2AHIA

Structural basis of dna recognition by p53 tetramers (complex iii)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
198
structure length
198
Chain Sequence
b'SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*GP*GP*AP*CP*AP*TP*GP*TP*CP*CP*G)-3'
publication title Structural Basis of DNA Recognition by p53 Tetramers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis/dna
total genus 51
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ahiA00
2AHIA 1T4WA 3IGLA 4AGPA 3VD2A 5AOIA 1TSRA 3WTTA 2X0VA 2X0WA 3US0A 4IBZA 2J1XA 3WTSA 3WTUA 1CO1A 2IOIA 5KBDA 3WTVA 3KMDA 2BIPA 4G83A 5A7BA 3VD1A 2ATAA 5LAPA 2WGXA 4HJEA 5LGYA 4AGLA 2FEJA 1GZHA 2H1LM 2IOMA 3WU1A 3WTWA 2OCJA 4AGMA 2VUKA 3Q05A 5ABAA 1CMOA 4IBWA 1HU8A 1GZHC 3D06A 5G4OA 1EAQA 2J6WA 2X0UA 1HJBC 4IJTA 4L18A 2MEJB 3TS8A 4IBVA 5G4MA 2J1WA 4LOEA 5AOJA 4GUQA 1H9DA 2AC0A 2PCXA 2BIOA 1YCSA 2J1ZA 4KVPA 4A63A 4IBQA 4G82A 2BIMA 3D0AA 4IBSA 1KZYA 3VD0A 1EANA 1EAOA 3QYNA 4IBTA 4AGNA 4AGOA 3WTYA 2J20A 2P52A 4MZIA 4QO1B 3IGKA 2BINA 4GUOA 5ECGA 5G4NA 2BIQA 4LO9A 5AOLA 1TUPA 5AB9A 1E50A 2J1YA 3Q01A 2RMNA 2IOOA 3D08A 3Q06A 2ADYA 3D05A 5AOMA 4IBYA 2XWCA 2GEQA 2XWRA 4AGQA 5BUAA 3WTXA 3QYMA 3EXLA 4LOFA 3KZ8A 4XR8C 2YBGA 1IO4C 1LJMA 1UOLA 4IBUA 4L0YA 5AOKA 3US1A 3D09A 2J21A 1HJCA 4L0ZA 3D07A 3EXJA 3ZMEA 4MZRA
chains in the Genus database with same CATH superfamily
2ZXQA 4LKXA 5D8JL 2RGSA 3M88A 3V0HA 2C3GA 3VXRD 3VXUA 3FTUA 3DSNA 1JFHA 1MHCA 3BCDA 3RUGF 4AUYA 4CDGC 4LT7A 5EOCL 2Z35B 3WJLC 1UKQA 3EFOB 2V9QA 3IFOA 1CIDA 2WZAA 5A2KH 1NGYB 2J8UE 1XF5B 1DVFB 4MAUL 1DJXA 2ZYSA 1AXIB 4JHVA 4JPWL 1ADQA 2JELL 4APQC 2BVEA 3EJQA 3UEQA 1ZE3H 3TVMB 4J4PC 1A4JB 5DQ9A 4X5XA 3DIDA 3P0VL 1OM9A 3QJFA 1QYGL 5GHWH 1G9HA 1H6TA 3U2SA 2C5DC 3WNMA 3W5NA 2MWCA 3KPMA 1TR7A 2VE6A 4WENB 4B9ZA 2VJ0A 4ZS6D 4GSUA 3GINA 3NA4A 5D2NA 3S96A 4PP1D 3E7JA 3AT0A 4K8RC 3ZRSA 4B53A 1UFGA 1MCWM 2NY4D 3QJRB 1JK9B 2YFNA 4OLYL 4UAHA 4WWOA 5D7SL 2GK0B 2AW2A 3N50A 4IK7A 1V7MH 3O81A 1WT5C 5D7KE 1HXMB 3DV4B 1K8IA 1N5YL 3CDFA 1NKRA 3L13A 3Q6GL 2NY7L 4OGQC 5JO5B 2OI9B 2FGWL 1EBPA 3PU7A 1ECZA 4XCCH 4HCIA 4F1SA 1RKRA 2WBXA 3MGTA 1RU9L 3Q2NA 3WE6B 4JKNA 1UQSA 3P4OA 5D6CA 3HEIB 3QDJB 4AG4H 5GZND 4KK9C 1QBLH 4HJ1A 4Y0GA 1TYRA 5DMIL 3II2A 1OSZB 3QJZA 1INQB 3OHXB 1K4DA 4NJAH 3VXPB 4B50A 5HDQL 3VXSE 1H0DB 3R1GL 3BUPA 3KNBB 2OLDA 5TD4A 2YRBA 4KJQC 3OMNB 2LOEA 2JKJA 5AW5B 5IK3A 1URLA 4YXHL 5C7ZA 2QVTA 1A6UH 1U8QA 4OCLC 2ZAHA 4HLJA 1KTKE 4H1LA 3W11D 2WYZA 2E75C 3X14B 1T2QH 4NXKA 4OCWH 4PBVC 3ILQD 3VFWA 5EOTA 3QHTC 2EO9A 1AO7B 4NI6A 3GJFA 3EXLA 4U1GC 1T2JA 4PRIB 3SEPA 5JW4Q 4BGLA 3T0EA 3QUKB 1IM9A 3UO1L 1HN1A 4F9LC 3N91A 3BPCA 2CALA 3GSOB 1QBBA 2BOLA 3I84A 1KGCE 2XACC 1CT8A 3RU8L 3AU0A 1H3VA 1JGLH 1EXUB 1HOCB 2VR3A 3KPSB 3WHE1 4LP5A 4P2RE 4TSCH 3LXUX 4GEJA 4NBZB 43C9B 5C97A 3CLWA 4FG4A 4KXAA 4AY0A 3GZOA 5FYKH 2MCMA 3IBEA 2H0JA 4YHLL 1G1KA 1NJ9A 3GS4A 4PJFE 2QGDA 1FIEA 5FHAH 4Z7QE 3LZPA 4EZKA 1A1MA 3GIVA 1KJ2B 4AYMC 2VUYA 2ED7A 3EF7A 4WTXA 5IT2H 1LL1A 3FRUA 5ADPH 4M48H 3UTSA 2ZG2A 3IMRA 2A3TA 3V6BR 4KK8D 3DRQA 1LK3L 5D7LE 1YAIA 3BEVB 3CHSA 1GGBH 3CVHA 1PGRB 5FO7A 1D7BA 2ZUTA 3DX1A 4DP6X 1GKOA 2WZ6A 1A3RL 3CZSA 1JV2B 5D7IB 3FTZA 2APXA 2P24B 4FNSA 2PW1B 3QZWB 4NQCA 2V2WA 4G80A 4HD5A 3FB5A 1R75A 3NSFA 4NUJA 4R90H 2IADB 3PABA 3VMOA 1CI3M 1HAWA 3SQBB 5CJXA 2FHFA 4DK3A 4MXWH 4M9PA 1QP1A 3MRJB 5TQ2H 4ZDHA 5DUPL 1PW3A 4AEIH 3K6SA 1DUZA 4HCGA 2N3JA 5CWSA 5HYJD 2G30A 4NQVB 4HUXA 4G7YL 5F7BA 4WGWB 2TSBA 1S9VB 4LOUD 3AXIA 3O6KL 4TQEH 4JM2A 4JR9H 3JTSA 2BHFA 2IBZY 3JWDL 1JFQH 2DJSA 3EO1B 2F7PA 2UX6A 3MXVL 4JFFA 2DQIH 4UIKL 2ILLA 5GJSL 1OAUL 3KVPA 3ZDZB 1WFNA 3CZLA 5DXWA 1W80A 4KZ0A 1OXYA 1QFWL 3OR7A 4APQB 2E9GA 3CC5A 4H26B 4PY7A 2AJZA 2R83A 3QCUL 4KZDL 2DM3A 4M9OA 5F1IA 1TQVA 2W38A 2C9XA 5C3IA 2KL6A 1CB4A 5C08A 3UAFA 1DR9A 2VDLH 3ZKQD 1XH3A 3MC0A 5IW3A 3L5XL 2WNXA 3QUGA 5D5MB 5KUMA 1SJVA 3NN8A 1BIIA 4F9PC 2WLKA 4XP9L 2CLVB 1KBWA 4RX4A 5D1QC 1WBZB 4IKLA 1DVFD 3ZHKA 4F8NA 5C6WH 4ZXBC 3DXAD 3A6CH 2OL3L 4DUWA 4L8SB 3T0DA 1U8JB 1Y1DA 3ILEA 4PR5A 2UYLA 3WXWL 5GGRB 3ZY7A 1FC2D 3V0VA 1IGFL 1ZLUK 1F4YH 1F2QA 1JF5A 2ZZUT 3BAWA 1OP3K 4OJEH 4I2XA 4NNYA 2WBJA 1PKQB 4ELKB 4PRNA 2X9YA 1AIFB 4O51B 2VDOB 2BCKA 1OHQA 1QHQA 3DX9B 4GY4A 1TVBB 3MJ9H 4QI3A 1CFNB 3ZOAA 5LJYH 1FHGA 3L3DB 2Z4QA 3LV3A 3VFTB 4XZUA 4L4TE 4XN1A 4UUJA 3LZNA 4WW2C 3VD1A 2VDNH 3VDAA 2VITA 2BS8A 2H4EA 3EO9H 4JO3L 2YEZB 5E6RB 1AQ8A 4YSQA 4PG2C 3GRWA 1KIRA 4CMMA 5JNYB 1HYSC 4WO4B 4X6DB 3N1PC 4ZUUB 3A3YB 1LO2H 3V4VH 1ID5I 2OCJA 4ONOA 1N59A 3LXCA 4MTMA 2CO6B 2R0WH 1P1ZA 1DJIA 4PJBF 3DYPA 2HT3D 3QDJD 1RVFL 1WZ1L 2F1BA 1VENA 2VN4A 4QXUH 1U8PA 4AENB 1ERNA 4FXGB 3T1WA 4B9GA 1CCZA 1NBYA 3CZNA 4U2YA 1CXLA 2AV7A 1UD6A 3H8NA 1BQRA 3CC1A 1DQTA 5G5DB 4IRJD 3WSQH 2CBPA 1T1YB 3CHOA 2AQNA 3U0PA 4Q6YA 4O5LH 5HGAA 4DETA 4ELMF 1CDYA 3SDAD 3OZ9L 1BYOA 2VAJA 3T08A 3RDTB 4YXLL 5H2BB 3OKMB 2PYEE 5BZWA 2H6UA 3IYLW 3X13A 2HTLD 2YD9A 4DKAA 4KTEL 2J2ZB 4UT6L 2UWEA 2WGNB 4I77H 4PRID 2GJ6A 5C0BD 2YLHA 3DETD 4KKNA 5E8OA 1TT6A 3GK8L 1OP3H 5A6LA 5B38A 2VZ3A 5C86A 3MRDB 3PXLA 4QXTB 1AMYA 3IVKA 1YSOA 1NEUA 4EO5A 3HG1A 3FO2A 3PAUA 1NMCB 2WLYA 5D2NC 8FABA 2FSDA 5J4MA 3KPSD 1ZGLA 3BI9X 1FA4A 2FWSA 1SXCA 2X4OA 2EINB 2XV6B 4HSAC 4NRZA 1MVUB 1E65A 4RGOH 2Z92B 2C7UA 2V33A 2DQGL 1OF2A 2EIMB 3HMXH 3BKJL 1MFDH 4QKXB 2Y7QA 3MLRL 3BESR 3EH2A 4XNMB 4KKCD 5DD1L 5IVXE 4LPCA 4UQ9A 4DFIA 4BZ1H 2CDEA 4BV1A 1MWAL 1JG9A 1T5XB 4GXVL 1XCQA 12E8L 2P80D 2HP4A 5AKTA 1BFOA 1S5IL 4M7JL 4LRIC 5BVPL 3DHMA 1KGIA 2CMRL 2WNKA 1BQLL 1SDDA 4IQHA 1SPDA 2FBOJ 3LH2L 4IRZH 2R7EB 4U33A 1S7TA 4YSTA 4E9YA 3QEUB 5GS2D 2ID5A 3PXJA 4HUUA 1LYQA 3QEQB 2H1PL 4TNWK 4L3EE 2NSXA 4E0RB 2FIKA 4HJ0C 4WNQA 1CBJA 3KLAB 1SN2A 2N4IA 4WFED 4DVBA 2GSIB 4ZW8A 4HPOL 4DESA 2CKNA 2Z7YA 3PP4H 4W9EC 3Q7JA 4Z3EA 3VYNA 4IIQA 4HWUA 4WV1A 2ERJC 4JO4L 4NWUH 1RMFL 1TQBB 2I9LB 7FABL 3GHEH 3HC4L 2NY5H 1G7LA 2MOGA 4F57L 4MA7H 4N0YL 2WZPD 4O4YL 4UOW1 2AQRA 2J6EH 4Y2LA 5JW5B 3CV5A 4GFXA 3PLYA 2R9HC 4NQXB 1WG3A 3QZPA 2P5ED 2ZOOA 5FKAA 1SJMA 1UA3A 2G3NA 2AXGA 2FSEB 2R4RH 3V95A 2UZXA 3GXFA 1HHKB 4S10A 5FFOA 5D1QB 1A4KA 2K6WA 4ETYA 1KACB 3L3KB 4F7CB 4NKDA 4U1KA 4A7VA 1DYZA 3BZ5A 4WI6A 4S1QH 1VGEH 4R7VA 5C6TL 1EHLH 3AY2A 4K3EH 1J12A 1ZS8A 2VLKD 5E4AA 4QRAA 4XP1H 5DRZA 3QCVL 5IOPB 3K8LA 1RUAH 3C87A 5CLXA 5JIMA 3T9WA 4EDXA 3DJSA 1OM3L 2PYFA 4A63A 5DJCB 1MQKH 4KU1A 1TPXB 4CC4A 1YNTF 3TJHD 3DUSB 3PPSA 2Y07L 4U2ZA 3RTLA 3EDDA 1ZA3A 2WB1A 3MOQA 4C4BA 3NPSB 1KCKA 2AJSL 3FU5A 2AJYH 4FQXA 2D03L 4XMWA 3SPHA 3NP3A 1J9QA 2DQUH 3BDXA 4H5SA 4K9EC 3LEXA 4XP4H 2FD6L 1XCTA 2HXAA 3FH8A 4KRPB 2UZYA 3AB0B 1H3XA 4DW2H 1YQVH 5CJXC 2E8ZA 2Q6WB 1LEKA 4PU2A 4CJ1A 1C12B 3VE0B 5CP7B 5GGTL 3MLZL 4OZ4B 5DK3A 4PGBA 2ETWA 3I75B 3CVCA 4OQTH 4JDEB 2QTVA 2X6MA 3CLFL 5DK0A 1BVLB 4PRPE 2LAAA 4FQPA 4YXKL 4LKXB 3VXUB 1S78C 2Y06H 4HLEA 3PJLA 3DSNB 1MHCB 4X6CA 1UXLA 3L48A 2X4PA 1PPIA 2YGVA 5T5FL 5D2LA 5KVGL 3O0RH 3IFOB 1DVQA 4QRUA 3TNMA 2J43A 5ID0A 5KVFH 4WO4D 2G5RA 5F6IB 3O11A 2OCCB 2ZOLA 2F54E 3AM8A 4X5XB 2HMIC 3VWKA 2B1AH 4B0MB 1V27A 4A2FA 3QJFB 4E2OA 3OX8A 3U2SB 4E68A 3KPMB 3IWUA 1AYOA 3X11A 3G3LA 4EI5C 3DJ9A 3L95A 1CLYL 2VE6B 4RH4A 5F7WC 4ZFGL 4XI5C 3WTVA 4U1IA 2HT4D 5D2NB 3S96B 1NFIA 5J12B 2XTSA 2M1KA 4Q9RL 1S9YA 2RFXA 3A0OA 4WHDA 4FRWA 4AYEC 4TULL 1OANA 3LZOA 4O2FA 2D31A 3RDTD 2MSPA 3HN5A 1P2CA 1NFDA 5F93C 3HLAA 4XWGL 5I1IH 5FUOH 4ANXA 1F2XK 1ROWA 4M8UA 4YOKA 3LKOB 1K8IB 1UATA 5MENA 5G4OA 5CGMA 4LL9A 3UJIH 1MXDA 4YDZA 1YQ2A 3F6JA 5I82A 3OMIB 3MGTB 2A9MH 5GRWA 1QLEH 1EVUA 3B43A 3BP4A 1UQSB 5D4QA 2ODIA 5D6CB 5FW8A 1HHGA 3B9KA 4G8FA 5G4MA 1OO2A 4K07A 2GSGA 3K6IA 5H94A 1K4DB 5HI4C 5EN2A 3ZUNC 5TE6H 1AC6A 4N4YB 4WFGD 3PL6D 5IK3B 1XXDC 3T2NH 1U8QB 4AGOA 2QQNH 3B2PA 2AP2A 5FGRA 4UQIM 3W9EA 3S3DB 4H1LB 3J8F7 4P3WA 3V0IA 5SWSA 4QRBA 5I1KH 3VFWB 5EOTB 5CUSH 4EUPA 2WVVA 5D1ZD 4HOZA 4X42A 3GJFB 4HWBA 2R69L 3T0EB 4TVSa 2QVFB 1AXSA 1I82A 4E36A 1IM9B 1LO0L 5HYSA 1XSKA 4Z9KB 1RP8A 1EZUA 3BPCB 3D05A 3EF4A 3EOYG 1ZANL 1DO5A 4TRPH 3SKJH 1CT8B 3IAGC 1VESA 4DVRL 3ZDYE 3U6XS 4JN2A 3I2CL 2CPUA 3F58H 1GS8A 3P30L 3TZVA 3PQYA 3CSPA 3NIFE 5HI5C 3HE6C 1IIKA 1TTRA 2Q3XA 1B4LA 1SXZA 1MJ7L 4RFEA 2X70A 1XGQA 3IDMA 5CNHA 5FYKE 2WWMD 1NJ9B 1G4MA 3GIZL 3BGMB 1SF3A 1A1MB 2XA8H 3GIVB 3FB8A 3H9SE 1MJ8H 4NJ9L 1YYMH 3FRUB 2EEAA 2ED9A 3UTSB 1YPZF 5F7MC 2Q7YA 5JR1H 2GIMA 1VKXA 3NABH 3DRQB 3ZE2B 5H4ZA 5JQ6H 5DJAA 5D71L 2BZCA 2A83A 3IPEA 2ZP0T 2I7SA 3CVHB 2OSWA 5KJRH 3ZYJA 1MAJA 1PZAA 5FO7B 1JIBA 1SUHA 2F58H 3HAEA 3SQOH 5DQDL 4FERA 1SEQH 1AANA 3FT0A 3OSKA 4OCYH 4P48A 1HH9A 2R29A 2Z91A 4NQCB 2V2WB 4G80B 3IDXH 4M7LL 4V1DE 4NUJB 1H6UA 2JKNA 4HIXH 4NEHB 4XBPB 3PABB 4BBWA 4DGIL 5KBMA 2WP3O 4LSTH 1OTTC 5TH2A 3L9BA 3QZMA 5AFAA 3G6DH 4ZDHB 1XGRA 1X5HA 1QWHA 1GSMA 5E1AA 1OE1A 3K6SB 4OIIL 1DUZB 2GG1A 4YL9A 3IAQA 5CWSB 3GMNA 5CEZH 4LAQL 1KGXA 4A39A 5L4FA 4HUXB 1UEMA 4W93A 1X5ZA 2I24N 3UDWA 3K91A 1P6WA 4AOFA 4ZBJA 1B90A 4JM2B 1MI5A 4KRPD 3JTSB 3U1PA 5FF6A 1BLIA 4H8PA 4RA3A 2YPVL 3ZLQC 4JFFB 4ANUA 1LTXA 1JHKL 5T1DH 4PJHE 3BH8A 4IIQC 1BOGA 1YCSA 3OR7B 2Q5BA 4NZTL 5EIIG 4YSEA 2NT0A 2PP7A 3CC5B 4PY7B 5MEPA 2AJZB 3KPPA 5TF1H 2VGLM 4PMEA 5F1IB 1IC7H 5CZKA 4CA4A 4DEUA 3VXUD 1UJ3C 4P3CH 1L9QA 1IKNC 5C08B 2UXFA 2VLJA 2RACA 1SN0A 1XH3B 5J0BA 1GMIA 2FB4L 4GKNA 3NN8B 1BIIB 4X8CA 1T6VN 3E6HA 2G3ZA 1EJOL 3FZUD 4P49A 4KI5D 5DVNA 1WFJA 3L1FA 4JG1L 2DJ4A 1EHKB 4V2BA 3VGHA 2AKRA 3RKDC 1JRHH 4TPRH 3U83A 2YMTA 3H3PL 2HG5A 1OW0C 4XVUC 4PR5B 2DMBA 2UYLB 3ATDA 3WN5A 5JMRA 1CVRA 5IM7A 1C5BL 3V0VB 1X5GA 4CRPA 3RLSA 2DM7A 5ILTH 3PGDA 1NICA 2VDQB 2ZNXA 5BZZA 4JW3A 1GPOL 4I2XB 4NNYB 2WBJB 4P23D 5FYJU 4HBCH 5EUOE 5KYYA 4PRNB 3ARDD 2BCKB 2VR8A 4QT5A 1KXVA 1UYWL 3TP4A 3UIYA 3UYRH 1WWBX 3V8OA 2Z4QB 4R7NA 2OXGA 3E1F1 3LV3B 1AZZC 1DVUA 4XZUB 4OD1H 1UVQA 3FULA 2MCG1 3A47A 3BSZH 1OGAD 2A73B 2VITB 2FYYA 1WLHA 3DX2A 4QD2E 3M7OA 1FSKC 1FCGA 1KIRB 4CMMB 1EX0A 5LKNA 1BFSA 3NZ8A 1VB9A 3HMWL 4XN9A 3T3MB 3ULVC 4OI8A 1CBVH 3H4FA 2GBTA 1XAUA 1RZQA 4LCWE 1P1ZB 2NDGA 2WQXA 4G8AC 3WTUA 4GPVA 1H19A 3LNEA 4JQXA 4LEXH 5GRUH 4Q0XL 4RWYL 1U8PB 2G4GA 1L9PA 1PG7L 2D3JA 2ESVA 2ATPA 2AV7B 1IC4L 1P7HL 4S11A 1EJFA 3UG4A 1MG2C 4MCYA 1IGML 2X09A 4BXSV 1GVIA 1KCVH 2DBLH 3U0PB 2AVFA 4Z7UA 3QFDA 5HGAB 5BW7A 3ARED 4PRHA 3PV7A 1ASPA 2HUHA 3CMOL 2XHNA 3RIFF 4I1RA 3CPUA 1LE9A 2F7RA 1AS8A 5BZWB 2HPOA 4LNRA 3VWKC 3X13B 3CDZA 4K23L 4QGTA 2UWEB 3T0ED 2QEJA 3PGFH 2GJ6B 4GRLA 5BZDA 5E8OB 4QTHB 5B38B 2APBA 1E2ZA 4XB8A 2QLVB 4ACTA 1N4XL 1PZ3A 2AC0A 3IVKB 1VZIA 3HG1B 3FO2B 4IHOA 1P4LA 4ODTH 4V2CB 8FABB 3CFCL 3S5YA 1UXSA 4N68A 1B2YA 1ZGLB 3OKKA 1TZGH 2X4OB 3P4MA 3IDUA 4NRZB 4TUJA 1EHAA 2C7UB 3AAZA 2DQEH 1OF2B 3TO4D 3NDYE 2Y7QB 5DO2C 1DQLH 2LHAA 2GTZA 1XH1A 3CMGA 4BFKA 1L9TA 3GLDA 4OF6A 2CDEB 4PJXF 4H8WL 1ZHNA 1XCQB 4LZKA 4UQCA 1BFOB 3ULVD 4ZK8A 3D3VD 1CE6A 4XC1L 4XMPH 3ORJA 2FQDA 1MEXL 5B7EA 4A7GA 4I48A 1SDDB 4PTUA 4YN3A 3VXTA 3FUNA 4DSYA 3N44B 4BXVA 1S7TB 4PJDE 1IGCL 5IBUG 2CBTA 4HUUB 4FFYH 4XBGA 4IEFA 4Y1SA 2J57A 4F8TA 2WBWB 5HJDA 2FIKB 4LHQB 4DVBB 1HZHH 4UOZA 1NBCA 1RFDL 3KLQA 3HIZA 3US1A 1F3JA 4EF3A 3I6SA 4IIQB 4FNTA 2X6CA 4OZFB 4WV1B 5HHVH 1NC4A 2WIIA 1ICTA 2CR0A 4Y5XA 4OCRL 2WXKA 4AE1A 1G7LB 5I19L 2ZE0A 1BZEA 5IV2A 3ULVL 3WEBA 2Q87A 1MQ8A 4KXZH 2QKSA 3HJ0A 3KM1A 1W0YT 1EEYA 1VEMA 5AZEH 5FKAB 2V9TA 2I27N 1M3JA 1C7TA 1I8AA 2ARJQ 2AXGB 4LARH 2UZXB 4WHTA 2F74A 2O61A 3AMKA 3K6OA 1OPGL 2IOIA 2E9BA 2XPYA 3HS8A 4HZAA 4CVUA 1A4KB 1H15A 4ZTPH 4ECNA 3H42L 4NKDB 2BZDA 3NRFA 4U1KB 3SD2A 1BAGA 4Q7DA 2WXMA 1CDCA 4HWEL 4DZBA 1DQML 3GSNH 1ZS8B 4LLDA 4NX0A 3HR6A 3P73A 2VLME 2GW5A 3N85L 4HOXA 3JZ7A 2DEYX 1HU8A 4EDXB 3TASA 2F8IA 2PYFB 4JRYA 2CLRA 4DO4A 3EJCA 3OLIA 1ZA3B 4N0CC 2Y2YA 4UT9A 4AMWA 4XOBA 4YGVA 4RX4D 2WXPA 4FQXB 1RZKH 3L5WA 3W81A 1E43A 2CO2A 4H5SB 4ELDA 3LEXB 4AJWA 3KPLA 2WUCH 1XCTB 2XC8A 2X6BA 2EP6A 2UZYB 2V3DA 3D4GA 5DD5L 3HI5H 3N9GL 2A4EA 3V4PA 5GS0H 1FHNA 1D9KA 1LEKB 1DBBH 3JWNH 3GMQA 1ODAA 3E2HC 5DEGB 1MPAL 5CZVH 5EC1A 2FBJH 2IPKB 1OKEA 4AIEA 5I76A 3QYNA 1NCDL 1V7NL 4PGBB 3L7EA 4ACPA 4UNVA 3MLUH 3NESA 2B77A 1FV1A 3QFJA 2NR6D 4EBQH 1NAKL 4GG6A 3SDXF 1T0MA 3BUYA 4LCCA 4UV4L 4J3OD 2VQ4A 2OJEA 3RZWA 4X4YA 2VDRL 4X6CB 5F9OH 2X4PB 3TN0D 3I6LE 5D2LB 5A16A 3BXNA 1TOXA 5AYUL 3HW7A 5CFHA 4JKMA 4L48A 4QRUB 2HKFH 1E0OB 3G6JE 4UT7H 3TNMB 3QXWA 5ID0B 4JO5A 3O11B 1S7QA 4LMQE 2W80C 2Z7WA 2ZOLB 4N2BA 3VWKB 2CBOA 2HTKD 2CXKA 3MLSL 5TK2A 3OX8B 4G8EA 4XR8C 4AI7A 4P4RA 5JYLA 2W0LA 1E4KA 2AJUL 3X11B 3KEDA 1V3JA 3P2DA 3L95B 2OR8A 1QYGH 4JZNA 3UMNA 4U1IB 1MFEH 1NFIB 3HC2A 3QDAA 3BWSA 3CU7A 1S9YB 5MHSD 2RFXB 2V9UA 4N2DA 4O2FB 4RZKA 1P2CB 1NFDB 4PJHB 3HLAB 3TV3H 2BFVL 5I6XB 3ET9F 3WN5C 1HCYA 2TRYA 5MENB 5ECJE 3U0TA 4TVPD 4LESA 2NY5C 2ORBL 2DLGA 1UUSA 4PVNA 3S2AA 2ZUYA 3BP4B 4NP4L 1KXVC 2G3MA 4ERSL 1HHGB 2QDWA 3B9KB 4G8FB 4OCXH 5ADOL 4HKZA 2EXYC 3ZJAA 4MJ4A 4OTXL 1F90L 1RU9H 2GSGB 4MCMA 5H94B 4U1NA 3AU1A 4QXGL 5EN2B 2QL1A 1A3LH 4PCTA 3WFZA 1ZS2A 2PNDA 4DKEL 1GHFL 5FK9A 5JXEA 1OEZW 3PF2A 4XVJL 5HDQH 3FH7A 4WU7A 2L0DA 4LHUA 5DD3H 4JAMA 3W9EB 2AGJL 1QFOA 5SWSB 4KQ4L 3QDME 3V0JA 1KUMA 2HVJA 4TVPL 2C4XA 2IAMA 3MVSA 3HB3C 4EUPB 3KCPA 2WVVB 3QHFL 1SLUA 1KIUA 1MW3A 4HISA 2NTSP 1AXSB 3OG6B 3CSBA 4NZJA 5HYSB 4ZRGA 2APVA 1XTMA 5DZLA 1EANA 2YA1A 3FH5A 2L8AA 2NQCA 1JDDA 1BYNA 4FX5A 4JN2B 2QLYA 1IT9L 3OD3A 1UWFA 1T80A 1IZKA 4BWUA 3RU8H 5BW7C 3TZVB 3PQYB 3TL5A 4AQEA 5JPNA 1GIGH 1L7TL 2X9ZA 3DBXA 4RFEB 5DHYA 2X70B 1XGQB 3IDMB 1DQJA 2K6YA 3PPEA 1H5BA 4XOAA 4LLYA 4GQPH 3JV4A 2E6PA 4L9DA 1RJCA 5HVHC 3FB8B 4JRFA 3UG5A 4L05A 5AAMC 3NJVA 4PJEA 4PB9L 3BPOB 3BVNA 3VGAC 1I9RH 4AV5A 2Q7YB 3NCYP 2ZXEB 1VKXB 4CMHC 4TQ8A 4JPKL 1E3XA 5DJAB 4R4BA 2A83B 3Q48A 4DF9A 4HT1L 2D3VA 4M7ZC 1NCHA 4G6ML 5CGYD 3HAEB 4EEEA 4ELME 3HE7A 3FBQA 4GRWH 1HH9B 1BSIA 2OJZL 2KZ1B 1OE2A 3B5HA 1XQ4A 2P49B 3OJDA 4JKPH 3GXIA 3PNWA 1RQ5A 3CG8A 5DT1L 5TH2B 3S36X 4Z7NF 2CZNA 1FGVH 4JG5A 5HHOE 4H88H 3IDNA 1XGRB 3TIEA 5E1AB 1BZ7A 5DZPA 3GRGA 3LEVL 3Q1SL 3PWVA 3GMNB 4P46C 5JZ7D 1KEGL 5CEZE 3JZYA 4IBLT 5CJQH 4DK6A 4EKJA 3ECBA 5F9WB 4YR6A 5E2VL 2X3AA 3O2VL 2VR6A 2VH5H 1MI5B 2A99A 5FF6B 3VG9C 1NBZA 2EH7L 2EILB 2ZCKH 3WKMH 3RWFA 5DZJA 2P8PA 1CFVL 1NCAL 5F7LB 5TQ0L 3K71A 1XGUA 4L5FH 2I25N 4KQ3H 1U8MA 1IUZA 3BH8B 3QI9A 1BOGB 4FTDA 3S37X 1EO8H 5JQIB 1RZJL 1KEML 1AZRA 5MEPB 1WA2X 2BSTA 3KPPB 2CRYA 3T6WA 1JOIA 1QFWH 3S3BB 4R7DA 1RURL 4N86A 1PLGH 3OAYK 3DK0A 2VLJB 4NKIL 4AC2A 2MOVA 3EYUL 3QQ3A 3BWZA 1TJMA 2XIBA 4GKNB 2O72A 3E6HB 1WJ3A 3ZVVA 3LAFA 1NOAA 3QWNA 2XVGA 5CU5A 2AKRB 2VL5A 3D39E 3MA9H 4X6BA 3TFKC 3WELA 2HG5B 4LGRB 4GYBA 4XO9A 2Y2TA 3WN5B 5DEFA 4TMPA 1HAUA 5IM7B 2NRDA 3SDCC 5GRVL 1ZLVH 3T0WA 4D9QE 4BUQA 1CR9H 3PGDB 2H6OA 1VZGA 5G4NA 5HDBF 4I9XA 3S8GB 3BN9D 3ZTCC 4BZYA 1ZGLM 5IOKA 5KS9E 4M62L 5E8NA 5KYYB 2Z64C 3LRGA 4QT5B 1EIBA 1XB3A 4H40A 3VMPA 3WEMA 4N25A 2OMUA 2VOTA 2O5ZL 2OXGB 2YR3A 4R7NB 3WIFA 3PUUA 1UVQB 3ZTJG 5CD5D 1EAJA 3IDYB 2FYYB 2CK0L 4HCFA 4QLRA 4Y19E 4X99A 1D9KC 3TA3A 2Q7AA 3FF7A 1GGYA 3DVNA 3VH8G 1HE7A 1SHSA 4WAFA 1GYAA 3NZ8B 2EDDA 4OZIF 2W07A 1OD9A 1J8KA 1F41A 1A9EA 1HH6A 2YQ3A 1WEJL 2AMUA 3IWVA 3LYRA 3V7MA 1PY0A 4N2OA 3B9KD 4EE2A 3OAYH 2DLTA 4DP9X 1L6ZA 3L9YA 3Q8EA 2ESVB 4O02L 2ATPB 4X80L 5F89A 4MCYB 3LXAA 3B7SA 3O4OC 2K9UA 4UQBA 3LKQA 3O2WL 4Z7UB 2G2NA 2HLFC 3QFDB 3RTQA 3UACA 1F42A 2D2OA 1UD2A 1AG6A 1AQDA 3GDBA 3BH9A 1LE9B 1E27A 4LNRB 3GI9L 4UM8A 3DI3B 4JRXD 4LP4A 3CDZB 4GW5A 2Y1VA 3ZKMD 1HSBA 3ARUA 5C07A 5HVHB 3FT9A 4GRLB 3SOBL 5BZDB 4XPHH 2IOMA 4ZUTA 1FFNA 3NEXA 4QF1A 4IHOB 2WXNA 1P4LB 4HULB 4HMCA 4JQIA 3GK8H 4CMHB 1J5DA 1UXSB 2CGRH 4X98A 3EJZD 1S7RA 2C7FA 2DYPA 3OKKB 2ZF8A 3BT2H 3GJEA 3P4MB 4DQOH 3PQYD 1I7UA 3MHZA 5FM5M 5E6YA 3AAZB 4NLAA 2BLFA 3UPCA 1XF2A 4JFDE 1NCIA 4XNZB 2GTZB 4IKJA 5DF0A 2KPWA 4PJ8D 3Q44A 5IJVA 1XL6A 2W9LA 2VR5A 1ZHNB 2IIJA 2XRAH 4LU5L 4YHZL 1FE8L 3LN5A 5DD1H 1CE6B 2XN9E 3UTPE 1DLHA 1PTZA 3M46A 3RVUD 3B9EA 3CPLA 2CLZA 3NIGF 4U31A 1UM4L 4I48B 1GOGA 12E8H 4PTUB 1R6VA 2EC9U 5EIQA 3VXTB 3ECUA 4U6TA 4AE0A 5BVPH 5B7MA 2KHAA 3NFNA 5DRXA 2HJLA 3WIIH 2YAHA 3KJ4B 1UXMA 1I3RA 1TU2A 4XBGB 4IEFB 3FTVA 1CZ8L 2JWYA 4X8JA 5K1VA 3VG9B 1UHVA 3W82A 1A64A 3O3AA 1QI4A 4M6AA 3WMPA 2WWKT 3K72A 4YHKH 1SFDA 4AMKL 2H1PH 3LCYA 1PNDA 1F3JB 3JV5A 4Z7WA 5FUZL 2WLZA 1NC4B 2WIIB 5F88A 5T3ZE 2IAMC 4LVHB 4Y5XB 3ISRA 4P2OA 1KPRA 4FNLL 2B4CC 1W72H 5IV2B 2CE6A 5J6SA 1SRDA 3EHBD 1R1CA 3BH4A 4FTVA 2YPLD 2B08A 1RMFH 1E7UA 4HS3A 4M4RA 5D6DC 2W9EL 1MI5D 5GGVL 4N3UA 1EEYB 3QISA 5EA0H 3OKOA 2F19L 2O61B 1OSYA 4WHTB 2F74B 4ODSL 2VSDA 4TUKL 3VI4A 1H15B 2NUTA 1J0KA 3VQ1C 1FNHA 4J3VA 5I8KL 2LFEA 2DI8A 1FL5A 5HPOA 1C5CL 5IB1A 4DZBB 1H5BC 1R3KA 4LLDB 1X5MA 3GPSA 5SWQA 1XD1A 1HESA 3P73B 2KQNA 4PB0L 4DGVL 4B6ZA 2CKBH 1B0IA 1QW9A 2QTEA 2R0ZH 3LIZH 1WFTA 4KI5F 5C6TH 3SDCB 4ALAH 5F3BA 1EAPA 1L9OA 1YZZA 3L4YA 3ZHLA 2CLRB 4ABQA 4NFBA 4XPFL 3MV9A 1X5JA 4N87A 1T66D 1OM3H 1F58L 2L7JA 1KJ3H 1FGNH 3L5WB 2Y07H 4KJWD 2ICES 3KPLB 4N8UA 1MCFA 1M1SA 4KK5C 3FQ1A 3OKYA 1H8SA 3G04A 3ZE0E 35C8H 1KENH 3NK4A 3LNFA 3V4PB 1E90A 2JIXA 1D9KB 3O6FD 3TH4T 4FABH 1CF8H 3GMQB 3JWNE 2R23A 1AZUA 3KPRD 3NCCB 4HETA 4K4KA 4JY6A 5EC1B 1LM8V 2FX7L 5I76B 4LSQL 1I3GH 2DLFH 3VXMA 3L7EB 4C4KT 3T4AC 4X6EA 5GGTH 1FV1B 3QFJB 5SWZD 1VFMA 4M6OL 5E9AA 4GG6B 1DBML 3EFFA 4YSRA 1T0MB 2P47B 4LRNH 2ZYIA 4BKSC 2YGOA 3BUYB 4LCCB 3OM3B 5AVQB 1ZIBA 3M07A 2OJEB 3QUYA 4GSDL 3NJIA 4X4YB 1JGEA 1MNNA 3HRZC 4WUKL 5ALBH 5A16B 4ES8A 5EEXA 1KB3A 3NH7H 3BXNB 4GI9A 4XMKL 3O4OB 1QRNA 2BO0A 3QDGE 5T5FH 3UZQA 2DQHH 3QI9C 5C0JA 1EGJL 2CM5A 1S7QB 3FN0L 2BSRA 3BPLC 1RAMA 1INEL 3NCMA 4UZGA 4XHJC 3SYQA 3NCXA 4XE5B 4MBOA 4XNDA 4QRPA 1FL6A 4G8EB 2N59A 4P4RB 3WS6C 4M02A 4BK5C 2ZX7A 3IDJA 4DH2A 1BECA 2A38A 1KT2A 3HG3A 1VERA 2DDQH 4RZCB 2CCWA 4G5ZL 4MRBA 1QSFA 4ORGA 5JQHC 4JHZA 1W8OA 2JJVA 5T3XD 2QSCL 5EF1A 1KBPA 4PRHD 1LK2A 4FQCL 4XCNA 4EDWL 1R9FA 2OA9A 4YNYA 3KYMA 4BCZA 1O6VA 2JCCA 5E70A 2FECI 4F2EA 4LBEA 5E5LA 5DLLA 3CXDH 4A04A 3P3YA 1N6VA 1MIML 5J5EA 4ONHA 3WCYA 4OCSL 5FCSH 5CINL 3U0TB 1CYXA 4XWGH 1REIA 1SZNA 4A6YA 3FSZA 1A6WL 4EZLA 4MWFA 1EFXA 3ARBA 3BIKA 4QIRA 4N90E 3MGOA 3L08A 1KIPA 1BVOA 3B2UC 3L45A 3L5HA 3F12A 4HKZB 1RCYA 5I1HH 2DTSA 4DPCX 4TNVK 4U1NB 3CFQA 1OP4A 2YXFA 1YUKB 3AU1B 5T3XL 5HDLA 3ULVF 4PS4H 2OK0L 4F3FA 2UVEA 1I1AA 2WQVA 3M7FB 5FK9B 2NYYC 1DSFH 1AI1L 4WU7B 1A7PL 1E5YA 4BQCA 1T0PB 4JAMB 4TTDC 1GJIA 4NHUA 2HVJB 5EEYA 2IAMB 2YD7A 4K0OA 4GIPD 1RUQH 4LSRH 3KCPB 3ZKXC 5IMMA 5KW9L 2XV0A 1KIUB 1OVZA 4DP4X 3F84A 4K7PL 1EWHA 1J0IA 1VFAA 4G8GD 1UGNA 5BO0D 2XV2A 4FL4C 2R69H 1PAMA 5AKSA 2E6QA 3UABA 1BF8A 3HKZA 4HVBA 4M5YL 4LL1A 1F4XL 2GBUA 4G3YH 3T5WA 2CUMA 5I15H 4PJ6A 4Y19B 5FECA 5SX4I 2QVKA 1HNFA 1JI1A 3H7LA 1X9LA 3JWNC 4AQEB 5A2BA 5JPNB 2E8YA 2GUOA 1NC4D 3DBXB 5DHYB 1N7ML 1OT4A 1DQJB 3ISWA 1H5BB 2E7DA 4LLYB 3WYRA 1JMZA 5DVKA 3JV4B 3K2UH 4L4JA 3VU2A 5KN5A 3VFSA 5LQBH 4GP5B 3N1MC 4JPIA 4PJEB 4Q4EA 2YUZA 5BMFL 5FWQA 3BVNB 4ENED 1AXTH 5DUML 1DL7H 1KTLB 4MZIA 4ZG1A 1D7DA 2VXTH 1UOVA 4HHGA 5DHVA 2AK1L 3RB5A 4R4BB 5FX3A 4YUEH 3MRPA 2DQJL 1MCPL 1U2HA 2Q76A 4XE0A 3HE7B 5FCUL 2OMWA 3D9AL 5D71H 2BFGA 3I9GL 4JRLA 5DK2A 5I6NA 4GRWE 4LIQH 3RBGA 1G7JA 3OJDB 3IM1A 1L0YA 1OZUA 3PNWB 4JCMA 5KSBA 1CTOA 3SO5A 2JFCA 2EYRA 4HX1A 4DOHE 2HH0L 2XX0A 3DMMA 3O45A 4JRYD 1DCLA 3IDNB 1SEBA 3TIEB 4F93B 1BZ7B 3QORC 2XXGA 2G60H 3S2CA 3ZMNA 3PWVB 4JFSA 5I8CB 5J06A 2JKTM 3M6DA 3ZTJH 2TRHA 4L0YA 1J86A 3C09C 2F61A 2A6JA 3DOSA 3ECBB 4YR6B 4AC4A 4OIIH 3FU8A 2BZ7A 1JTTA 2AQQA 4LAQH 2IBBA 4JUTA 3WG7B 1WICA 1NBZB 3Q3GA 4JGJA 1H6FA 1P9MC 1SDAB 2P8PB 4KH2A 2AJVH 3K71B 1XGUB 2CGYA 5KEZA 5C09A 1MIEH 2ZCHH 3UAEA 4L5FE 2DQDL 3QI9B 3Q9PA 4KTDL 3EYOA 3HZVA 3U1SH 2QPDB 5ISZE 5IB2A 2BSTB 1HYRC 1AHMA 2IQ9H 4JM0A 5AVTB 4R7DB 2BVPA 3BO8A 4JGNA 3APNA 4HALA 3VI3E 3VSVA 3QQ3B 4ESKA 2OULB 2KLRA 4AX3A 3NIDF 1FZKA 2Z65C 3OWEA 4EOWH 4YE4H 3D06A 1TJHL 3LOWA 1MY5A 1NSNL 3RWDB 1B3JA 1DUYA 4XPGH 4QRRA 2VL5B 4X6BB 1HJBC 1EJOH 5GGUA 2UXGA 1ZLSL 4UINH 3B2VH 4FMKA 5IHBA 5EBLB 1CICC 4B96A 2XYCA 4XP6L 3BDYL 1TQUA 3CZGA 3IMVA 3H3PH 4LOEA 1ZVSA 4FZ8H 3MBXH 3NZHL 1CGXA 2F18A 1CUOA 1MFCL 1XMEB 4OI7A 5E8NB 3OR6A 2OW6A 4C56A 1I7ZA 5CCHE 1KZYA 1KXTA 4MJID 5KSUA 3LXBA 3WIFB 3GDCA 5IFAH 4J3WA 3NGBB 4YHIA 2R0KL 4AEHL 4KZCA 5E2TL 3AQYA 4X99B 1QACA 3TA3B 5CFAA 3DVNB 5CZXD 2P46B 5L4IA 2W07B 1A9EB 1ADWA 1HH6B 3MV7A 4M7KL 3B6SA 1YEIL 3UIZA 1OARL 3BKCL 3ZKNC 1H6EA 1X9UA 1CG9A 2FVNA 4ZNCD 4GSXA 3QJHA 4WSKA 3ZKXB 4N24A 2PWFA 2UVFA 3HFFA 4QR7A 5T1KA 3OPUA 3C08L 4D3CL 2FAUA 4OZHA 5F89B 4YK4C 4J3TA 1YMMA 1N12A 1D5BA 3LKQB 5JXED 3RTQB 4ONGH 3L54A 1V05A 1J0HA 3QE5A 2EDOA 1AQDB 4LHUD 3TBSA 3U36A 3ULAB 3BH9B 15C8L 3PWPE 1E27B 4TLTA 4UM8B 3VFPA 4WEBL 1U30A 4M5ZH 1DTUA 1WBYA 2G5UA 3EYSL 2R8SL 4GW5B 3WFCL 1HSBB 3EFDL 4N2GA 4NFCA 5E2JA 2HT2D 5EV7A 5C07B 5IJKA 1A9VA 3IETA 5CAYB 4U6VH 2HX7A 4ZUTB 2F53A 1FFNB 4QF1B 3EH1A 3WE1A 4LSDA 2ICWA 4E9QA 1ML0A 2VO5A 2DIJA 4X98B 1S7RB 2DYPB 3QG6A 3NCJL 4LVOC 4OV6F 3GJEB 5JDJA 2QPSA 1I7UB 4HJIA 3BGAA 2HN7A 2WQRA 3ZO0A 3MLXH 1MCQA 5CR8A 4M5SA 1XF2B 1PEZA 3U6XA 4XBMA 5ICXA 1QA9A 5DQJA 2Y23A 4NQTA 3H0TA 1EBAA 5DFWH 4C55A 3MAWA 5IJVB 2Y3NA 4W68A 3LNGA 4GFTB 4GUPA 3DO3A 3ARBC 5FYJE 3CSYA 1A22B 4F2MA 3OJVC 3LN5B 4GXUN 1NH6A 5ICZA 1DLHB 3IMWA 3MXWL 4WQOA 3ZIMA 5CEXA 3CPLB 2CLZB 3HPLA 5ABZA 1J5CA 1EXHA 2WNWA 1U36A 3MLVL 1HWWA 3C09B 5AYTA 3RB7A 1VF5C 3ZE1E 4AYSA 4S0HA 4KVNL 3NFNB 5DRXB 5I73B 3HE7D 5EHFA 3WIHA 1I3RB 1TU2B 3SGJC 5AW2B 4X8JB 1GJUA 5HHPA 3BZEA 3O3AB 3FPYA 3MRRA 4I88A 3HUJF 1I1AC 4KX7A 4U6XA 2CDGA 4YZFF 4TS6A 4GKOA 3ZSTA 1KYUA 3ABMB 3K72B 4KRNA 5TPWH 2FWOA 3KYKL 5B39G 3VD0A 4YFLI 2WO2B 4Z7WB 4CVWA 3EUDA 5EU6A 4JFYA 4YBQD 1YEEH 1HZLA 5F88B 2E74C 5EU3A 3LPWA 4XX5A 4OB5H 4P2OB 1KPRB 3EJPA 4FTVB 5ES4B 1R47A 4HS3B 3B1TA 4M4RB 1AE6L 5ACMA 3JWOL 2NPLX 3WJJA 3CFMA 3GO1H 3LX9A 1OV8A 3OKOB 2XWEA 4FFZH 3L7FA 1RUPL 3W0WA 2WWNA 3AZUA 4Y88A 2AAAA 3M1CA 4PJCE 4PCSA 3VI4B 3HTLX 1YEHH 1NC2A 2NUTB 2XWXA 1DJZA 1KLGA 2EDWA 4G7RB 1FL5B 4I89A 1J1PL 4NQEA 4OFDA 1MCIA 5IB1B 1R3KB 3ES6A 5SWQB 1JL8A 2W9DL 3KL0A 4OKDA 5D96C 4KHTL 3V6OA 1ECYA 4ADGA 2OCFD 5AYQA 3BAJA 3GHBL 4ZD3H 1UWGL 1EAPB 5F3BB 2A1WL 4ZX5A 4GAAA 4URKA 4BINA 5L2KA 4IDJH 3VRIA 2JMRA 2Y7NA 3MV9B 5ETUA 4KMLB 4UOJA 4QHPA 3O4LA 1CK0L 4KHXL 3IJSA 4L3FA 4XOEA 2M8XA 2VXQH 3ATAA 1TSRA 3UBGA 2H2PD 3G04B 5DJ6A 1PFOA 4QAMB 4XVSH 2JIXB 1ACXA 3BWAA 3KMDA 4ZW6A 3VCLA 2P7TA 4CVXA 1P0SE 3OV6A 4G6FD 4WJKB 2R23B 5DD5H 3PGCA 2IJ0C 3N9GH 4JY6B 1U4EA 3K6FA 3VXMB 3WY4A 4EN2A 3WHE0 2HUEA 4X6EB 1U4FA 2V2TA 3MCLL 2JB5H 3C6LC 4QHNA 5M95B 3O2DA 3ESMA 2F5BL 4N2NA 3EFFB 1QBML 1L0XA 3OF6D 4DP8X 1I8IA 1J8HA 1M1XA 2GC7C 1BEYH 3QUYB 3WLBA 4ATWA 1JZ7A 1JGEB 2AK4A 1PZUB 1WISA 3X3GL 4D8OA 4UV4H 4WWKA 2NY6C 3QUZA 4DAGL 1QRNB 2VDRH 4NO5A 1PLBA 3UZQB 1FAIL 1OSEA 3Q2VA 5C0JB 5ITFA 2BSRB 1PJWA 2AXHA 1X7QA 2B0SH 4JHWL 4UBDD 4W1TA 3ZDXF 3T1FA 3Q43A 1HX0A 4JN1H 4EVNA 2CJ3A 2FCBA 1I8MA 4KVPA 2AS5M 3HHMA 4H8QA 4QRPB 1FL6B 4QTIL 3RX7A 1OTUD 3B8SA 1JGDA 4N26A 4P5RA 5LNDA 3UEZA 3IDJB 1T5WA 3VXSD 1KT2B 4N6RA 3F8UB 1INDL 3QNZA 5F96L 3TJEL 4MHHG 1OB0A 3GXMA 3ASNB 5FGCB 1QSFB 3WDJA 3QAQA 5BV7H 1NGQL 4LVOB 3P02A 3TTSA 4OBRA 4TQPA 5JOPE 1LK2B 4KX9A 4XCNB 2PETA 1MCOL 3DECA 1JWSA 2AITA 1S4IA 3MRFA 3TT3L 3X1GA 3WHXA 4YNYB 2ZPKL 3KYMB 5IQ7H 2JCCB 2ADYA 4LBEB 3BE1H 5B1BB 3LRHA 4ONHB 1A7OH 4OM1L 5TDOA 4AL8L 3IPBA 4UIMA 1DBAL 4A6YB 3WY1A 3Q13A 4MWFB 1C8PA 1EFXB 3ARBB 3BIKB 3P54A 5AQ0A 3RUGA 5DVPA 4NNPL 3DI2B 1LP9A 2E9JA 1T21A 3MGOB 5A43C 3IE9A 4XPAH 1KIPB 1P5UA 4P2RD 2K8MA 4KRMB 1S8DA 3T0VA 3F12B 1T83A 1TFPA 1KELH 3QJTB 1SOXA 2ITCA 1QEWA 4NM4H 3V8CA 4R26L 1GGIL 4KY2A 1BVKA 5ADOH 3D09A 4RMSA 1OSPH 4OLVH 1VLXA 1J1XL 3P4LA 4WJG3 1YVLA 4F3FB 1I1AB 3H9YA 4FQLL 2VDPL 1NTDA 2AEQL 2HVBA 1ET8A 2K0RA 2ZICA 4DKEH 3IU4L 3EYVA 5I1CL 4NHUB 3V52L 1FO0L 2AANA 2YGNA 2X0VA 2X0WA 2X9WA 4K2UL 4ALAC 5IMMB 4G6JH 3F00A 4FI8A 4OZGF 3ULUH 4KQ4H 5FKPA 1EZSA 3M86A 4PJGF 4Y2DA 1VFAB 1UASA 3UGEA 2ATAA 5D7JC 1JGUL 3VACA 3SY0A 1O6TA 5D9SA 1JK8A 4AJYV 2FX8H 4YQXL 2WKOA 4E41E 1BWMA 3QG7L 3MNDA 3EJUA 5EZIL 5FECB 1X7SA 1KCUL 3DJRA 1NGPL 4WY7L 4KX8A 3FT3A 5E6ID 5AVSB 1LEIA 2ZJSH 2GUOB 1S9KC 2V5TA 3TWCL 2E7BA 3D1MC 4JK0D 4P2OD 3LRLA 1SXBA 5KN5B 3VFSB 1CPUA 3L2LA 4FTVD 5KYUA 4JPIB 5L8KB 2W0PA 2X2YA 4QNPF 4G9FA 1FF5A 2MEJB 1IQWH 4KROB 5FPIA 4TQIA 1I9JL 1QTYT 1CD8A 4HK3N 4N22A 1IGYA 5DHVB 4GAJL 3UJTH 5DGRA 2CJTA 3MRPB 3DUUA 1SYVA 2Q76B 4NCC1 2VUOA 2OMWB 5DK2B 1UUNA 1YJDL 4JO2L 1R3LA 3GQFA 2GYSA 1OAYL 3TNNA 2X3CA 3BMVA 4G6MH 1G7JB 5DMYA 1LE5A 4LIQE 4KWUA 1YEGL 2GABA 5KSBB 2EYRB 2PPEA 1XSOA 2FHBA 4HX1B 1R3HA 2OJZH 2IGTA 3F6IA 3DMMB 3O45B 1SEBB 1KWGA 4C4KO 3CHPA 3MUHL 3MV9D 1ZDSA 5AOMA 3C6LB 4FP8H 3QIWC 2N0MA 4NQDA 4Z8FH 1OCWL 2A6JB 3DOSB 2JQAA 3LEVH 5DHDA 2IWFA 2RTTA 4XNUH 4OGAD 1XIWA 5I0XA 2E86A 1BBJA 1YEFL 4HUWA 3Q3GB 2X87A 1SNRA 2DQTL 4O2CA 5E9DA 5E2VH 5IB4A 2CUAA 3KZ8A 1RULH 4ZMOA 3G9AB 1M2VA 1RD6A 5C09B 1JZIA 3LKNA 1RIVL 3EYOB 4N85A 1NCAH 3HZVB 2WXQA 4TTGA 5IB2B 3BW9A 1Q38A 4OQTA 3MRIA 3UJJL 3MROA 4MQTB 1RZFL 3DOIA 1RIHL 5HYEA 1MRFH 2BVPB 1BREA 1G9NC 3BO8B 3NSJA 4NZUH 3TT1H 1Z5LA 1AS7A 1XX9C 1M2OA 3WJJC 1NUGA 3NJKA 3F7LA 3SN6N 4LEOA 2KKQA 4NT6A 2XTJE 1FZKB 4L0PB 2VDKH 3S3JA 2OZ4L 3V4UH 5HPMA 2WO3B 4KKAD 3GM0A 1DUYB 4MBRA 4QRRB 1IL1A 1GH7A 4PPTA 5GGUB 3UADA 4J7RA 1JD9A 2KZWA 1JPSL 3IJ7A 3C6SA 5EBWA 4QRPD 3QUMH 4PS3A 2A9AA 4YSCA 4EIUA 4K7FA 5MP6H 1ZVSB 2WVSA 4JNXA 1H3PH 5JDSB 2G4EA 5EDXA 3HZYA 2Z7ZA 3X3FH 3BGFC 1QNZH 3INOA 4ODVL 3N40P 2Y7SA 4M6NL 3OR6B 4W4OA 4C56B 1QSFD 1I7ZB 4UTAA 2LW3A 1KXTB 4HJUA 5KSUB 2XQBH 1M9WA 1WZLA 4PJCB 5K93A 1A47A 1JHLH 2PYED 3T6QC 5I6OA 2QDVA 2FNBA 1GA2A 3QNYB 1F8TH 3I02A 4YHIB 5BS0E 2PP8A 2Z31D 4UOW0 4G6AD 1HKLH 4X7SH 1NCWL 4OGXH 4XMUA 3WDIA 2JF1A 4IBSA 1KULA 3MV7B 3QPXL 3B6SB 3ENEA 2NNAA 1CG9B 1EAOA 4PJAF 2Q10A 1KB5H 3QJHB 2K7PA 5KZCB 1WWCA 5T1KB 1U42A 2X40A 4JHAL 4MMXC 1WEJH 2X2IA 4AQAA 5C2BL 3ZGIA 4FNQA 4KC3B 3VVWA 4AIZB 4JPVL 4OZHB 4K9EL 5D7JB 4I5BA 3MOAH 2B59A 2D9CA 1YMMB 1D5BB 5JOFA 3RWCA 1JTOA 3RJQB 4L9LA 2X6AA 2E76C 1O75A 2F08A 3U4EA 2A9DA 5ICUA 3U36B 1F6LL 3TBSB 2HMID 3R18A 4K3DL 1BBDH 1E8XA 2ZXBA 3WGUB 3H7BA 4A6YL 4HV8A 5DTFA 4UQ2A 3IETB 1Z66A 4EAEA 3OPZH 2YBGA 2ZAIA 3A4EA 4ILDA 4M6MH 1X9QA 2COVD 2F53B 4L3ED 4PLOB 3RA7H 1MCEA 3SJVE 1F97A 2ICWB 4LASH 2QGBA 1ZY9A 2IV9A 3KS0J 3QG6B 3HNVL 2P5WE 1EFQA 3KS0H 1JZGA 4PUBH 1CGSL 5E99L 1P4IL 1IAIH 2HN7B 5CBEB 3GBNL 3MOBL 5FM8A 4WHCA 1QA9B 5DQJB 4PJBA 1L6XA 3H0TB 5E2UL 1HZKA 4QGYA 4Y4KA 4XO5A 1CE1H 2FECL 4XN4A 4GUPB 4DUXA 1W91A 2O5YH 1EDYA 3LZFH 3CSYB 3SGEH 4A7UA 4F2MB 5JHLL 2V3EA 2BVUA 3K2KA 5DJXA 2ZKYA 5ICZB 5CEYA 4RIRA 2VN6A 4QHKJ 5AL0A 5CEXB 3HPLB 2A4CA 1T83C 3V6ZA 2C4FU 2WAHA 4GH7B 3EJTA 2PPFA 3CZUB 4NPYA 4HZ1A 4ZW5A 2ZXCA 4P2QA 1RUKH 3UZVA 4K3HA 1Z7JA 4P9HC 2NOYA 1UM5L 3I6KA 5J1AA 3LH9A 3SPVA 3RIAK 5LVEA 5HHPB 3BZEB 4LE8A 3U4KA 1QLFA 4U6XB 2CDGB 5FYLE 4GBXC 2RALA 2FWOB 2GY7B 2XA3A 4WU5A 1NDTA 3RVWC 4D9RE 5EU6B 1MRDL 3DMMD 4JFYB 3RVXC 4PGJA 4JZJA 4NKOA 3VM5A 3LS5L 5EU3B 4AMKH 5BPPA 5AAWC 4L8BA 2V8MA 3MACH 3QZWG 4OUUA 3IN2A 1NGWA 3ASOB 2LLGA 4L37A 1CGYA 4NWTL 1DBKH 2BIMA 4FI7A 1PSKH 1JRHI 1JYXA 4NENA 3CBJB 3GPEA 3L7FB 3W0WB 3NFPA 5IW6A 3HE6D 1QHOA 1NC2B 2VB5A 2XOTA 5C09D 3WO4C 3U6RA 1JP5A 1UGKA 1ODUA 3SE4C 1AOZA 1KLGB 4TUKH 5C9JA 2MQCA 2QBWA 3ES6B 3ESPA 5J1TC 2YZ8A 4NN5B 4PRPD 1MFAH 3KCWA 3VXQA 4MCNA 5LGHH 4N2HA 1H9VA 3ASWA 5GGQH 5L2KB 5HHXH 4HEPA 2JLLA 3VRIB 1ACYL 2E7CA 4DGVH 1L0QA 3N0PB 4AITA 4WEMB 2DAVA 5ETUB 5AKVA 2YAQA 3O4LB 3IJSB 5F1OB 3QYMA 5KTEL 2YQBA 3S35L 3TYGH 1BW8A 2H1XA 4QYOB 2XPZA 4Z7VF 1XZ0A 5DJ6B 1P7BA 1TMQA 3O3EA 1HHJA 3BWAB 4MA8L 3VCLB 2ED6A 3LEYH 3WI9A 1EH9A 5D7IF 4CVXB 2ZUQB 1ZLDA 1TETL 3PGCB 4BUHA 4G1EA 4HU8A 3M8OL 5F3FA 4FZEL 2VDML 1J9RA 2VSKB 4LB8A 2V2TB 1X4ZA 4QHNB 3RFZA 2CHZA 4C56D 1X5FA 3IMUA 4E9VA 4OVVA 4RMQA 2WYIA 4KY1H 4CBPA 5FLVA 2CO1A 1FZJA 1I8IB 1J8HB 1M1XB 1RIUL 1FYTA 1XIWC 2EC8A 3WLBB 4Z5RA 3GFUA 5I66A 2AK4B 3LPFA 3KLHD 2QFRA 4GQZA 1ZXKA 4C4UA 4WWKB 1V3KA 1JNLH 2PLTA 4MQXD 4DPAX 3QUZB 4GSDH 3A23A 2ADIA 4NO5B 4ZUSA 1A7RH 1VPOH 2IQAA 2YD3A 2IEPA 2L7QA 4N0UA 5ITFB 1RERA 5TDNA 1ZTXE 1LQSR 1X7QB 1YNTA 4RISL 5GHWL 3T1FB 2CD0A 3BP5A 4EVNB 5F3HA 3TIDB 1I8MB 5KZCD 3QRFM 1JGDB 4XTRD 1CQYA 5EO1A 1T5WB 4H20L 1CXEA 2J4WL 4N6RB 1H3TA 3QNZB 4Z3HA 4ZMPA 1I8LA 5DVMA 1XCXA 2IH9A 5JHMA 1Z3GH 1CFSA 1HQ4A 5BRPA 2BNRE 4ZAKD 2V9RA 5AL8A 5F7AA 2EVFA 2B1HH 1IU1A 2P8MA 2GIYA 1JWSB 4DIXA 3MRFB 3CZFA 3QRGH 3WHXB 4K5MA 2QSCH 2VC2H 4H8VA 3ZL4H 1LILA 3LRSA 5KSAA 4FE9A 3REWA 3DTDA 2J88L 1USQA 4FQCH 3U1QA 2NZ1A 2F7IA 2K45A 2WSPA 4XCCL 5TDOB 2NY0C 5KYWA 5J7CC 4UIMB 4G42A 3SBWA 4YC2B 5GRYA 2F53D 3RUGB 4AG4L 1KDIA 1LP9B 1QKZL 1T21B 1QBLL 1NAMH 4W4OC 1P5UB 1YY9C 1S8DB 1BJMA 3EJSA 1XR9B 4NJAL 2ITCB 4LP8A 5LBVA 1QEWB 4H0LC 2NZIA 4KNTA 4KK6C 4RGNE 5FYKD 1BVKB 3UBXG 1PQZA 1UZ6F 2O6DA 3UYPA 1A6UL 4M4PA 3T3PE 4KKLC 5BRZE 3H9SD 2VJ8A 4YO0A 5DS1A 1SXSA 4AVHA 1GZPA 1T2QL 3IBOA 3EDKA 5E5RB 4KTGA 3SKMA 5DR5L 1D5RA 3WKPA 4KXZI 5DJDA 3EYVB 5CXPA 1E4HA 1JDAA 3IRCA 4FLOA 2JK5A 5AVWB 4LDEB 4P0DA 3VWJC 1A7PH 3RVVC 1BQ5A 4CC0A 5FKPB 1FVCA 4H8UA 3ULUE 2D3LA 4Y2DB 1JGLL 3L4WA 5HDOA 3SY0B 3ZPDA 5D9SB 1JK8B 2AI0L 2BH0A 4MNGE 4G7QB 5AALA 2Y22A 5FYKL 2Q0ZX 3NCFB 2KS0A 3RNKA 1U95A 3FT3B 4NI3A 3ZSSA 4KXBA 2X38A 4TSBH 3WO4B 1LEIB 1J05A 5E5MA 5EU6D 5FHAL 4A7SA 5C92A 1BP3B 1JZHA 4KMTL 2CPCA 5IT2L 4G59C 4F5CA 4PD4K 5ADPL 4M48L 3KYOA 1M6OA 1OOAA 3D2TA 4BZ2H 3TC9A 4G9FB 1N7MH 2NX5A 3VFOA 5CKAA 1D2PA 4QHLA 2YS4A 1IGYB 2EXTA 2CDFA 4DGUA 2GHWB 2FJFA 3CE1A 3CH1A 3OWRA 3PG2A 4CN4A 3X1EA 4D2NA 1SYVB 3L1GA 5KANG 1S7VA 2AK1H 5E1IA 1W6LA 4R90L 2HCZX 4NQED 5CU9A 1R3LB 2DQJH 3HI1A 2K4AA 2MCAA 5JIHA 4MXWL 5DEZA 3TNNB 3FK3A 3T2PA 2EE0A 1LE5B 3QPQC 4R97C 2B7DT 2J8UF 4UQEA 3WEAA 5I1EH 3B34A 3UAJC 1NLDH 4AEIL 1R3HB 5D1XA 2WQSA 1SQMA 5FFLA 1V5JA 3SPGA 5L2KD 3MJGX 2Q1EA 4ZMLA 3O4LD 2IWKA 4I3GA 4TQEL 5AOZA 1ZD6A 4JR9L 2ED8A 4NQDB 3BVXA 1JFQL 3FMGH 1WS8A 1XIWB 2DQIL 4TSAH 1BBJB 2V5RA 4HUWB 1EZVX 2VSCA 4B7IA 2NT1A 4O2CB 3BUIA 3CN2A 3PWNA 5E9DB 3GF8A 3UERA 5IB4B 2DZEA 2EKJA 1FRGH 2ICEA 2EVGA 2R4SH 2FLMA 1M2VB 1NUNB 4U4BA 3LKNB 4IKNA 1ZV5A 1YPZA 4J6RH 4JZJC 4PD4J 3UTTA 4ZSOE 3B2DC 4I87A 3BW9B 3O6LL 2XFGB 3HZMA 4GS7B 4L1LA 2VDLL 3TPKA 3MROB 5BUAA 2WB7A 2XN1A 5FS5A 3QXDA 4L1HA 3VFRA 1Z5LB 2IH3A 2VL4A 3AUVA 3G9VA 3GT6A 2RAMA 4LEOB 4FFTA 4NT6B 4RGNC 1IAOA 4K5LA 3ECQA 1JYWA 4IRSA 5J11C 3QUZD 1L9MA 4Z3JA 3A6CL 1KFAH 5E7FA 2Y4SA 4FJYA 3I9PA 4ABWA 1SHWA 2PR4H 4X9FA 1IL1B 1CGWA 3EH3B 4LCWD 4UANA 3D33A 4DEPC 2KDGA 3QQDA 1UM6H 5DU7A 2DM4A 5B3JE 1F4YL 2RA1A 2QVMA 1UXWA 3DX6A 5EBWB 1Q1JL 4B9YA 3VA2C 4K7FB 1T89A 2NY0B 4BA0A 4N0CD 3ULUC 3HZYB 2IAAC 4XAWH 3BDYH 3MJ9L 1OCRB 1QFUH 2XKSA 3FS9A 4G83A 5EEUA 2YAOA 5TFSH 1LDPH 4UCFA 3MBEA 1D7FA 5HHME 2VDNL 1AD9A 3KPOA 3EO9L 3PFQA 3RWHA 3P9LA 4WRLA 3K6DA 2ZUWA 5KWYC 4ZOBA 4JG0H 5IVNA 4BUGA 5AUMA 4AT6A 3VFNA 1CMOA 3T65A 2KPNA 4Z1PA 1LO2L 4PLKC 3V4VL 1XB6A 2DD8H 4WW2F 1J5IA 4W9HC 1KJVA 2R0WL 1OOWA 3IKKA 5I1LA 4H2CA 3QIBC 5IHUH 3VRLE 5A2IH 2J5LC 1Q9LA 1UG9A 2NNAB 4QXUL 1Z9SA 3HA0A 1QLEB 2WZ5A 3QQ4A 2ZXWB 4PJFF 4IKKA 4OIAA 4Y5VA 4Z7QF 1SQ2N 4ZQTA 3WSQL 3SY6A 3U4BH 1OARH 2WLHA 1ZT1A 4AQAB 5IQNA 4AW4A 1RJZA 2D0HA 4NPKA 3CLEL 4CSPA 4ZFFB 4I5BB 4F7EA 4RRPM 3JTBA 4O5LL 2W60A 5IHWA 1UA6H 4J2QA 4D3CH 5JOFB 4HS8L 3CDYA 5FDYA 7TAAA 4IMKC 1JVLA 5IROC 3U4EB 4MNQE 3V9EA 5IESH 2MFNA 3L4ZA 1PNCA 1NL0L 2FR4A 1R34A 4KFMA 5HI3D 2NY2D 1JPFA 1JF6A 2QV2A 4MVBC 2DQFA 3H7BB 5AOLA 2HX8A 4G2AA 4HV8B 5KOVC 4FQQB 4UQ2B 5DTFB 1F00I 5L4MA 4B3VA 4Y89A 1CFTA 1UCBL 4Y2DD 4Z78A 1KZQA 1DJYA 3CN1A 1I8LC 3PREA 2BRRH 2XT1B 2D7TH 3TCXA 5EIIA 4RGOL 5KVEH 3DIVA 5GZNA 1EUUA 3HMXL 2XWBA 3BIAX 4GMSH 2W81C 3FQNA 3U2IA 1H8LA 5TDPA 3LS4H 3ETTA 2UY7A 4Y9EA 1NBVL 4BZ1L 4Z7OB 4PJBB 3FFOA 4NO0D 4WSGA 1RZIA 2DYRB 5IVZA 3U30C 4Y4KB 1X44A 1QUPA 4R97B 1TQWA 2YC1A 5CILL 4R2GB 6FABL 4I0CC 1J8SA 4U1HA 2VISA 1BVNT 3ME0B 4FMFA 4G7VL 5DJXB 4IRZL 4RIRB 4A55A 1PFCA 4NYLA 2X2UA 3VUAA 5CGTA 4KO5A 3MSPA 1TDQA 2Z0BA 1CFMA 1PZ5A 1UURA 4NPYB 3D30A 5EWIH 4P2QB 2FATH 4JHUA 3V0AC 2NCMA 5A3IC 4FC3E 3UZVB 3SGDH 1Y07A 3U0WH 3I6KB 5J1AB 3SPVB 2VLMD 3GLZA 2QR0A 2XQYG 3HNSH 4LGPB 1QLFB 1S6NA 2V4LA 3L3HB 4K8RH 5KBDA 3PP4L 2EADA 4W6WB 1QFWI 5TE7H 4WU5B 4NWUL 4Z0BH 3GHEL 1BJ8A 2D4FA 5KUKA 3GTNA 2NY5L 4IU2A 1HQRA 4JZJB 4HJSA 4NKOB 5CSGA 1CU4H 4R7LA 4MA7L 4L8BB 3WTWA 2O93L 5T1MA 2J6EL 2YXMA 3NVQA 4OUUB 5EULV 1NGWB 2C9UA 4M1GH 2WQAA 4ATTA 3WXVH 4L37B 3FUDA 3ARTA 5GSRA 2VSMB 5B4MC 1E2WA 2R4RL 4QRTA 1G9MC 3X12A 2VDOH 1IKFH 3AGWA 5C0AA 4NENB 5K59F 5MI0C 5LN4A 3ILPA 4RAVA 2F8VA 3EG9A 3VSUA 5E9DD 1J7VR 3NFPB 4LFHG 5IW6B 5J11B 1SHXA 1WZKA 3VXRE 5IIEA 1VGEL 4G70B 4HU2A 4MZ2A 4PJXA 1ZGLP 1EHLL 5L7XL 4K3EL 3U6RB 3GSUA 4JFWA 5DYOA 1U8HA 2G0KA 4XP1L 5TE4L 5C9JB 4DEPB 3DROA 4HCRH 4F1ZA 4LSSH 1KBVA 3VXQB 3TBWA 3DK2A 2EVIA 2BS71 3WNNA 1ETA1 5EORH 2UY6A 1GCYA 1JZ4A 4J8QA 4PJGE 3I6LD 3BHBA 2DQUL 2WMPA 4XP4L 4UNIA 3LDBB 5HVFB 3AWFA 2KBGA 1ED3A 2DTML 3EBIA 3HPJA 4KQ0A 4DW2L 1WZMA 3S36H 3PJNA 2Y7MA 1YQVL 2ZT9C 4LLVA 2YXWA 1XZ0B 2JKWA 5CIPA 1L4IA 1KTRL 1S2EA 3NG5A 4OSUH 3HFMH 1QQDA 3O3EB 1HHJB 4M56A 2OL3A 3BP6A 3JTTA 4W6XB 4HFUH 3BKYH 4HLZH 4XC3L 4G1EB 2HSIA 5LNEA 3GTTA 2J5LB 3BPNB 5ELIA 1MZZA 2NDFA 2PXYA 3FO0H 1C08B 2Y06L 4JFZL 5BQ7A 2FNWA 4FI6A 1PF3A 1PZDA 2Y2WA 4H25B 1FZJB 1YLBB 1FYTB 3O0RL 3S37H 1AJ7H 2WPGA 4U3SA 2E7HA 1KTBA 3NJXA 5IF0B 2VERN 4XBEH 2EDHA 2ADIB 4P8QA 4ZUSB 3CFUA 2D7PA 1WYJA 2IQAB 5C0CA 4N0UB 2JJSA 5TDNB 2B1AL 3RFRA 1SY6L 1YNTB 3MV8E 1P6FA 3BP5B 3FC8A 1YYLH 3ABZA 3NUKA 4PTTA 2ZUSA 3QHZH 4NOFA 5IVXF 2A0LD 4AIXA 3C60A 3SDDA 4AQOA 1U8LA 1R5IA 1M3IA 3OXRA 1EO5A 3WL9A 3JV6A 2P45B 2ZKMX 5EO1B 3QWQB 1NPUA 1K9TA 3TBYA 1K5NA 4IRSC 4XRCA 1OGSA 1BZ9A 1IGTA 2GI0A 1KBBA 3G08A 1CFSB 1HQ4B 1N0XH 1UACH 4N2CA 1O5DT 3TJEH 2PWDA 1GW0A 3I50H 3RVTC 2P8MB 5EZOH 3ZZQA 3QDMD 1BXUA 5FM4A 5FUOL 3CZFB 5SX5K 5DS8A 4HG4K 1JXFA 3N42F 3LRSB 5KSAB 3REWB 1C16A 2QQLH 3UJIL 4N1HB 1MWOA 1ZT7A 3E8UH 3U30B 3SDXA 1Y1UA 3HOGA 4HGWA 5KYWB 4IBVA 1FBIH 1UFUA 2A9ML 4G42B 3ARFA 2K9FB 5I0VA 3S48A 1IQDA 3EGSA 1WIOA 1LMKA 1HI6A 4UT6A 5JHDE 1J8RA 5LWYH 3GMPA 1JXJA 3ZL1A 2WLIA 4JDZA 3ZRCC 2Y6SD 2G9HA 4OM0L 1PQZB 4Z6AT 1W8NA 4IRJA 4LHJB 3SDYH 3UYPB 3T2NL 2JSFA 1MCHA 1U41A 2QQNL 4BH7A 2NW2A 2X28A 3AS3A 4Y4KD 5CHNA 4YO0B 3GEWB 2NW3A 2Y5TA 1GZPB 5I1KL 4HC1H 3K0WA 3SKMB 3SDAA 5CUSL 2D7OA 5D7EA 5DJDB 5DLMH 3H2PA 4KPHH 2JK5B 4Y5VC 1MWAA 4QYAA 1AC0A 5HSFA 4MS8D 3D0LB 4TRPL 1FVCB 3SKJL 4P2QD 5C0BA 2ZXGA 4K2UH 3D85A 2FE0A 2ZKHH 4JKLA 1L0PA 3M1OA 2KQMA 3B3IA 4ZS6C 5MI0B 5HYJE 3GZPA 4PP1C 5B1JA 3KAAA 5FM5O 3T0BA 5HHOD 3SD5A 2VXUH 1CXKA 3BFWA 5TK4A 2B3RA 4HG4J 5C9KA 5SX5H 3VD9A 2NY4C 3RNKB 1NMBH 1U95B 4XXWA 5K1NA 5ESQB 1J05B 5E5MB 5IGXH 5MEOA 2XA8L 2ZX8A 4S0SD 1MJ8L 3CCHA 1FFTB 2DKSA 4JREB 4WY7H 5EOQH 5CEZD 3KYOB 4J3SA 1M6OB 2RBLA 1XVSA 2X5PA 5JR1L 5ANME 2E0PA 1G5AA 4Y16D 2B20A 3NABL 3TWCH 2FDBP 2NX5B 3MNZA 4DKDC 5JQ6L 3VFOB 5DMGC 1KTJA 1TQCC 4NKMA 4QHLB 1KCSH 2P80A 4KNUA 4AZUA 3QB7C 4OZFG 2C3VA 2FT6A 2F58L 2CDFB 3GZQA 3TFBA 3SQOL 1X5KA 2BVYA 5C0FA 1SEQL 2FJFB 3CH1B 2AQSA 4CADA 1XDTT 4OCYL 1OLLA 3P0GB 1S7VB 2VR4A 1N26A 3IDXL 3R4RA 1FG2A 5CKGA 3RNQA 1II4E 5HGBA 4HIXL 1N3NA 1ACCA 2Q8BH 4FEMA 1OGTA 3HI1B 4JZOA 4LSTL 1J1OH 5HDWA 1DO6A 5DSCA 1ZEAH 2E27L 3ELAT 3G6DL 1AGFB 1ADQH 3GSQA 6TAAA 3HC3L 1F45A 1HHIA 4IBWA 3DXAE 5D1XB 4JBSA 2VZOA 4BHUA 5CEZL 3W11C 3K4ZA 3ILQC 1A4CA 3CZKA 4PHZA 3GJFK 4QKTA 5I5RA 3CHQA 5F6HJ 3S8FB 1UOWA 3D39D 3OHMB 2BVQA 2QPEB 3MNVA 1RL1A 5ABDE 3QEHA 2P5EA 5T1DL 3PWNB 4IJ3C 4KJPD 3H85A 3QPKA 3RGVC 3W2DH 4D9QD 2DWEA 3WLWD 2ICEB 2DQTH 3SPJA 3UTTB 2ENPA 1YPZB 3SODB 1IC7L 3FQRA 2EDYA 2EACA 3BISA 5EF0A 2D0FA 3HZMB 5GGTA 2VLKA 4P3CL 4FD0A 2KERA 2FWUA 4EXPX 2BNQA 2YD4A 3QXDB 4PJ5A 3VFRB 2R0LH 2IH3B 1E7VA 4DTGH 1FYTD 2TAAA 1A4AA 3TJPA 3RQ3A 2OPCA 4KK8C 1IAOB 3QO1A 2ATKA 4IRSB 3QDJE 1TJIH 1CD1A 2GITA 5J8OA 2K3TA 1JRHL 1BXXA 4TPRL 3JWDC 5T5FA 1JUFA 4AQ1C 2MTAA 4LDLB 3QQDB 2RB8A 2EH8L 4NS0A 4KXCA 4MRCA 5E6UB 3TBTA 5ANHA 5ILTL 1A66A 1UXWB 2O30A 3DX6B 3EO0A 4ODHH 1GZQA 2B4CL 4KTYA 5E00A 4HBCL 2P9RA 1KWKA 1JPSH 1X7TA 3UYRL 2QV4A 1VCAA 1AO7E 4CNIA 1O0VA 4OD1L 4PRIE 3MBEB 3BSZL 4HSCX 5C6PB 4FXKA 1AD9B 1YA5A 3KPOB 2ZXAA 4LOUC 4ODVH 4M6NH 2XXCB 3P9LB 1MHEA 2BP5M 5M94B 3L5IA 4JVWA 2X4UA 3HG4A 4PS8A 5AUMB 5KSAD 2C9SA 3KPSE 3VFNB 3ZDYF 1BQUA 4AT6B 4UTBL 1XGPA 1JZ8A 1MW0A 4OD2A 3T09A 3NIFF 4XH2A 4FKEA 1QWUA 1KJVB 5I1LB 3BSHA 4LEXL 1Q9LB 5GRUL 1Z9SB 3QQ4B 3KBPA 5IB3A 3N55A 4Y5VB 3KXFA 5E4IA 5I5JA 4OF8A 2EE9A 2Y5EA 1FZMA 3KW7A 4HJJL 1ZT1B 3C2AL 3RG1C 3JYBA 1GOFA 1KCVL 1CXFA 5DJYA 2DBLL 4JEGB 3F2LA 1P84K 4JFDD 4F7EB 4X4KA 1ZVYA 1AAJA 2NQ3A 2W60B 3EYQD 4U1JA 1ASOA 5E5UB 1GY1A 2CRMA 2Z34A 1IBGL 3EYFA 5CCJA 4LSPL 1DVFC 3ALXA 2JJSC 5D7IE 2FR4B 1CYGA 2NY4B 3DNKA 4BH8A 2XN9D 1TLKA 2R1WA 2BDNL 4NAMA 4QOKA 1JPFB 4AM0Q 4P3DA 2OR7A 4JO8A 3TVMC 3PGFL 3UMTA 4C54A 1FH5H 4OV5A 2DQFB 5F1SA 5CJBA 1OALA 4LCVA 2IWEA 2NXYB 3A67H 4ODTL 1CXIA 1CFTB 2PKDA 3C9NA 4Z78B 4N8VG 3CU1A 2R69A 4WWNA 1TZGL 5K69A 4WNJA 4JJOA 5K1JA 2C9AA 5DHMC 4WI7A 1M53A 2DQEL 1P7KA 1QG3A 4W81A 2XWBB 4A7QA 5AB2A 5KVEE 3FOLA 3FQNB 4OZIA 4GUOA 4HFWA 1CFQA 4MDJA 2BP8A 3TCLA 3U82B 1OP9A 5TDPB 3IAPA 4ZMAT 4X5PA 2UY7B 3QT2A 1CGSH 1UB6A 4IKIA 1RZIB 4PCYA 5E99H 5IVZB 1W2KT 3ZDZE 2XU9A 2YC1B 4F27A 5JIQA 4PJHF 2EICA 3ZR5A 4U1HB 2VISB 4TQHA 3ATEA 3QC5X 1O7SA 2AQ3A 4NYLB 1TZAA 2HT3C 3T6ZA 5D1ZA 1PZ5B 2E56A 2JCWA 4NN7C 4FFYL 1P84J 2BWIA 2P44B 4YFLF 5D5ME 1UOLA 1V3MA 5FA4A 3NEOA 1HZHL 4IRJC 4MD4B 1JJUA 1IV8A 3QZLA 2QR0B 3JXAA 1X5AA 2BY1A 5GGRY 4AYDC 2J21A 4AKPA 1F3DJ 1TENA 2YOCA 4WI8A 2O4EA 4KDWA 5HHVL 4NB7A 5T3ZL 4JFQA 1BPVA 3FCBA 4JDVA 3L8QA 1U92A 3CX2A 3SDAC 5M7QA 1URZA 4OKVA 3HAEG 1A2YA 4IU2B 1HQRB 3VYOA 1TZIA 1XR8A 3RAJH 1C7SA 1N18A 1ZKAA 5AOIA 2HTLC 5T1MB 4FG2A 1MRDH 2VDQH 4MS6A 4ZO9A 3AY4A 3DETC 5AZEL 5GSRB 4F80A 4GB9A 5CM1A 4LARL 2AMGA 3VH8A 4NQUA 1PKQE 3X12B 5C0AB 1QOKA 5EUOF 1DSYA 3ILPB 2R39A 3W39A 4RAVB 3EG9B 5GS0D 1SOQA 2GBVA 1UZ6E 2JI3A 5LCVH 5GJTL 2H0EA 2QHRH 3SGKA 5IIEB 5IFHH 3RPBA 4IMLA 4PJXB 4XXWC 1OIOA 3GSNL 3UCQA 4ZMXA 3GSUB 5DYOB 1U8HB 3UTTD 2J44A 3GRWH 5HXMA 1GZHC 3ARGA 3DROB 4K15A 3SO3B 2XBZA 4W70A 4NIYE 4KKCC 3TBWB 4X6DE 3APFA 2UY6B 2DN7A 1WAAE 4WW1A 2FBRA 2FQEA 4CVZA 2QFPA 2HAZA 3BHBB 2J1WA 4ZQKA 4FYSA 1WIPA 2H8PA 2WMPB 3GUFA 4RAHA 1FNEA 2W91A 2CJSA 2WUCL 3QDGD 2CRZA 5FOJA 2WCSA 1QSEA 3VNZA 4ZNEE 1ED3B 4AQZA 2DICA 3HPJB 4Q9CA 2AXFA 2XZAH 3HI5L 1EEZA 3VFGH 5GS0L 1DDTA 4LLVB 5DRWB 5CGBA 1DBBL 2UZPA 4ZMWA 5CIPB 1KB9K 3LMJH 3FHQA 3E38A 2XDHA 3J2PA 1QQDB 3VAEA 2ZOWA 2Y72A 5CZVL 2FBJL 2CO4A 2OL3B 3BP6B 3JTTB 3T8XA 2WP3T 2BY0A 3VRJA 5IHLB 4FCAA 4KV5E 1BXAA 4EBQL 1SGKA 2YAEA 4DCQA 4F8QA 1O7VA 4N9GA 2PXYB 4JFOB 4LAJH 3U7WH 4HIIA 5BQ7B 4JDTH 4HEME 3MBED 3STBA 4FZEH 1GGCL 3WMQA 3AADB 2PPAA 2HKFL 4N20A 2CUHA 1H3GA 2Z8SA 4U3SB 2CHXA 1I85A 4UT7L 4GQ9H 4UAOC 5T5NG 5JTWA 3PCYA 1RIUH 4YFDB 1I9IH 3SIKA 2N7BA 2B39A 2BOCA 1IBYA 3FL7A 1MCNA 3DXAB 5AW0B 3B37A 4WFGE 3N1FC 4IBUA 1G0YR 1R17A 4PTTB 5IBUB 1JBJA 1A1OA 1A5FH 3SDDB 4RISH 1U8LB 1R5IB 2XN0A 3OXRB 3WL9B 3JV6B 1MFEL 3RX5A 2F8OA 5DHXB 3ZBMA 1AZBA 5DWUH 3C8KB 3TJHC 4Y4FA 2Z9TA 3KLLA 1K5NB 1AYRA 3QIUD 4P23A 4XRCB 1BZ9B 1IGTB 3G08B 3ARDA 4BIKA 4H20H 2J4WH 2ZIDA 1DQQA 4NM8H 3TV3L 4PJDF 4DK5A 32C2A 2WWOA 3QEQE 5DS8B 1CICD 3VFMA 1A8JH 4L8SC 4OT1H 1OGAA 1C16B 3NJHA 1MZYA 3MMEB 3GB7A 3KDMA 3OAZH 3SDXB 1K6QH 2IWGA 2NXYD 4HGWB 4OZFH 4B97A 1U3JA 3UPRA 2F9BT 5F7KC 2J88H 3ARFB 5JW3L 1IQDB 3WNJA 3DYMA 1AFVL 3EGSB 3FTWA 4OCXL 3W37A 1HI6B 3S4SG 1KIQA 3GMPB 2FH6A 1CN4A 1I53A 4Z0XA 3RWIA 2WLIB 4FXKC 2HFFA 1QKZH 4NN7B 1A3LL 2ZTBA 1RHHA 3R4DA 5T5NF 4UDUA 4OFKA 5IBTH 3RWJA 2G9HB 1FCCA 4PQXA 4EN3A 5E6SB 4EXKA 4IRJB 4Z3FA 4BH7B 5AOJA 5DD3L 2NW2B 1U3HA 5D1QE 3P3TA 4LVNC 4PJ7A 2NW3B 5CHNB 2Y5TB 4BK4A 2DMGA 4WO4C 3OKLA 1ZAGA 4YHMH 3AREA 3SDAB 2JXMA 2LR4A 1HCFX 3HLKA 5J9PA 3FQTA 3PWJA 3P9MA 1QI5A 4XMVA 1N70A 1MVFA 1ET7A 1RPKA 1KYAA 1MWAB 5DR5H 3SE3A 3VB8A 5EC2A 2CQVA 5I26A 5B3NA 2NUPA 4EI6A 5KBKA 5C0BB 4FXGC 1G7MB 4TNFA 3D85B 4YSUA 3GM8A 5I16B 1IAIM 2DQCH 2ZWZA 3EJYD 4APXA 2EEFA 2HT4C 4OF3A 3OLGA 2JKRM 4TNGA 1GIGL 4OBSA 4ZPTA 1AY1H 2AI0H 2XNAA 2EO7A 2QGEA 3DGDA 2PABA 3RDTC 3OJMB 4TNWF 4YBLB 3MPCA 5MEOB 2NY3B 4Z7UF 1YG9A 4HGMA 2DL9A 3CCHB 1AR1B 3DVGA 5EF3A 3TO4A 1QVOA 1KXQE 1I9RL 4FGMA 1ZPUA 3VFUA 4PJIA 4KMTH 3K8MA 4HOWA 3MNZB 4NKMB 2J71A 3EADA 5C0AD 2C3VB 1FDLL 1NMCC 3D3VA 2VR9A 1TJGH 3O6MH 5C0FB 1N9PA 2QZQA 1L9NA 3VXUE 4CADB 3P2BA 3BWUC 4OFIA 1FG2B 5B22A 3RNQB 2AF2A 1P4BH 1K72A 1N3NB 4JKPL 5IEHA 5LBSL