4W76A 4DXMA 1YHIA 4ZIOA 5LK4A 4JC2A 5KTGA 2BTJA 4PFEA 3DPWA 2YE0A 3H1RA 1C4FA 3U8AA 5EXCI 3SG7A 1W7SA 4W73A 4DXOA 2B3PA 1EMLA 2VADA 5DTXA 5HZTA 4R6BA 2YE1A 4H3LA 3V3DA 3NEZA 4RYWA 1W7UA 4JEOA 3LVDA 1JC0A 4GF6B 3DQ9A 2HQKA 5EB6A 3CB9A 4Q7UA 1S6ZA 3ZULA 3LS3A 5FVIA 2A48A 2C9JA 5H88A 4GESB 4JRBA 1F09A 5LTRA 5HW9A 1GGXA 1HCJA 5J2OA 2GX0A 3ED8A 4W6UA 2G6EA 1MOUA 2G3DB 1W7TA 1OXFA 1XMZA 4LJBA 2DUHA 4DXIA 2G5ZB 2QRFA 1H4UA 3SSKA 4PPJA 3MGFA 4IK9A 2HRSA 1KYRA 2DUGA 3SVNA 4IK4A 2HFCA 4W74A 5FVGA 3E5WA 1GFLA 4W6JA 1EMAA 2V4EA 4HE4A 4N3DA 2A52B 4HQCA 3OSRA 5T3IA 5HGEA 4H3MA 2G6XA 4Z4KA 3EVVA 2VVHA 1JBYA 4JGEA 4LQUA 4W7AA 3SS0A 3GJ1A 1ZGOA 1HUYA 3SG2A 4W75A 3SSLA 3DQ1A 3SSTA 1YHHA 3P28A 1YFPA 4W6MA 4Q9XA 2QLHA 5DU0A 1RMPA 1QYQA 3OGOA 2G3OA 2QZ0A 4L13A 3ZUJA 3EVUA 2HGYA 2P4MA 3UG0A 2AWMA 3EVPA 1GL4A 3CD9A 2H8QA 2EMNA 2Y0GA 4LJDA 4RYSA 4XOVA 3SG3A 3ADFA 3E5VA 3NEDA 2V4EB 3DQ5A 2FWQA 3U0KA 5DTLA 1RMOA 5EXBA 3DQ6A 3U0MA 2FZUA 3RWTA 4W6IA 3PJBA 5DRGA 1Q4BA 5HZSA 3BXBA 5LTPA 3SVDA 3IP2A 2HGDA 3CFHA 4W7XA 4KW9A 4PPLA 5AQBB 4L12A 3U8CA 3DQMA 2HQZA 5BTTA 2H5QA 2IOVA 4KGFA 3SSYA 4LJDC 1KYSA 3O78A 3A8SA 4W6GA 3DQ3A 3SVEA 5H87A 3SG6A 4DXNA 4KA9A 2G16B 4W72A 1XQMA 1EMFA 2YFPA 1Z1PA 1YJ2A 3ST0A 2WHTA 3NF0A 5EHUA 3W1CA 3CD1A 4AR7A 1YJFA 3DQKA 4B5YA 2ARLA 3DQEA 1QYOA 3DQ4A 2DD7A 3G9AA 2HCGA 2WURA 2EMOA 3DQOA 4H3NA 1Q73A 1RM9A 3NT3A 4B30B 2H6VA 4Z4MA 2QLEA 2WISA 1UISA 4OQWA 4BDUA 2AWKA 2QLIA 4Q7TA 2ICRA 3RWAA 5BTTB 2YDZA 2G2SB 3BX9A 4W6HA 1RMMA 3DPXA 3UFZA 4JFGA 4W7DA 1EMCA 3DQ8A 3E5TA 4XVPA 3WCKA 1KP5A 4ZF4A 2PXSA 4ANJA 3OSQA 2FL1A 1EMBA 2DDCA 3EKHA 2H5PA 3H1OA 5H89A 5DY6A 3AI4A 1EMEA 4IK5A 3EK7A 2H5RA 4J89A 4W6DA 5DTYA 4J8AA 3DQAA 4P76A 4W77A 4LW5A 3W1DA 2VZXA 5DQBA 1BFPA 3CFFA 2C9IA 3S05A 2H9WA 2QT2A 2PXWA 4W6SA 4EMQA 2ZMWA 2OJKA 3SV5A 5EB7A 4I2YA 3WLDA 3K1KA 4ORNA 1EMGA 1XA9A 2V4EC 3LF4B 3SSHA 2DUFA 1QXTA 1F0BA 1Z1QA 3SVBA 4AS8A 3BXAA 2A50B 3BXCA 5HBDA 4OJ0A 4EDOA 4KPIA 3U0LA 2OTEA 3LA1A 2A54B 5HZOA 1MYWA 2ZMUA 4KEXA 4P1QA 3ZTFA 2OGRA 4Q9WA 4B30A 3EKJA 4LQTA 4W6KA 2Q57A 4Q7RA 2VVIA 2ZO6A 4NWSA 3CGLA 3LF3A 2H5OA 4J88A 3U0NA 2JADA 4OHSA 2A53B 4IK1A 4H47A 4ZFSA 4KW8A 4L1IA 3ZUFA 3PJ7A 3DPZA 4ZINA 3SVSA 4KW4A 5FVFA 1ZGQA 2IB6A 5EBJA 2O24A 3KCSA 3LVCA 5LTQA 1JBZA 3SVRA 3GB3A 2QU1A 3EK8A 5EJUA 1XSSA 2O29A 4U2VA 1RRXA 3SSPA 2OKWA 2POXA 5FHVA 2HJOA 3DQIA 3ST2A 5DPIA 2AH8A 3TMRA 2AWJA 3DQ7A 2A46A 4W6NA 4IK8A 2B3QA 4W7FA 3M22A 1EMMA 3DQJA 1Q4CA 5DPGA 3O77A 2EMDA 4W6CA 2DUIA 2WSOA 2Z6YA 3TMTA 5DPHA 2A47A 4GOBA 2GW4B 3ST3A 4PPKA 1XAEA 1Q4DA 4TZGA 1JC1A 2QLGA 4KF4A 5DQMA 3IR8A 4DXQA 4W6BA 5HZUA 2WIQA 3M24A 4UTSA 4KAGA 3WLCA 1OXDA 2RH7A 4HVFA 3DQUA 1YHGA 3PIBA 2GW3A 5EXUA 5BQLA 2VVJA 3I19A 3DQLA 4W6OA 1KYPA 3GL4A 1YZWA 3SG5A 2Z6ZA 2DUEA 4W6TA 2ZO7A 3VICA 4EDSA 4ZBLA 2WHSA 3CFAA 3SSVA 4W7RA 1EMKA 4ZF5A 3KCTA 3LSAA 3DQDA 1QY3A 3DQ2A 5BT0A 3NT9A 2OKYA 3DQFA 1B9CA 3GEXA 3AKOA 2VAEA 3DQCA 2GX2A 2QLGB 1ZUXA 4EULA 4IK3A 4HQ8A 4DKNA 2DD9A 4W6AA 1CV7A 4JF9A 5DPJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VK1 A;  3SVC A;  3U8P A;  3VHT A;  4ZF3 A;  2O2B A;  3LVA A;  5F9G A;  4R6D A;  4W6P A;  3GJ2 A;  5DRF A;  3SVU A;  3CBE A;  3P8U A;  4H48 A;  4KF5 A;  4LJC A;  4IZN A;  1H6R A;  3EK4 A;  1G7K A;  4W69 A;  2HPW A;  4KGE A;  4W7E A;  4XGY A;  2IE2 A;  4OY4 A;  4OGS A;  4RTC A;  2OTB A;  1Q4A A;  4HQ9 A;  3EVR A;  2A56 B;  4W6R A;  4EN1 A;  1Q4E A;  2Z6X A;  2Z1O A;  2AHA A;  3DQH A;  3PJ5 A;  1QYF A;  2G6Y A;  2IB5 A;  1MOV A;  4TZA A;  1ZGP A;  4W6L A;  1OXE A;  2AWL A;  3DQN A;  3AI5 A;  4ZB1 A;  4W6F A;  4W7C A;  5DTZ A;  3SRY A;  4XL5 A;  4XOW A;  4KF5 C;  2Q6P A;  4DKM A;  2WHU A;  2DDD A;  3SVO A;  2WSN A;  3SG4 A;  3VHT B;  3ST4 A;  4DXP A;  4W76 A;  4DXM A;  1YHI A;  4ZIO A;  5LK4 A;  4JC2 A;  5KTG A;  2BTJ A;  4PFE A;  3DPW A;  2YE0 A;  3H1R A;  1C4F A;  3U8A A;  5EXC I;  3SG7 A;  1W7S A;  4W73 A;  4DXO A;  2B3P A;  1EML A;  2VAD A;  5DTX A;  5HZT A;  4R6B A;  2YE1 A;  4H3L A;  3V3D A;  3NEZ A;  4RYW A;  1W7U A;  4JEO A;  3LVD A;  1JC0 A;  4GF6 B;  3DQ9 A;  2HQK A;  5EB6 A;  3CB9 A;  4Q7U A;  1S6Z A;  3ZUL A;  3LS3 A;  5FVI A;  2A48 A;  2C9J A;  5H88 A;  4GES B;  4JRB A;  1F09 A;  5LTR A;  5HW9 A;  1GGX A;  1HCJ A;  5J2O A;  2GX0 A;  3ED8 A;  4W6U A;  2G6E A;  1MOU A;  2G3D B;  1W7T A;  1OXF A;  1XMZ A;  4LJB A;  2DUH A;  4DXI A;  2G5Z B;  2QRF A;  1H4U A;  3SSK A;  4PPJ A;  3MGF A;  4IK9 A;  2HRS A;  1KYR A;  2DUG A;  3SVN A;  4IK4 A;  2HFC A;  4W74 A;  5FVG A;  3E5W A;  1GFL A;  4W6J A;  1EMA A;  2V4E A;  4HE4 A;  4N3D A;  2A52 B;  4HQC A;  3OSR A;  5T3I A;  5HGE A;  4H3M A;  2G6X A;  4Z4K A;  3EVV A;  2VVH A;  1JBY A;  4JGE A;  4LQU A;  4W7A A;  3SS0 A;  3GJ1 A;  1ZGO A;  1HUY A;  3SG2 A;  4W75 A;  3SSL A;  3DQ1 A;  3SST A;  1YHH A;  3P28 A;  1YFP A;  4W6M A;  4Q9X A;  2QLH A;  5DU0 A;  1RMP A;  1QYQ A;  3OGO A;  2G3O A;  2QZ0 A;  4L13 A;  3ZUJ A;  3EVU A;  2HGY A;  2P4M A;  3UG0 A;  2AWM A;  3EVP A;  1GL4 A;  3CD9 A;  2H8Q A;  2EMN A;  2Y0G A;  4LJD A;  4RYS A;  4XOV A;  3SG3 A;  3ADF A;  3E5V A;  3NED A;  2V4E B;  3DQ5 A;  2FWQ A;  3U0K A;  5DTL A;  1RMO A;  5EXB A;  3DQ6 A;  3U0M A;  2FZU A;  3RWT A;  4W6I A;  3PJB A;  5DRG A;  1Q4B A;  5HZS A;  3BXB A;  5LTP A;  3SVD A;  3IP2 A;  2HGD A;  3CFH A;  4W7X A;  4KW9 A;  4PPL A;  5AQB B;  4L12 A;  3U8C A;  3DQM A;  2HQZ A;  5BTT A;  2H5Q A;  2IOV A;  4KGF A;  3SSY A;  4LJD C;  1KYS A;  3O78 A;  3A8S A;  4W6G A;  3DQ3 A;  3SVE A;  5H87 A;  3SG6 A;  4DXN A;  4KA9 A;  2G16 B;  4W72 A;  1XQM A;  1EMF A;  2YFP A;  1Z1P A;  1YJ2 A;  3ST0 A;  2WHT A;  3NF0 A;  5EHU A;  3W1C A;  3CD1 A;  4AR7 A;  1YJF A;  3DQK A;  4B5Y A;  2ARL A;  3DQE A;  1QYO A;  3DQ4 A;  2DD7 A;  3G9A A;  2HCG A;  2WUR A;  2EMO A;  3DQO A;  4H3N A;  1Q73 A;  1RM9 A;  3NT3 A;  4B30 B;  2H6V A;  4Z4M A;  2QLE A;  2WIS A;  1UIS A;  4OQW A;  4BDU A;  2AWK A;  2QLI A;  4Q7T A;  2ICR A;  3RWA A;  5BTT B;  2YDZ A;  2G2S B;  3BX9 A;  4W6H A;  1RMM A;  3DPX A;  3UFZ A;  4JFG A;  4W7D A;  1EMC A;  3DQ8 A;  3E5T A;  4XVP A;  3WCK A;  1KP5 A;  4ZF4 A;  2PXS A;  4ANJ A;  3OSQ A;  2FL1 A;  1EMB A;  2DDC A;  3EKH A;  2H5P A;  3H1O A;  5H89 A;  5DY6 A;  3AI4 A;  1EME A;  4IK5 A;  3EK7 A;  2H5R A;  4J89 A;  4W6D A;  5DTY A;  4J8A A;  3DQA A;  4P76 A;  4W77 A;  4LW5 A;  3W1D A;  2VZX A;  5DQB A;  1BFP A;  3CFF A;  2C9I A;  3S05 A;  2H9W A;  2QT2 A;  2PXW A;  4W6S A;  4EMQ A;  2ZMW A;  2OJK A;  3SV5 A;  5EB7 A;  4I2Y A;  3WLD A;  3K1K A;  4ORN A;  1EMG A;  1XA9 A;  2V4E C;  3LF4 B;  3SSH A;  2DUF A;  1QXT A;  1F0B A;  1Z1Q A;  3SVB A;  4AS8 A;  3BXA A;  2A50 B;  3BXC A;  5HBD A;  4OJ0 A;  4EDO A;  4KPI A;  3U0L A;  2OTE A;  3LA1 A;  2A54 B;  5HZO A;  1MYW A;  2ZMU A;  4KEX A;  4P1Q A;  3ZTF A;  2OGR A;  4Q9W A;  4B30 A;  3EKJ A;  4LQT A;  4W6K A;  2Q57 A;  4Q7R A;  2VVI A;  2ZO6 A;  4NWS A;  3CGL A;  3LF3 A;  2H5O A;  4J88 A;  3U0N A;  2JAD A;  4OHS A;  2A53 B;  4IK1 A;  4H47 A;  4ZFS A;  4KW8 A;  4L1I A;  3ZUF A;  3PJ7 A;  3DPZ A;  4ZIN A;  3SVS A;  4KW4 A;  5FVF A;  1ZGQ A;  2IB6 A;  5EBJ A;  2O24 A;  3KCS A;  3LVC A;  5LTQ A;  1JBZ A;  3SVR A;  3GB3 A;  2QU1 A;  3EK8 A;  5EJU A;  1XSS A;  2O29 A;  4U2V A;  1RRX A;  3SSP A;  2OKW A;  2POX A;  5FHV A;  2HJO A;  3DQI A;  3ST2 A;  5DPI A;  2AH8 A;  3TMR A;  2AWJ A;  3DQ7 A;  2A46 A;  4W6N A;  4IK8 A;  2B3Q A;  4W7F A;  3M22 A;  1EMM A;  3DQJ A;  1Q4C A;  5DPG A;  3O77 A;  2EMD A;  4W6C A;  2DUI A;  2WSO A;  2Z6Y A;  3TMT A;  5DPH A;  2A47 A;  4GOB A;  2GW4 B;  3ST3 A;  4PPK A;  1XAE A;  1Q4D A;  4TZG A;  1JC1 A;  2QLG A;  4KF4 A;  5DQM A;  3IR8 A;  4DXQ A;  4W6B A;  5HZU A;  2WIQ A;  3M24 A;  4UTS A;  4KAG A;  3WLC A;  1OXD A;  2RH7 A;  4HVF A;  3DQU A;  1YHG A;  3PIB A;  2GW3 A;  5EXU A;  5BQL A;  2VVJ A;  3I19 A;  3DQL A;  4W6O A;  1KYP A;  3GL4 A;  1YZW A;  3SG5 A;  2Z6Z A;  2DUE A;  4W6T A;  2ZO7 A;  3VIC A;  4EDS A;  4ZBL A;  2WHS A;  3CFA A;  3SSV A;  4W7R A;  1EMK A;  4ZF5 A;  3KCT A;  3LSA A;  3DQD A;  1QY3 A;  3DQ2 A;  5BT0 A;  3NT9 A;  2OKY A;  3DQF A;  1B9C A;  3GEX A;  3AKO A;  2VAE A;  3DQC A;  2GX2 A;  2QLG B;  1ZUX A;  4EUL A;  4IK3 A;  4HQ8 A;  4DKN A;  2DD9 A;  4W6A A;  1CV7 A;  4JF9 A;  5DPJ A; 
#chains in the Genus database with same CATH topology
 3VK1 A;  3SVC A;  3U8P A;  3VHT A;  4ZF3 A;  2O2B A;  3LVA A;  5F9G A;  4R6D A;  4W6P A;  3GJ2 A;  5DRF A;  3SVU A;  3CBE A;  3P8U A;  4H48 A;  4KF5 A;  4LJC A;  4IZN A;  1H6R A;  3EK4 A;  1G7K A;  4W69 A;  2HPW A;  4KGE A;  4W7E A;  4XGY A;  2IE2 A;  4OY4 A;  4OGS A;  4RTC A;  2OTB A;  1Q4A A;  4HQ9 A;  3EVR A;  2A56 B;  4W6R A;  4EN1 A;  1Q4E A;  2Z6X A;  2Z1O A;  2AHA A;  3DQH A;  3PJ5 A;  1QYF A;  2G6Y A;  2IB5 A;  1MOV A;  4TZA A;  1ZGP A;  4W6L A;  1OXE A;  2AWL A;  3DQN A;  3AI5 A;  4ZB1 A;  4W6F A;  4W7C A;  5DTZ A;  3SRY A;  4XL5 A;  4XOW A;  4KF5 C;  2Q6P A;  4DKM A;  2WHU A;  2DDD A;  3SVO A;  2WSN A;  3SG4 A;  3VHT B;  3ST4 A;  4DXP A;  4W76 A;  4DXM A;  1YHI A;  4ZIO A;  5LK4 A;  4JC2 A;  5KTG A;  2BTJ A;  4PFE A;  3DPW A;  2YE0 A;  3H1R A;  1C4F A;  3U8A A;  5EXC I;  3SG7 A;  1W7S A;  4W73 A;  4DXO A;  2B3P A;  1EML A;  2VAD A;  5DTX A;  5HZT A;  4R6B A;  2YE1 A;  4H3L A;  3V3D A;  3NEZ A;  4RYW A;  1W7U A;  4JEO A;  3LVD A;  1JC0 A;  4GF6 B;  3DQ9 A;  2HQK A;  5EB6 A;  3CB9 A;  4Q7U A;  1S6Z A;  3ZUL A;  3LS3 A;  5FVI A;  2A48 A;  2C9J A;  5H88 A;  4GES B;  4JRB A;  1F09 A;  5LTR A;  5HW9 A;  1GGX A;  1HCJ A;  5J2O A;  2GX0 A;  3ED8 A;  4W6U A;  2G6E A;  1MOU A;  2G3D B;  1W7T A;  1OXF A;  1XMZ A;  4LJB A;  2DUH A;  4DXI A;  2G5Z B;  2QRF A;  1H4U A;  3SSK A;  4PPJ A;  3MGF A;  4IK9 A;  2HRS A;  1KYR A;  2DUG A;  3SVN A;  4IK4 A;  2HFC A;  4W74 A;  5FVG A;  3E5W A;  1GFL A;  4W6J A;  1EMA A;  2V4E A;  4HE4 A;  4N3D A;  2A52 B;  4HQC A;  3OSR A;  5T3I A;  5HGE A;  4H3M A;  2G6X A;  4Z4K A;  3EVV A;  2VVH A;  1JBY A;  4JGE A;  4LQU A;  4W7A A;  3SS0 A;  3GJ1 A;  1ZGO A;  1HUY A;  3SG2 A;  4W75 A;  3SSL A;  3DQ1 A;  3SST A;  1YHH A;  3P28 A;  1YFP A;  4W6M A;  4Q9X A;  2QLH A;  5DU0 A;  1RMP A;  1QYQ A;  3OGO A;  2G3O A;  2QZ0 A;  4L13 A;  3ZUJ A;  3EVU A;  2HGY A;  2P4M A;  3UG0 A;  2AWM A;  3EVP A;  1GL4 A;  3CD9 A;  2H8Q A;  2EMN A;  2Y0G A;  4LJD A;  4RYS A;  4XOV A;  3SG3 A;  3ADF A;  3E5V A;  3NED A;  2V4E B;  3DQ5 A;  2FWQ A;  3U0K A;  5DTL A;  1RMO A;  5EXB A;  3DQ6 A;  3U0M A;  2FZU A;  3RWT A;  4W6I A;  3PJB A;  5DRG A;  1Q4B A;  5HZS A;  3BXB A;  5LTP A;  3SVD A;  3IP2 A;  2HGD A;  3CFH A;  4W7X A;  4KW9 A;  4PPL A;  5AQB B;  4L12 A;  3U8C A;  3DQM A;  2HQZ A;  5BTT A;  2H5Q A;  2IOV A;  4KGF A;  3SSY A;  4LJD C;  1KYS A;  3O78 A;  3A8S A;  4W6G A;  3DQ3 A;  3SVE A;  5H87 A;  3SG6 A;  4DXN A;  4KA9 A;  2G16 B;  4W72 A;  1XQM A;  1EMF A;  2YFP A;  1Z1P A;  1YJ2 A;  3ST0 A;  2WHT A;  3NF0 A;  5EHU A;  3W1C A;  3CD1 A;  4AR7 A;  1YJF A;  3DQK A;  4B5Y A;  2ARL A;  3DQE A;  1QYO A;  3DQ4 A;  2DD7 A;  3G9A A;  2HCG A;  2WUR A;  2EMO A;  3DQO A;  4H3N A;  1Q73 A;  1RM9 A;  3NT3 A;  4B30 B;  2H6V A;  4Z4M A;  2QLE A;  2WIS A;  1UIS A;  4OQW A;  4BDU A;  2AWK A;  2QLI A;  4Q7T A;  2ICR A;  3RWA A;  5BTT B;  2YDZ A;  2G2S B;  3BX9 A;  4W6H A;  1RMM A;  3DPX A;  3UFZ A;  4JFG A;  4W7D A;  1EMC A;  3DQ8 A;  3E5T A;  4XVP A;  3WCK A;  1KP5 A;  4ZF4 A;  2PXS A;  4ANJ A;  3OSQ A;  2FL1 A;  1EMB A;  2DDC A;  3EKH A;  2H5P A;  3H1O A;  5H89 A;  5DY6 A;  3AI4 A;  1EME A;  4IK5 A;  3EK7 A;  2H5R A;  4J89 A;  4W6D A;  5DTY A;  4J8A A;  3DQA A;  4P76 A;  4W77 A;  4LW5 A;  3W1D A;  2VZX A;  5DQB A;  1BFP A;  3CFF A;  2C9I A;  3S05 A;  2H9W A;  2QT2 A;  2PXW A;  4W6S A;  4EMQ A;  2ZMW A;  2OJK A;  3SV5 A;  5EB7 A;  4I2Y A;  3WLD A;  3K1K A;  4ORN A;  1EMG A;  1XA9 A;  2V4E C;  3LF4 B;  3SSH A;  2DUF A;  1QXT A;  1F0B A;  1Z1Q A;  3SVB A;  4AS8 A;  3BXA A;  2A50 B;  3BXC A;  5HBD A;  4OJ0 A;  4EDO A;  4KPI A;  3U0L A;  2OTE A;  3LA1 A;  2A54 B;  5HZO A;  1MYW A;  2ZMU A;  4KEX A;  4P1Q A;  3ZTF A;  2OGR A;  4Q9W A;  4B30 A;  3EKJ A;  4LQT A;  4W6K A;  2Q57 A;  4Q7R A;  2VVI A;  2ZO6 A;  4NWS A;  3CGL A;  3LF3 A;  2H5O A;  4J88 A;  3U0N A;  2JAD A;  4OHS A;  2A53 B;  4IK1 A;  4H47 A;  4ZFS A;  4KW8 A;  4L1I A;  3ZUF A;  3PJ7 A;  3DPZ A;  4ZIN A;  3SVS A;  4KW4 A;  5FVF A;  1ZGQ A;  2IB6 A;  5EBJ A;  2O24 A;  3KCS A;  3LVC A;  5LTQ A;  1JBZ A;  3SVR A;  3GB3 A;  2QU1 A;  3EK8 A;  5EJU A;  1XSS A;  2O29 A;  4U2V A;  1RRX A;  3SSP A;  2OKW A;  2POX A;  5FHV A;  2HJO A;  3DQI A;  3ST2 A;  5DPI A;  2AH8 A;  3TMR A;  2AWJ A;  3DQ7 A;  2A46 A;  4W6N A;  4IK8 A;  2B3Q A;  4W7F A;  3M22 A;  1EMM A;  3DQJ A;  1Q4C A;  5DPG A;  3O77 A;  2EMD A;  4W6C A;  2DUI A;  2WSO A;  2Z6Y A;  3TMT A;  5DPH A;  2A47 A;  4GOB A;  2GW4 B;  3ST3 A;  4PPK A;  1XAE A;  1Q4D A;  4TZG A;  1JC1 A;  2QLG A;  4KF4 A;  5DQM A;  3IR8 A;  4DXQ A;  4W6B A;  5HZU A;  2WIQ A;  3M24 A;  4UTS A;  4KAG A;  3WLC A;  1OXD A;  2RH7 A;  4HVF A;  3DQU A;  1YHG A;  3PIB A;  2GW3 A;  5EXU A;  5BQL A;  2VVJ A;  3I19 A;  3DQL A;  4W6O A;  1KYP A;  3GL4 A;  1YZW A;  3SG5 A;  2Z6Z A;  2DUE A;  4W6T A;  2ZO7 A;  3VIC A;  4EDS A;  4ZBL A;  2WHS A;  3CFA A;  3SSV A;  4W7R A;  1EMK A;  4ZF5 A;  3KCT A;  3LSA A;  3DQD A;  1QY3 A;  3DQ2 A;  5BT0 A;  3NT9 A;  2OKY A;  3DQF A;  1B9C A;  3GEX A;  3AKO A;  2VAE A;  3DQC A;  2GX2 A;  2QLG B;  1ZUX A;  4EUL A;  4IK3 A;  4HQ8 A;  4DKN A;  2DD9 A;  4W6A A;  1CV7 A;  4JF9 A;  5DPJ A; 
#chains in the Genus database with same CATH homology
 3VK1 A;  3SVC A;  3U8P A;  3VHT A;  4ZF3 A;  2O2B A;  3LVA A;  5F9G A;  4R6D A;  4W6P A;  3GJ2 A;  5DRF A;  3SVU A;  3CBE A;  3P8U A;  4H48 A;  4KF5 A;  4LJC A;  4IZN A;  1H6R A;  3EK4 A;  1G7K A;  4W69 A;  2HPW A;  4KGE A;  4W7E A;  4XGY A;  2IE2 A;  4OY4 A;  4OGS A;  4RTC A;  2OTB A;  1Q4A A;  4HQ9 A;  3EVR A;  2A56 B;  4W6R A;  4EN1 A;  1Q4E A;  2Z6X A;  2Z1O A;  2AHA A;  3DQH A;  3PJ5 A;  1QYF A;  2G6Y A;  2IB5 A;  1MOV A;  4TZA A;  1ZGP A;  4W6L A;  1OXE A;  2AWL A;  3DQN A;  3AI5 A;  4ZB1 A;  4W6F A;  4W7C A;  5DTZ A;  3SRY A;  4XL5 A;  4XOW A;  4KF5 C;  2Q6P A;  4DKM A;  2WHU A;  2DDD A;  3SVO A;  2WSN A;  3SG4 A;  3VHT B;  3ST4 A;  4DXP A;  4W76 A;  4DXM A;  1YHI A;  4ZIO A;  5LK4 A;  4JC2 A;  5KTG A;  2BTJ A;  4PFE A;  3DPW A;  2YE0 A;  3H1R A;  1C4F A;  3U8A A;  5EXC I;  3SG7 A;  1W7S A;  4W73 A;  4DXO A;  2B3P A;  1EML A;  2VAD A;  5DTX A;  5HZT A;  4R6B A;  2YE1 A;  4H3L A;  3V3D A;  3NEZ A;  4RYW A;  1W7U A;  4JEO A;  3LVD A;  1JC0 A;  4GF6 B;  3DQ9 A;  2HQK A;  5EB6 A;  3CB9 A;  4Q7U A;  1S6Z A;  3ZUL A;  3LS3 A;  5FVI A;  2A48 A;  2C9J A;  5H88 A;  4GES B;  4JRB A;  1F09 A;  5LTR A;  5HW9 A;  1GGX A;  1HCJ A;  5J2O A;  2GX0 A;  3ED8 A;  4W6U A;  2G6E A;  1MOU A;  2G3D B;  1W7T A;  1OXF A;  1XMZ A;  4LJB A;  2DUH A;  4DXI A;  2G5Z B;  2QRF A;  1H4U A;  3SSK A;  4PPJ A;  3MGF A;  4IK9 A;  2HRS A;  1KYR A;  2DUG A;  3SVN A;  4IK4 A;  2HFC A;  4W74 A;  5FVG A;  3E5W A;  1GFL A;  4W6J A;  1EMA A;  2V4E A;  4HE4 A;  4N3D A;  2A52 B;  4HQC A;  3OSR A;  5T3I A;  5HGE A;  4H3M A;  2G6X A;  4Z4K A;  3EVV A;  2VVH A;  1JBY A;  4JGE A;  4LQU A;  4W7A A;  3SS0 A;  3GJ1 A;  1ZGO A;  1HUY A;  3SG2 A;  4W75 A;  3SSL A;  3DQ1 A;  3SST A;  1YHH A;  3P28 A;  1YFP A;  4W6M A;  4Q9X A;  2QLH A;  5DU0 A;  1RMP A;  1QYQ A;  3OGO A;  2G3O A;  2QZ0 A;  4L13 A;  3ZUJ A;  3EVU A;  2HGY A;  2P4M A;  3UG0 A;  2AWM A;  3EVP A;  1GL4 A;  3CD9 A;  2H8Q A;  2EMN A;  2Y0G A;  4LJD A;  4RYS A;  4XOV A;  3SG3 A;  3ADF A;  3E5V A;  3NED A;  2V4E B;  3DQ5 A;  2FWQ A;  3U0K A;  5DTL A;  1RMO A;  5EXB A;  3DQ6 A;  3U0M A;  2FZU A;  3RWT A;  4W6I A;  3PJB A;  5DRG A;  1Q4B A;  5HZS A;  3BXB A;  5LTP A;  3SVD A;  3IP2 A;  2HGD A;  3CFH A;  4W7X A;  4KW9 A;  4PPL A;  5AQB B;  4L12 A;  3U8C A;  3DQM A;  2HQZ A;  5BTT A;  2H5Q A;  2IOV A;  4KGF A;  3SSY A;  4LJD C;  1KYS A;  3O78 A;  3A8S A;  4W6G A;  3DQ3 A;  3SVE A;  5H87 A;  3SG6 A;  4DXN A;  4KA9 A;  2G16 B;  4W72 A;  1XQM A;  1EMF A;  2YFP A;  1Z1P A;  1YJ2 A;  3ST0 A;  2WHT A;  3NF0 A;  5EHU A;  3W1C A;  3CD1 A;  4AR7 A;  1YJF A;  3DQK A;  4B5Y A;  2ARL A;  3DQE A;  1QYO A;  3DQ4 A;  2DD7 A;  3G9A A;  2HCG A;  2WUR A;  2EMO A;  3DQO A;  4H3N A;  1Q73 A;  1RM9 A;  3NT3 A;  4B30 B;  2H6V A;  4Z4M A;  2QLE A;  2WIS A;  1UIS A;  4OQW A;  4BDU A;  2AWK A;  2QLI A;  4Q7T A;  2ICR A;  3RWA A;  5BTT B;  2YDZ A;  2G2S B;  3BX9 A;  4W6H A;  1RMM A;  3DPX A;  3UFZ A;  4JFG A;  4W7D A;  1EMC A;  3DQ8 A;  3E5T A;  4XVP A;  3WCK A;  1KP5 A;  4ZF4 A;  2PXS A;  4ANJ A;  3OSQ A;  2FL1 A;  1EMB A;  2DDC A;  3EKH A;  2H5P A;  3H1O A;  5H89 A;  5DY6 A;  3AI4 A;  1EME A;  4IK5 A;  3EK7 A;  2H5R A;  4J89 A;  4W6D A;  5DTY A;  4J8A A;  3DQA A;  4P76 A;  4W77 A;  4LW5 A;  3W1D A;  2VZX A;  5DQB A;  1BFP A;  3CFF A;  2C9I A;  3S05 A;  2H9W A;  2QT2 A;  2PXW A;  4W6S A;  4EMQ A;  2ZMW A;  2OJK A;  3SV5 A;  5EB7 A;  4I2Y A;  3WLD A;  3K1K A;  4ORN A;  1EMG A;  1XA9 A;  2V4E C;  3LF4 B;  3SSH A;  2DUF A;  1QXT A;  1F0B A;  1Z1Q A;  3SVB A;  4AS8 A;  3BXA A;  2A50 B;  3BXC A;  5HBD A;  4OJ0 A;  4EDO A;  4KPI A;  3U0L A;  2OTE A;  3LA1 A;  2A54 B;  5HZO A;  1MYW A;  2ZMU A;  4KEX A;  4P1Q A;  3ZTF A;  2OGR A;  4Q9W A;  4B30 A;  3EKJ A;  4LQT A;  4W6K A;  2Q57 A;  4Q7R A;  2VVI A;  2ZO6 A;  4NWS A;  3CGL A;  3LF3 A;  2H5O A;  4J88 A;  3U0N A;  2JAD A;  4OHS A;  2A53 B;  4IK1 A;  4H47 A;  4ZFS A;  4KW8 A;  4L1I A;  3ZUF A;  3PJ7 A;  3DPZ A;  4ZIN A;  3SVS A;  4KW4 A;  5FVF A;  1ZGQ A;  2IB6 A;  5EBJ A;  2O24 A;  3KCS A;  3LVC A;  5LTQ A;  1JBZ A;  3SVR A;  3GB3 A;  2QU1 A;  3EK8 A;  5EJU A;  1XSS A;  2O29 A;  4U2V A;  1RRX A;  3SSP A;  2OKW A;  2POX A;  5FHV A;  2HJO A;  3DQI A;  3ST2 A;  5DPI A;  2AH8 A;  3TMR A;  2AWJ A;  3DQ7 A;  2A46 A;  4W6N A;  4IK8 A;  2B3Q A;  4W7F A;  3M22 A;  1EMM A;  3DQJ A;  1Q4C A;  5DPG A;  3O77 A;  2EMD A;  4W6C A;  2DUI A;  2WSO A;  2Z6Y A;  3TMT A;  5DPH A;  2A47 A;  4GOB A;  2GW4 B;  3ST3 A;  4PPK A;  1XAE A;  1Q4D A;  4TZG A;  1JC1 A;  2QLG A;  4KF4 A;  5DQM A;  3IR8 A;  4DXQ A;  4W6B A;  5HZU A;  2WIQ A;  3M24 A;  4UTS A;  4KAG A;  3WLC A;  1OXD A;  2RH7 A;  4HVF A;  3DQU A;  1YHG A;  3PIB A;  2GW3 A;  5EXU A;  5BQL A;  2VVJ A;  3I19 A;  3DQL A;  4W6O A;  1KYP A;  3GL4 A;  1YZW A;  3SG5 A;  2Z6Z A;  2DUE A;  4W6T A;  2ZO7 A;  3VIC A;  4EDS A;  4ZBL A;  2WHS A;  3CFA A;  3SSV A;  4W7R A;  1EMK A;  4ZF5 A;  3KCT A;  3LSA A;  3DQD A;  1QY3 A;  3DQ2 A;  5BT0 A;  3NT9 A;  2OKY A;  3DQF A;  1B9C A;  3GEX A;  3AKO A;  2VAE A;  3DQC A;  2GX2 A;  2QLG B;  1ZUX A;  4EUL A;  4IK3 A;  4HQ8 A;  4DKN A;  2DD9 A;  4W6A A;  1CV7 A;  4JF9 A;  5DPJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...