2AHIA

Structural basis of dna recognition by p53 tetramers (complex iii)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
198
structure length
198
Chain Sequence
SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*GP*GP*AP*CP*AP*TP*GP*TP*CP*CP*G)-3'
publication title Structural Basis of DNA Recognition by p53 Tetramers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis/dna
total genus 51
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ahiA00
3VD1A 3TS8A 1CMOA 4AGMA 3VD0A 1UOLA 1HJCA 5ECGA 4AGLA 4XR8C 1LJMA 2PCXA 3US1A 2J21A 2J1YA 3D07A 1GZHA 3VD2A 1TUPA 3QYMA 1E50A 4QO1B 3D0AA 4LOFA 2IOOA 2ATAA 1EAOA 4AGPA 3IGLA 1EANA 5LGYA 2BIPA 3WTWA 3Q06A 5AOLA 1YCSA 2AHIA 3WTVA 2XWRA 2J1XA 5AB9A 2J1WA 2X0VA 5BUAA 4AGQA 3WTYA 2RMNA 4L0YA 2BINA 4AGOA 2ADYA 4IBZA 4AGNA 4IBSA 4IBYA 2OCJA 2X0WA 2IOMA 4IBWA 4MZRA 5G4OA 3QYNA 2GEQA 2AC0A 2FEJA 2BIMA 5LAPA 3KMDA 1HU8A 5A7BA 5G4MA 4LO9A 2J6WA 4A63A 5KBDA 5AOMA 1IO4C 2P52A 1EAQA 3Q01A 3D05A 2XWCA 1T4WA 1KZYA 1CO1A 4GUQA 5AOKA 2MEJB 3WTTA 4G82A 3WTSA 4IBTA 4MZIA 3US0A 5ABAA 3EXJA 5G4NA 3D09A 5AOJA 3WU1A 2BIOA 4L0ZA 2WGXA 4IBVA 2BIQA 3KZ8A 2X0UA 2IOIA 1HJBC 3EXLA 3WTXA 4IBQA 4LOEA 2J1ZA 3IGKA 2YBGA 4IBUA 4KVPA 2J20A 3Q05A 4L18A 1H9DA 4IJTA 5AOIA 4GUOA 3D06A 3D08A 4G83A 3ZMEA 3WTUA 1TSRA 2VUKA 4HJEA 2H1LM 1GZHC
chains in the Genus database with same CATH superfamily
5HSFA 1LO2H 3CNKA 5KS9F 4Y16C 4AK2A 1THAA 2CLVB 3B7RL 4MZ3A 1MVUB 1MW0A 4P2OC 3F85A 5LO7A 1MFMA 5C2UB 2ZWSA 3CN0A 1P9MA 3FCTA 4NZUH 2H7WA 3NP4A 2DLHA 2B08A 3VG0H 3FUIA 2OFQA 2FSDA 3MGTA 4Y1AA 5SX5K 4Z7IA 3MXVL 2MOGA 3QNYA 4CADB 3O2VH 4OZHE 5IVXE 5JW5B 4BSWB 3C8HA 5EUKA 5GGUA 1G9MC 2RALA 2H0PA 1NBYA 1EJ6A 2ALAA 2CGRH 4OFKA 3OC8A 4PVNA 4X8GA 3LVTA 1G1KA 1DSWA 1H15B 2GBTA 2X4QB 4AQOA 3NZ8B 1WICA 3JUYA 2EEFA 3JTTB 1S9WB 4N0UE 2X53A 3EOTH 1HNGA 5F8QC 3MMEA 2FUQA 3ABKB 4W9DC 5FUZL 5SX4I 3C60A 4N1EA 3DMMD 2BSDA 4AVJA 5F7KC 1UD6A 3CVHL 1Z5LA 2ZKMX 2A0LC 4S1QL 4YS4A 1OAZL 1FRGH 1YEJH 3FT3A 4ZX3A 5CLXA 3T5WA 1RSFA 3BUDA 4OZGB 1OO2A 3HNVH 3LAFA 3QQ4A 4XCCL 5E08H 1MIEL 2Z92A 1N0LA 1IGCH 1RIHL 2YGOA 4RBPK 2BVTA 3NPSB 3QI9C 4F8NA 3RKPA 2OZ4L 1RZ7H 4WGKA 2OSLB 3M17B 2BXZA 1OP5K 1EAQA 2UZXA 3VSUA 2EDWA 3MUY1 3D33A 3T0EE 4F2EA 2XUWA 4LT7A 4I2XE 4KHTH 3UTTB 3DVNA 1MFEH 3WJJC 5LCVA 1TPXC 3IDNB 3FTGB 4EUPH 3SKUD 2XQYG 1UA7A 2AQRA 2F7RA 2VDRB 3C6LA 3BKYL 3EJPA 2RHEA 5EDXA 3T8VA 1VFOA 3QDMB 1WQVT 1YN7B 1Z6JT 4HD5A 3EZJB 3DVIA 3U46B 2ZPKH 5LGJB 4FZEL 2NNCA 4RAVA 1J0IA 1DEEA 3AS3A 3AUVA 3QFJE 2YUVA 5I6XB 4LRIC 1JGVH 4AQAB 1YY8B 4H26A 4Y5VA 1BGXL 1BD2E 1BOGB 1KYDA 1NCAL 3VO0A 4F37K 1I1YB 1OQXA 2AV1B 3TJHD 2QSTA 4HKXA 1BF8A 4FXKA 4W6YB 5IUSA 5FUCE 1KDIA 2WLZA 1BJ1J 4FFZH 2EIZB 5BPPA 2C5DC 2BK8A 3NABH 4JQIA 3ARBB 4JRLA 4JRYB 1EZVX 5DQDH 1GSKA 3VTMA 3FK3A 2ZUTA 3S96A 2R2BB 5EO1B 1RUPL 1JYXA 4N8UA 5EEZA 3L5WA 4LU5L 1RZ8B 3TONA 4QTIH 4AC4A 4DN3L 3FT4B 3GBEA 2FK9A 4PWHA 1DJYA 4DO5A 1NDGA 1F6AB 1QLFB 1V3LA 3IDYB 3KHQA 5DHVB 4ELKA 3RA7H 1Y6NR 5F3BB 2PCPB 2CLVA 1GY2A 4FE9A 4HUWB 1QP1A 2A74A 3UTQB 5EZIH 2R0KL 1BBDH 1NINA 5KJ7E 2WXHA 3UTSD 2XCMC 3MUGA 1TETL 2GFBB 1UA6L 4UZSA 3VD9A 1X5AA 1JFHA 3HHSB 5E2TL 2VN6A 5AOLA 5JW5A 2A99A 4CADA 1QFOA 3NRFA 4BSWA 2V3FA 5I1GH 3CVDA 4KKRA 1IE4A 4D2NA 4N2IA 1I1AD 1RZJL 5E9DD 5DGRA 1FE8L 3IJ7A 1H15A 3QPQC 3O3AB 1A7PH 1QSED 2C3XA 4GYBA 5KVEE 4YFEA 2CO2A 4RA3A 1PG7W 3NZ8A 2VN5A 4H0HB 3JTTA 3MNVB 1S9WA 1CDHA 4TTDC 1NFDF 5DJ2B 2HT2C 3QWQB 3SPIA 3VFGL 5EFIB 4QRPB 1I8LA 1E42A 4J3XA 4Y8DC 5A2CA 3KBFA 2EABA 1XEUA 1PAZA 1RIUH 4KKCD 1BMZA 5I16B 1WD8A 3D9AH 2NZIA 3O6MH 1JPTH 4LARL 2UY7B 5BRQA 1MHCB 4JHZA 3NH7L 4P3CL 1AHWB 4Z7VE 4OZGA 3RGBA 3GSRB 1PZAA 5HVWA 4PJHA 3TOPA 3GBMH 1WSST 3IU3B 2I24N 5DRWB 2B0SH 4FTDA 1UTDA 3ZDXE 4EZJA 3BUBA 2OSLA 2KI6A 3M17A 1TNNA 3CLFL 3MRRB 1UYWL 3KL0A 4WU5B 1AZBA 1NCHA 1M6OB 4OLEA 2VR9A 5ADPL 5BO1H 1Q1PA 5B38G 5BVJB 4P9MH 2DBLL 2M2DA 3CBRA 3UTTA 2CBPA 3HAEG 4PJGB 5GRXG 3IDNA 4LPTA 3UZQB 3EJRA 4XN5A 3GLZA 2C3VB 1LE5B 2RQEA 2YMXH 5EUOF 5H8DA 3BDXA 3QDMA 1YN7A 2BPBA 1ACYH 3G6JF 1O7SA 4I3RL 4O5LL 3U46A 4Y5YC 2NXYD 3VI3E 5LGJA 1CDBA 2J1ZA 4TSAL 3NJMA 2XFXB 3UMTA 5KVGH 4TVPE 3Q9QA 3STLB 4BYHA 2BHUA 1YY8A 3RX8A 3EO9H 1BOGA 1MF2L 3G3LA 3HBPA 1I1YA 3F2LA 3KJ6L 2IWGA 3MBWB 5DC2A 4A2HA 3H42L 1DVFA 4I1RA 5GZNA 1SLXA 2YRLA 4X4ZA 4Y19D 4TXVB 4DVRL 2EIZA 2VXQA 5J6SA 4DEWA 1S9YB 1HZHL 2VZUA 3QCTH 4B7IA 4LHUG 2CA3A 2VLKB 2R2BA 2QVTA 5EO1A 2Q20A 4D9RD 3VD0A 2H3XC 4MAYC 4BFIB 1RZ8A 3M6DA 1MN4A 4Y4FB 3TVMB 3FT4A 1X44A 2DLTA 1CN4A 4N24A 1EJOH 1F6AA 2DQTL 5DHVA 3ISWA 4Z7WE 2OSXA 2PCPA 4HUWA 2F0CA 3N40F 2PABA 5E6IC 4YL9A 2GB2A 3UTQA 3PGDA 1KJ2B 2XG5B 2DIAA 2NY2C 4XMZA 3T6ZA 2ZUWA 3CVIH 4IIQC 4K94L 3HHSA 2FATH 3PAZA 4R2GD 1P6WA 3OG6B 4EN3D 5ERWB 1IE5A 4OD2B 2DICA 1J11A 1A21A 5HHQB 1V05A 2NYYC 5DMGC 3O3AA 3W39B 3U6RB 5C6PB 1HINL 4B60A 2B20A 3TA3C 3NTCL 1J10A 5DJ2A 5EFIA 2J57A 4MS8C 2FEJA 5GGQH 1HWWA 4K2UL 2EJ1A 5BVPL 3FQ4A 5E95B 3OB8A 4BFEA 5E00A 2WCSA 4CMHB 3ETSA 5I16A 4YHKH 1CCZA 3M1BB 3NIGB 1MHCA 4KTDL 1AHWA 4QAMB 3QUZC 5CCKH 1AY1H 1E4WH 1PX8A 2J88L 3GSRA 3IU3A 1F56A 1ZOXA 5DRWA 1JV5B 4G6AC 1TQWA 3JV6B 1KFAH 1X7QB 3RDJA 4WTQA 2G2NA 1NGZB 2DKSA 1W8NA 4PQXA 1EBPA 2C7FA 4HC1A 5BVJA 2EKSB 4PJGA 2EE0A 1AANA 2XA8L 5LAXA 4L5FL 3UZQA 2NY4D 3TBTB 3FQ1A 4GFTB 2C3VA 1LE5A 3MCLH 1J0KA 4JKNA 5HDBF 4V33A 2FGWH 2QGDA 3D85B 1J8HB 4QRUB 3T2QA 3OQRA 3ZTDC 7PCYA 5DTFB 4JFQB 2XFXA 1IJNA 5CO1A 5AZUA 4OZIE 1HEJC 1K9TA 4GW5B 2OR7A 1OCOB 3KEDA 3MBWA 4UV4H 1GA2A 2DQGL 3MOBL 5CBAB 4H8UA 2HRPL 3EJCA 1MJ7H 5GSRB 4JN1H 3S8WA 3RHWK 5E94B 2F7IA 4RMVA 4H0GA 1S9YA 1JZ7A 3OR7B 3CQFA 3STZB 1R3IL 1P4BH 1MCCA 2MQCA 2VLKA 4G7QB 3LQMA 1AFVL 1HX0A 5FO8B 3JWDL 4ODBD 2ENSA 1EMTL 4Y4FA 3TVMA 1TZGL 2AGJL 2LLLA 1UUSA 5LXGH 1SY6L 3MCKB 4NNYB 2ZX9A 4R96B 1BX2A 2HRGA 3H9SE 3WXVH 4YDIH 1KJ2A 2QQLL 3EUDA 2FX9H 1XQ4A 2XG5A 4OVUA 4U3XA 4EEEA 5K1NA 4WK0B 5TK4A 3EYQD 5L2KB 1ZIAA 3ZOAA 1CU4L 3WD5L 3FONB 1CD0A 1H3PH 3QIWC 4ZSOE 2BNRB 2PLTA 5ERWA 4G7YH 5CKAA 3EKCA 1G9HA 4OD2A 1B4JH 2X4NB 3KVDD 4M29A 2XTJD 5JTWA 2EDXA 4AEHL 4PGJA 1H3VA 3SZKC 3W39A 1HWHB 1K3ZA 3U6RA 2ROYA 5IOPB 5GJTH 4LKCB 2XDHA 3BI9X 5IQ7L 4B0MB 1S9VB 5T1KB 4OCWH 1CIUA 2HZHA 2CPCA 5H37H 1UZ6F 2APXA 2N01B 3MRGB 4OLXH 3GMOB 3SKMA 1NAMA 2ZT9C 4XN2A 3ETBF 2YRPA 4G8IB 1DJXA 4TF4A 1GCYA 3IE9A 3PL6D 4N2CA 3U0WL 4H8WL 2IAMC 1M9SA 2IBBA 1AYRA 3GXPA 4G5AA 4XTRC 1UM6L 2PWHA 5D1QB 1G7MB 3VXMA 4Z76A 1JGDB 1PVHA 4K23H 4U6XB 3U9PL 4BQCA 4JGNA 3ARFB 2FWSA 1SM3L 3WKMH 3US0A 1MFAL 3MRBB 4ZBJA 5ACLA 1JV5A 4K8RD 3JV6A 3VFMA 4NI6A 1CZ8H 1OWRM 1AMYA 2YFNA 1X7QA 5DA0B 1QHOA 1WWWX 3K6NA 5IT2L 2PR4H 4WW2F 4U3SA 1HYSD 1NFAA 1NGZA 4UIKH 3LQAH 3TH3T 2EKSA 3MUZ1 35C8H 4K5OA 3TBTA 4UF7C 1BG9A 1CE1L 4ZMVA 4PV8B 4NFCA 1FJ1B 1BDYA 4I77H 4N2OA 4Y1AD 3HE6C 3D85A 4RFNC 3V4PL 2AEWA 1J8HA 4QRUA 3X1EA 3DX6B 2Q8AL 3EBIA 2GKIA 2J4WL 4JFQA 1SJEB 4C4KT 2XZAL 1EPFA 4C83B 3TYGH 3A6CH 4R0LB 4GW5A 3CSFA 4TQEL 1GZHC 5AAWA 8CGTA 5EORL 3T77B 4CUCA 3GXUB 1NCWH 3GXNA 5DS1A 3IB4A 3M1OA 3OC5A 5CN2A 1K4CB 5CBAA 5EB9A 4RRPA 5GSRA 3ZY7A 1P1VA 4D7PA 4MBRA 1CGUA 5E94A 3LZLA 3FKUS 5CEXA 3NFNA 3C60D 1UM4L 2CJUL 3L5IA 2YPVL 1PY0A 3STZA 1YEFL 3PDOB 3GJEB 2R56H 1M7IB 4X4ME 5FO8A 3QO1B 5D1XB 5CIPH 3GYRA 4PVMA 2BP8B 5D93C 3MCKA 4BSJA 4JO1L 5C08B 4R96A 1MCLA 5GIRB 5EOQH 3UO8B 1AZRA 1F4WH 2J8UB 4GP8B 5T5FL 3K6SB 2X0VA 1T1XB 4H7VA 1JXGA 2YA0A 4F8TA 2B1OA 3NA4A 3MNDA 1J5IA 4MZ2A 3SDXE 3V0WH 4ODTH 3TBSB 1FUNA 2BNRA 3MYZA 2YSTA 4X9IA 1KMGA 5ADOH 4BUGA 1UFGA 1F4AA 3RWHA 3C6LD 2J5LC 1XF1A 3QUKB 2O5ZH 4U1GC 5IOPA 4KKLC 2X3AA 1DFXA 5JHBA 1MG3C 1S9VA 2A38A 2D03L 2FEEI 5F9AC 5T1KA 4LEEA 4BRJA 2XG4B 5T1JA 3QAZC 4GRWH 4PJCE 3WE6B 3MRGA 3QDHA 2CUMA 3GMOA 2LT9A 5MP6L 3CDFA 3LKOB 4OLZH 1GXEA 3JT0A 4G8IA 1S4IA 5IQLA 3ML8A 1JZ5A 3UG5A 4G42B 4NQQA 3ZKMD 3E38A 4CILA 4LB8A 1HH9A 2UZIH 1QRNE 4MZIA 4P23C 1G7MA 5D1QA 5L8LB 1JGDA 5KJRL 1L0YA 4FQCL 1F4YH 4U6XA 5GPRA 4ZMOA 5B3NA 3ARFA 3RY6A 1AQKH 5KYNA 1MRDL 1C7SA 4UQ3B 2EVJA 3MRBA 4F8LA 5DMKB 2DDQH 1ADWA 2VDNL 3OJDB 4OFQA 1JNNL 3ZE0F 4PSPA 3VGEA 4AC2A 5JDSB 4LEXL 4L2YA 2HKAA 2B3IA 2VXTL 3M88A 1ZT4B 2JNZA 4R90H 4AENB 1KEGL 3UYPA 1R6VA 2A9CA 4BINA 1BFOB 4WK2B 3GF8A 1KB5B 1TYJA 4PG2C 1EXHA 5GRJL 2I9LB 1SXNA 5I1LB 1FJ1A 1Z5HA 4BWUA 4DFHA 2IANB 2WK2A 3VFNB 3GMQB 4K5PA 1P5UB 3DX6A 1SJEA 4LHJB 3RL1B 3UPCA 1YYCA 4C83A 3BAIA 1YJDH 4F58L 2IV9A 2W38A 3UJJH 1VEOA 3ESPA 4OF7A 3UROR 5EBWB 4Y16B 3T77A 4NZDA 1V7NL 4LSVH 1ZANH 4AIEA 1F11B 4H40A 4P2OB 1UXMA 5GGTH 1K4CA 4AKOA 4G2AA 3Q8EA 2GCYB 3L5XL 1PKOA 4NAMA 4YBHA 2B5IC 4PJIB 4LVHB 3VMOA 3GRWA 2XTLA 5F7WC 2WN2A 3PDOA 4RBPH 4G3YH 1BXXA 3GJEA 1M7IA 3I9IA 3QO1A 2EXWC 4YZFE 3RBGA 2NLJA 5TTRA 4AL8L 3HUJE 2BP8A 4QI3A 3KXFB 5IOKA 4ZAKB 5C08A 3OHXC 4K7PX 3VE0B 4HWBH 3B9AA 5GIRA 4WJ5B 3GGWB 4JQVA 3V0AC 1ZGLB 3K6SA 2R0ZH 2CIIB 4ZUUB 2ZE0A 2IPKB 2DB8A 3O4OB 3WIFA 4GW4B 2FQEA 4WHYH 3MR9B 4ADJA 1WPCA 4MCZB 2PKDA 5BOPA 4C8XA 1CE6B 2D7TH 3QFDA 3TBSA 2GEQA 5AKTA 3WBDA 3UTTD 1J0JA 3OLIA 1EJFA 1ASOA 5FM5M 3M07A 1H8NA 1IRAY 1G94A 2NT1A 2A9ML 4J3OD 4E41E 1JE6A 4XBEL 4LP4A 1VPOH 2TRYA 4FL4B 3QDMD 4FN0A 5IEHB 4I4WB 4MA3B 2WANA 1OHQA 4X80L 3QYCA 5GSVB 2XG4A 3HJEA 4KTGA 4XNUL 3WE6A 5I6NA 4W1TA 3DO7B 1KPUB 1IGFL 2CRZA 3ATFA 2AXWA 3PFUA 3LKOA 2AQ1A 3FTSA 5J7CC 4LFHD 1INQB 4YZWA 1TPXB 4G42A 1J18A 2WZ5A 3GD1C 1DVFD 1Y07A 2BY0A 5GZND 3WU1A 1BEYH 1CK0L 3LV3B 4LBEB 4XN4A 3C5XA 1FFQA 2R83A 2FQGA 3ARBD 4JRYD 1RK1B 2QPDB 3C6SA 2WBJC 5DMKA 4JFZH 1E28B 3RQ3A 4FX5A 3F7YB 3GPSA 4A7TA 2K4WA 5DMYA 3OJDA 3UZEA 3ZKXB 4AZUA 5TPWH 5JDSA 1MSPA 1T04B 2A4ZA 3GSWB 4OF3A 4B9KC 5F93C 5KBMA 4ANUA 2AFNA 2RCSL 3EFOB 4AENA 1V3JA 4MDIA 3TO2B 1KB5A 4MNGB 5HPMB 4O9HL 2I9LA 3MRCB 1LGVA 1ADQH 2DF3A 5SWSB 2H1LM 2IANA 1K2DA 2XXGA 3BT2L 1E6JH 4K5NA 3GMQA 5FW7A 4RMTA 2OSWA 1P5UA 3LMJL 3VFNA 1F45A 1W8EA 3ECVA 4X5LA 5J1SC 3FQWB 1PD6A 2YA1A 2E75C 4JFWA 3P4LA 3UJTH 4TSBL 5ID0B 3VD4A 2CHZA 2FX7H 3IJYB 5DMIH 4M3KB 1MCOL 4Y16A 1UC6A 5L4FA 1LO5B 2ITCB 1UADC 1F11A 4P2OA 2AJUL 4PJ8C 4AGPA 1P69B 2MPAH 2GCYA 3CN3A 1OSZB 2KT6A 2W9LA 1A7QH 3FO0H 15C8L 4DPBX 1XEDA 4PJIA 3RY5A 3KLQA 1UGNA 4UT6L 1PJWA 1I82A 2QV4A 3DYPA 5DS8A 2ZXGA 5F1SA 2NR6D 3WL9B 9PCYA 4OLYL 3II2A 3QDAA 2VDPL 3KWTA 1UZ8A 2W9DH 5HHOB 5K9JL 2G4GA 1BLIA 3LRHA 1WV7T 3AROA 5GRZA 1W16A 1A4AA 3KXFA 3HR5B 4ZAKA 3G5XB 4LDCA 1WFTA 4WJ5A 1NAKL 3GINA 3CXFA 2NXZB 1FNEB 2IOMA 4XT1C 3V9FA 2IPKA 4F2MB 5LKNA 3FXIC 4GW4A 3FPYA 2LW3A 4YSOA 3FJTA 2OK0L 5BZZA 3HA0A 3MR9A 5AW7B 4NUPA 5KVDL 3DUSA 5IJKC 3KDPB 1CE6A 2FH6A 2BFVH 5AW3B 2D3NA 3O2WH 1T03H 4CJ0A 4PW4A 5DUBA 2WVVB 2BLFA 4QF1A 4IW4C 3OPZL 4PJDF 3QI9A 3WNJA 1KTDB 4I4WA 1XCQB 4MA3A 4TS6A 4UNTA 5IEHA 5D7EA 5C09E 1PG7X 3X12B 5GSVA 4ZS7L 3VUAA 4W9FC 4N26A 4QKXB 1TJXA 5FYKE 3TT3L 1KPUA 4Z7QE 3DO7A 3FUEA 4N28A 3QPXH 4FI7A 1PD1A 4G8GB 4WJKB 5DUPH 2WXPA 3A4EA 1HCFX 4M62H 5DD6B 1INQA 2L7JA 3HPLB 4P59L 5AVTB 2FECL 3LV3A 4HFWA 4PGDB 2CWRA 3N85L 4IKNA 4OCXL 3HFMH 4PRHE 1RK1A 1KIRA 3ARVA 4H88H 4M6NL 2VLKD 3OKLB 1F58H 5HGGS 1E28A 2EDKA 3F7YA 4Y4FD 5CHNA 3TVMD 2Z34A 4LRIA 1EAPB 4UANA 5DJAA 5I8CB 2DWEB 5E8EB 2IBZX 1A14L 2WMPB 4G6MH 2D31B 4EKJA 3H3PL 3OGOE 4FKEA 5EPMB 1WCBB 3UG4A 1IBBA 4C4UA 1RCYA 3MRCA 4AKQA 3ZE2E 4NENB 5F7NC 5SWSA 4X9FA 3JWNE 2DJ4A 3Q8FA 3MJ8B 1OAXH 2O6DA 2O4EA 5KUMA 4OI8A 1XGYL 3NIDB 4MAYB 1EFXB 3P0VH 1FNSH 1XGQB 2AEOA 5ID0A 4LOFA 2YPLB 3I74A 3BE1L 3IJYA 4MDRA 4NQCE 5E6YA 1P84K 5SV4A 3FFOA 4LRNH 5BOZG 4UCFA 3WTWA 1SN0A 2ITCA 4TNVF 4PBDA 5CGMA 1OSZA 3V95A 3VM5A 3WFBL 1QFPA 2NY2B 4FABH 4M6ML 5IJDC 2WPGA 1LWRA 2AJXL 3WL9A 3TFBA 3SDAC 2Y7MA 3E6FB 4LCIH 4H1LB 4NM4L 2ZXBA 2Y06H 1SN2A 2Z8RA 1NGPL 3I6GA 5HHOA 4P9HL 3BIKB 1QTYT 1F8TL 3RY4A 3ESOA 4K8RL 4N0CC 1PX3A 3SBPA 1BEXA 3A47A 1T2QH 2D9QB 3G5XA 4A7GA 1ICTA 1S9XB 2XNAA 1ILSA 1W72L 4NGHL 1FNEA 1DBBL 3EHBC 4LLYB 2YUZA 1IBGH 4F2MA 4XAKE 4KY1H 3FQRB 2FD6H 2X44D 4TQPA 1GMIA 4X5WB 3QULB 3VXTB 4UNUA 1DVSA 1PF3A 3L8QA 3P30H 3VU2A 2APBA 4IHOA 3QUZB 4HOWA 4J6RH 4X6EB 4W9KC 2WVVA 1MW2A 2LFGA 4QNPF 2PPDA 3HS8A 3D85D 2EEXA 1YQVL 3F00A 1KTDA 4JZNA 1J8HD 1XCQA 4KTYA 4YHNA 3S35L 1G4RA 3X12A 1DE4B 3S2CA 5CILH 3ZPDA 5EDSA 4WCYL 1TO4A 2NZ9C 4HF5L 4YE0A 3QDJE 4G8GA 3IWUA 5DD5L 5DD6A 1AXSB 2VWEE 1J1OL 4O2FB 3UPAA 3ZTNH 4A2FA 4KQ3H 4RNRA 2E4FA 1DUYB 5D2LF 1S7XA 2LR4A 4TM9A 1AO7B 1E6OH 2VXUH 4JMXA 2WBXA 3IWVA 3BP7A 1SFDA 4Y5YA 3A24A 3BKJL 4W9LC 4AIOA 2RD0A 3QZPA 5D7LB 4CVZB 1EAPA 3PLYA 4K3JH 4RGMC 2X12A 3UGXA 5I8CA 5E8EA 1YEEH 1II4E 3LKPB 1A3LL 2D31A 4XNQB 4IK6A 3VD1A 4LVOC 5FO9B 1MVYA 5EIIA 1SJMA 4GRMB 5EPMA 1WCBA 4HZ1A 3K1DA 4IRZH 2Q8BL 4JDTH 4FA7B 2PCXA 3BUYA 1EO7A 5LCVL 2DTML 3APMA 3FSOA 5JOPE 5L2KD 3N50A 4AQ1C 3ZL4H 3V4LA 4HIXH 3DHMA 2FWUA 3EBAA 5LGHH 5FPIA 1SJHB 4XBPB 1S6NA 4KU1A 1ZT7B 2BNRD 3CIAA 1BQHA 1A7BA 4MAYA 1VKXB 1EFXA 1WTLA 1NANI 1OAQL 4QRRA 1XGQA 3M46A 2CM6A 2HLFC 2X4RB 2YPLA 1W6LA 3DECA 3BUIA 1WDAA 1BJMA 5T1KD 4JJ5B 3FTZA 2FCBA 3AADB 3BEVA 4D9QD 1TJHH 5CN3A 3IRCA 1YEKH 2ED7A 3WNLA 5JA8B 1IKFL 1IAOB 1GKEA 4L8SC 5CR8A 4IIQA 1JNLL 3NSJA 4GY4A 1GJWA 3EH3B 3BWSA 3QIWB 4F9LC 1YY9D 3GBLA 4JQIL 5I5JA 4H1LA 3UL4A 4ODXB 5MEOB 2NTSP 4KZDH 1CI5A 4X5QA 2QKIC 3BIKA 4MJIE 3BN3B 2WO4A 5D1QD 3TFKD 4X9BA 4DK3A 1JGUL 3AS1A 1S7WB 2XV2A 2Z8SA 3E1F1 3EAKA 4QRQB 3ARFD 5FV1L 3SKJH 1LMIA 1OSYA 1SBBA 4U7SA 2FSEB 4LLYA 4DUWA 3TPKA 2WLKA 2HH0H 4KX9A 4YSUA 3FQRA 2UZPA 4X5WA 1I53A 3IDGA 4W6WB 1PEWA 4FCAA 3QULA 5IVOA 3U48A 2C9XA 3NCEB 2QFRA 3SBWC 4JO3H 4CGTA 3VXTA 4JS7A 3I3EA 1VGKB 1CGSH 3RWCB 4QXGL 4NP9A 4OB5L 3QUZA 5CZVL 1WT5C 3CFBB 4X6EA 1KFGA 3K0YA 1WWAX 2FE0A 4QRTA 1MFCH 1QD0A 5AOJA 1CLZH 3P3TA 1DE4A 1OCWH 3O6LL 2VT0A 2AXFB 3MBEC 3WJLC 1MZZA 3OZ9H 3O6FC 3A67H 4OLWL 1TG8A 2J1KA 1KLUB 1AXSA 1J8RA 4O2FA 1L4IA 2ICEC 5FCUH 1MZYA 4HJUA 4MJJA 1UJ3C 2QQNH 1Z1WA 3UBXG 1RUKL 5IESH 1UCBL 4ZMYA 5E7BA 3RJDA 1BZDA 1DUYA 6PAZA 2J5WA 4RFNB 4UTCA 1AO7A 3MLYH 4S1SH 2HMIC 2GJJA 3O45A 5JO5B 3DBXB 5HYJA 4N8CH 2Z1KA 1R75A 2FNWA 3HLKA 5FEBA 5IGXH 5D1XD 4Q74A 2H2PD 1I8MB 1CG9A 4J2XA 2DQFB 5D7LA 4CVZA 1DBKH 2MHAA 4IRJB 2XXFA 5DZLA 1CMOA 4OZHB 4R97B 3EYVB 4LSUH 1FI8C 5C08D 2H6UA 1A47A 4Q97A 4XNQA 3CC5B 4G70B 5FO9A 1CUOA 4FQIH 1RK0B 3IAPA 4GRMA 4KK6D 2Z4TA 3DPDA 1WFMA 4UI2A 5GRYA 2VE6B 4R5XA 4PIBA 2QDVA 4OGXH 3NJHA 4GSDH 2CDFB 2H0FA 3V10A 4N0UB 4HW6A 1SJHA 4M8VA 4XBPA 3S36L 5FK9B 5FXCH 1ZT7A 2X28A 3AC0A 3P4MB 4KX8A 2K1MA 4PS8A 1QHQA 1U8KB 3NAAL 4TRPL 3AG4B 4ZT1A 1PBYA 1MFBL 3KWUA 1CDCA 1TZHB 1ACXA 1H6UA 4TVUA 4PRPE 1OT1A 2BO0A 3ZZ1A 4LNRA 1DJHA 1MWAB 1ORQB 4BV1A 3GIZL 4MJ6A 1IAOA 4PJ9C 2OCJA 1TEFA 3VNYA 3QIWA 2VXQL 2OMTB 3PFQA 3SE3C 4GKSB 4ODXA 2APVA 2O5XL 4K9EH 5HVGB 3WO3B 3IF1A 3T0EB 1XB3A 3RX5A 1TVHB 4HSQA 3BJ91 3NK4A 4I2XB 4TQIA 4U1GB 3GLAA 3KYKL 1TFHA 1S7WA 1IAII 1U95A 1VACA 1GJIA 2WHVA 4UBDD 4QRQA 5GHWH 2APSA 1BREA 2FSEA 1CYGA 3K2IA 3UC0L 1IC5H 1MRCL 2DQJH 3OJMB 5AOKA 4FXGC 3S5LG 3B2UD 3KPSA 5EN2B 2UXVA 1AACA 2G9HB 5FWQA 2E9IA 2FB4H 4OFIA 1JERA 1VGKA 4UYQA 5EC2B 1BD2B 3CFBA 4OF0A 3U9UB 2BX5A 2EH8H 5GS3A 1RZIB 5EIQA 4XC3H 1A7RL 1E8WA 1FF5A 2IAND 4HWZB 1PDKA 1LK2B 3V4VB 2KHAA 2WNGA 5IFHL 1J48A 3ECUA 2WP3T 4MB5A 4AYDC 2W8CA 2B1HH 4JG5A 4NPJA 1QA9B 1TR7A 2P9RA 3Q2WA 4U6VL 4Y5XC 4BCXA 4Y16D 1KLUA 1GMEA 4P2OD 4PJ7E 2DN7A 2K4AA 4HLZG 5BV7H 1CFTB 2FO4B 4YSEA 2OJZL 4R4NC 2NY3C 3K8KA 3O3DB 4PS4H 3TU6A 1A9EA 5JO5A 5GRWA 1D7BA 1YNTA 1OP3K 1P1ZB 2CUHA 2R2CA 1I8MA 2QT6A 1P4UA 1PJ9A 4ZO8A 5DYFA 1S7TB 3KHOA 4IRJA 1AI1L 5DJ0B 1E5YA 3L4WA 3US1A 5IVXA 3KGTA 4OZHA 1GZHA 3IMWA 3EYVA 3KXFD 1TLMA 2IGTA 4YDVA 4ZAKD 2EDHA 2Y3AA 5E5RB 1MCBA 2P5EE 3CC5A 4LESA 4ZPVB 1RK0A 2O61B 3BVUA 2IOOA 4EDXB 2YSSA 3SZ6A 3ASWA 4HC1L 1G7JB 2NT0A 5DWPA 5DK2B 5I8KH 3VW3H 2P5WE 1NPUA 5I1JL 4KUZL 2CDFA 2FEEL 3QJVB 4M1GH 1SOQA 4MCNA 4J3SA 4N0UA 2JELH 4KKZA 5FK9A 4MXVF 1M6UA 2W9EH 3PAYA 4OM0L 1Q9LB 4RFOH 4BE6A 3A3YB 2J8HA 1U8KA 4UDUB 4M6OH 3ZZLA 3HFFA 1TZHA 2OTWB 3OHXB 4AGNA 1MRFH 2BNQE 2JF1A 2I32A 2X6CA 2XVBA 3QG7H 4BXSV 4KI5D 1JFQH 2HTKC 3L3IA 3QCVL 5FYJD 1ORQA 3UFIA 4Z7VB 1S3KH 2ZXAA 2H2SC 4R4FL 4W9CC 2R69A 3S7GA 5AG8A 5I19L 3WKQA 4XNDA 2AC0A 4PLKC 4QAWA 1CXIA 3GDBA 4HG4K 1BWMA 3DX0A 3KMDA 1P7QB 2OMTA 4YDZA 3ZDXB 3WELA 4GKSA 1AZNA 4FJZA 2G3ZA 4AEFA 5IVZB 1DYZA 4FFYH 1YN6B 4ANWA 3T0EA 5EF2A 1TVHA 3CG8A 4I2XA 4P5SA 3NQKA 3GB7B 2VR5A 2NUTB 3HZKA 4OF6A 4RGOL 1NEPA 2XBZA 4PI2A 2VZ1A 2WXJA 1AQDB 2RACA 2AQ2A 5DUMH 4JN2B 5MEPB 1KJ2L 1NL0L 4GAYB 4NQSB 5EN2A 3QIUC 3VI3B 4KRPC 4NO0B 5B3SB 2RGSA 5F7YC 1WRFA 2WQRA 3QFJA 4OZGF 3CFKB 2PTUA 5EC2A 4B53A 1NBVL 4FXLA 4N2AA 4P23A 4PJHF 1BD2A 3U9UA 3ETBJ 2WZPA 2B9BA 3PXJA 1RZQA 5SWSD 1HE7A 4HWZA 3V4VA 1LK2A 3MPCA 4NUGH 1FGNH 4LHQB 1S5HA 2XWJB 4W93A 3PF2A 1HL8A 1Z32X 3D3VE 4ZNCD 3NMEA 1U6AL 4ZX6A 4ZI8A 1QA9A 1W15A 3FQXB 4JREC 5AZ2L 3ZT6A 5LBSH 4EDWH 4ALAL 4PY7B 1NAML 4J3OF 4Q0XL 4CL7A 4URTB 3D87B 1CDJA 4W9HC 1HHKB 4WI0B 5GS1B 2CO4A 5DQJB 4HXAL 4Z7WB 2FO4A 3E1ZA 4N9GB 4LLWB 4N25A 2MCAA 1RUQH 3B2XA 5EO0B 1MI5E 1S78C 3LKSB 3O3DA 5GS2D 4A2EA 1G0YR 5L4JA 3G5WA 3QARA 3CDGB 4Z95H 1YYMH 2BSTB 1OT4A 3E3QE 4GKZB 1P1ZA 4WNSA 5HHOD 1S7TA 3OVUB 5DJ0A 2DIJA 4S1DC 3QPQD 3I9AA 2ATAA 3BUTA 3GLDA 4HPOL 4ZPVA 3MDJA 1IJ9A 2NXZD 4PJ8B 3TO4C 4Y9BA 4HLJA 1QX1A 3DPBB 5EULV 5JOFA 3MNWA 1G7JA 3BD3A 2ZOTA 2WWKT 5CLYA 2GJPA 2ZXQA 2VXVL 2X7LB 4AVKA 3ZTCC 1XH0A 1E4XL 1TLKA 3A6OA 1A4CA 4XPGH 3G08B 4DTGH 1G9NL 2V4LA 1ID5I 2DQCL 3TP4A 4X9YA 4Z6AT 1DZBA 2GSGB 4UDUA 1LO0L 1YNLH 2WINB 4J6IA 5TDOB 3U2SB 3OHXA 2WGNB 4PWGA 5I24A 5G55A 4NHCH 5H37G 3S5YA 4AUUA 1ZE3H 4ZOCA 5DD0H 4Z7VA 3MODH 4BZ2H 3IJ9A 1KELL 2R0LL 5A7BA 3V55A 5I1HH 2EEDA 5J3HD 1JMZA 3JV0A 4W4NA 2LOEA 3ZE1F 4G8GD 2CO6B 2JQZA 1P7QA 1CTNA 3O41A 4X5XB 5IP4A 5IVZA 2FR4B 1UT2A 1JPEA 2G0LA 2NY7L 2DS4A 2YGPA 2QGBA 1JPSH 2VWEC 4AM0Q 2BW5A 1T1WB 3GB7A 4DKFH 2DWDB 3TEWA 1DBAL 2ZX7A 1XGPA 3PXHA 3CDZB 1AQDA 5MEPA 4JN2A 1KZQA 2X3CA 4GAYA 4NQSA 3J07A 3VI3A 2ZJSH 3CSTA 3KS0J 4UMGA 4YL4A 2WTRA 2BHFA 1TTUA 3V0EA 2IF7A 1KBKA 4NNPH 1LDPH 2FEDC 3BO8A 5EZJB 3VB8A 5IMMB 2XWJA 4S1QH 2C1OA 2HG0A 4MAYD 3FUFA 1EFXD 3LHAA 3BRDA 3OKOB 3UYRH 2CKBB 2Y72A 4PJGF 2YPLD 4K15A 4F7KA 2AI0H 4XCCH 1MIEH 4PY7A 1RIHH 4WI0A 5I76A 5GS1A 3GHEL 2V8MA 1HJCA 1AQHA 3T0VA 4Z7WA 2COVD 4N9GA 4LLWA 4G1MB 3V6BR 2NY2D 3LKSA 4N68A 3P11L 2HFGL 4HJ0C 5F9WC 3CDGA 2Y6SC 2BSTA 4OCMC 2VLME 1CLVA 4GKZA 2VM4A 2WAQA 1C5BL 3MU3A 3NJVA 2F8XC 1JS4A 4GI9A 4UDTB 3WNIA 4I88A 3ZRFC 1QNZL 4GAFB 3UCQA 4ZSOB 1D5XA 4J28A 2CCWA 2OS7A 4XNXH 5BRZE 2BXYA 4AMKL 4YSTA 4G9DB 1J12A 2LU7A 3WLWC 1AQ8A 4PJ8A 2OP4H 3LY6A 3DPBA 3T2LA 2NQDA 4DGYH 2VB5A 2AF2A 2R29A 1GGIH 4DP2X 4IM8A 4B95C 5J56B 4NN6C 2JQAA 4LHUA 1KGJA 3L7FB 3SDAB 1BGXH 3FPXA 1E8ZA 4MS6A 3DJRA 3FU9A 4NEHB 4AE0A 3GIVA 5JIKA 2JIXB 4JRXE 2GSGA 5EEYA 3QUZD 4LCWE 2NDFA 3NCWA 5IV2B 5TDOA 2V17L 4YR6A 5HGDB 5CP3A 2XACC 2ZWLT 2J73A 4X7DC 5DR5L 4A7QA 4TUJA 5D7IE 3DJ9A 3FB8B 3N41B 1UKQA 1RPKA 1RZFL 2KDGA 3RX7A 3MJ9H 2YQGA 5CZXC 3DV4B 5IJKA 4X7SH 2CO6A 1TJIL 3IFLL 4YXLH 2D7OA 1YA5A 2OMVB 3GRWL 1FDLL 1KCKA 4X5XA 3G5YB 2FR4A 1AOZA 1IBZA 2EH7L 4YQXL 1TETH 4JFUA 4LIQE 2AP2A 4HG4J 1AO7D 1T1WA 2DWDA 3MJ7B 1ED3B 1THCA 3CZKA 3QB7C 1F6FB 3WFZA 4BGLA 1IGIH 3CDZA 1KIPB 3IPBA 3Q5YA 3MRDB 1IFRA 1TIUA 5D7LD 1H3WM 1FE8H 4JFYB 5JZ7D 1FPTL 2VABB 3NIGF 3DHJA 4OZIA 2H9GA 5H4YA 5B1CA 4GRWE 4CNIB 3GFUA 4KKQA 4Q2ZB 3RUGE 1KCSH 1OARH 1HI6B 1O6VA 2FUTA 3B2VH 3LHPH 4MMZC 3CXDH 4N87A 5EZJA 1A02N 4MX7B 1UB6B 3T6XA 2WLNA 4WNQB 2DI8A 4L1HA 3IAGC 4BCZA 4DN4L 3OKOA 4P3CH 3SE8H 4RGMB 2CKBA 4B6ZA 4NSKA 2P8LB 2Y36H 5I9QC 5IJBC 1F3DH 1BVNT 3FC8A 3FU5A 4NCC1 3QW9A 4PB9L 2BVPB 3L13A 5J4MA 4G1MA 4YX2L 3HNSL 3E2HC 1UYWH 1IGMH 4KDVA 3UAJA 4LQFL 4AQ1B 3QIWD 1HNYA 1YSOA 2DBLH 3Q06A 4XAWH 2BDNH 2WAHA 3NCJH 3TWCH 1CBVL 4ODSH 1DO6A 3GUFA 4UDTA 4CVUA 1IIIA 1LXMA 4JL1A 4P4RB 5F44A 3SODB 5C0ND 2P42B 4ZSOA 3PUCA 4K3EH 4JHAL 4MFHA 4ANXA 1T0NB 3HE7C 3SKNB 4G9DA 2GW5A 5D4IA 1WBXB 4ZRGA 3SGKA 1EGJA 2BJML 5DRXB 4HS3B 2CDEB 1KB5L 3EH5B 5IKCB 2ZCKH 1UKSA 3SDAA 1WYJA 2Y7LA 2MTAA 1QBML 4JPKH 2IV8A 1MCKA 2QKIB 5FR3A 3EJJX 3KL3A 3K4DA 3UO1L 4DVRH 5IV2A 3A4AA 3LKQB 2O5YH 2V3DA 3L4UA 5HGDA 1JXJA 1UJTA 2AJSL 1U8HB 4Q9RH 1MIML 1QRNB 1BF5A 4FQ1H 1MCPH 4J3UA 1HESA 3K4ZA 1N67A 2DQTH 3BQVA 3DV4A 4CN6A 3RZWA 1XGTB 3NQIA 5E2UH 1RJCA 5EWIL 4K71C 4PP1D 4JPSA 2OMVA 4R8WL 3EADA 2R7EB 1E5ZA 1G9ML 1E2ZA 3CH1B 1LTXA 2G5BB 1ONQB 2EDFA 5D5ME 3DI3B 2YN5A 4TULL 2ZONA 1I9IL 3MJ7A 1A7NL 2IG2L 1OAKH 1KIPA 3MRDA 4HKBB 4IRJD 3AXLA 3KPRB 3O6FB 4J27A 5IQMA 2H1XA 2NY1C 4U6HB 4ZUWB 1UG9A 4GQQA 5FWRA 3NFSH 2E0PA 4M3HA 4ZOBA 4CNIA 4HV8A 3GTTA 5CD3B 2E74C 3D25B 4Q2ZA 2TRHA 5E2VL 1HI6A 4UNIA 3HG5A 1LO4H 3T0WA 2DMGA 4MX7A 5TH2B 5I1DA 1UB6A 3FQTB 2K45A 4G9FE 4WNQA 3EOYG 2O6FA 1VADB 2BSSB 1FVEB 3GC3A 4HJ1A 4OCYH 5FYJL 2VDML 5MI0C 2EVGA 4KTDH 4NC2B 1WTGT 1T20B 4UQ9A 4X0NA 1WVZA 1HXMA 4X4MA 1GC1H 4X7FC 3O8XC 1E50A 2G30A 4RDBA 4Z78B 4HK0B 5C86A 4CSPA 5D7SH 1O0VA 3ARSA 2BVPA 3GBNL 4PPTA 1R5VB 2X4SB 2AKRB 1FV1B 4AQ1A 5C2BH 1C7TA 1A4BA 5LNEA 4F15B 3S35X 2XA8H 4OCLC 3UTPD 1SMAA 3HC3L 3T0ED 3SDXA 4P4RA 4L0YA 3Q44A 1RHFA 1DQMH 3WYRA 1T0NA 3QUYC 3SKNA 2DQUH 1WBXA 3CSYA 4L8SA 1ZJAA 1MLCB 5DRXA 2CDEA 4HH9B 4OCNC 5IKCA 1F3RB 4UT9A 4PJCA 4F9LA 3O6KL 1NPJA 2J56A 2PWGA 1TQTA 2XKNB 5C07B 4XN8A 3MOBH 3NP3A 3OB0H 2ZAIA 4KC3B 1UA3A 2QKIA 4QRFA 1CR9L 1XSKA 1J5OL 1BD2D 1J0YA 4B97A 4F27A 3LKQA 2QQQA 3G04B 4OGZA 2BERA 4AEIL 1R3IH 3KLAB 3HI1B 1QRNA 2VDOB 3L1GA 3WHE1 4HFUH 3MGAA 4K5MA 1TZGH 3C8KB 4FXGB 1ECZA 3EJSA 1SY6H 2YXWA 4JL2A 3E8VA 3SBWA 4X8CA 3VVWA 5JQIB 2GSMB 4IMKC 4M00A 1OP3H 5HJBA 2F74A 3UBGA 3BPOC 3HW7A 1TZIB 1WT5A 3V5HA 3CH1A 1ONQA 3ZN6A 1CU4H 3WD5H 1EZLA 3M86A 3MHZA 4A2MA 1CXHA 2OXHA 5DJCB 4DETA 3CK0H 5IHHA 5KEZA 3BQUB 3C6EA 3WJLA 3RWFB 1U4FA 4D8PB 5FGCB 4AEHH 3DX4A 4Y5XB 1UWYA 3KPRA 1HAWA 3O6FA 4R7NB 4F33B 3E3QC 2YAOA 2AAVA 3ULVH 4NJAL 4U6HA 4NXSA 3PUUA 4JDVA 4ZUWA 1D9KB 3BPNC 3ESMA 5T33H 4N5EC 5E9NA 5EIVA 2E6PA 5B39G 2NY3B 5CD3A 4QUOA 1YEIH 4JDZB 2P4AB 2H4EA 5JHAA 5TH2A 1MH5B 2OCFD 4FQPA 1UD5A 2EXWD 1VADA 2BSSA 1FVEA 4WKZB 3TCTA 1NMCC 1T20A 4NFDA 2MPVA 3BEWB 1JZJA 3I84A 3P77B 4WI4A 1RLWA 4RGNE 1Q1JH 4HK0A 4OAWB 4XX5A 2NYZA 2ZUYA 3HUJA 3T3ME 4KJPC 1A3RL 1R5VA 2KL6A 2X4SA 3CPUA 3GS0A 3T0DA 1CLYH 1ZWIB 3APFA 2A5UA 3DUHA 1KJMB 3GKZA 3SQOH 3K71B 1P7QD 43C9B 1RURL 3RIFF 4G6JL 4F20A 2IPTL 3DKHA 1CE1H 4N2DA 5CEZE 1I1FB 4DO6A 2VRAA 3P4NA 2VDKH 3EH2A 1TQSA 3AVEA 4Z7OF 5KBNC 4PMFA 5FF6B 3SSGA 4QHMB 3T6QC 3ZHNA 3V4UL 4E41A 2E7MA 2X9WA 4PJIF 1OSPL 5D1ZC 5FIEA 3GHBH 3AWEA 5GZOD 1MLCA 4PJ9A 5CP7B 2CK0H 4KV5E 1XR9B 3PWJB 5TE6L 5C09B 1C8QA 3RVTC 5EORH 4OFDA 2XICA 4NO0D 3SE3A 1RUAL 4R26L 2XKNA 4V1DE 3T1FB 1X5LA 1JRHH 4Z7QB 1E27B 1K8IB 1TQUA 2WXNA 2YEZB 1B0GB 1QACA 3QC5X 5ESAB 4OCRL 4PGCB 4BKLB 5ICZB 1SVZA 4M5YL 5I1IL 4F57L 3G04A 3P9MB 2VDLB 3ZUCA 2EACA 2W60B 1UM4H 3D7PA 3KLAA 3HI1A 2D3VA 2CMRL 4ZUTB 4DP7X 4ENEC 5I75C 5M95B 5D4QA 1Z7JA 4TUUA 3V0VB 1WUZA 4A1RA 2CGZA 4PRHB 5CJQH 1A6PA 3AB0C 3C8KA 4FXGA 5TE4H 4OM1L 3IDMA 3QCUL 1ZRUA 1GYUA 3ARUA 3QIUB 4JO1H 5LGKA 5HDOA 2GBAA 3J2PA 2LTQC 5AKVA 3D4ZA 5T3XH 2QQKH 4DP1X 5I28A 5DZVA 1TZIA 2AXHA 1VENA 3ARQA 4DGWC 1CF1A 2K7QA 4HUUB 1JP5A 2IMMA 3CFUA 5F71A 1ZA6B 4WFEE 3HMWL 2X1QA 4DGIL 2LU4A 3ZE2B 4KXZH 1BZ9B 5F3HB 3GXDA 3LZQA 3BQUA 2ILLA 3RWFA 2CQVA 2CO1A 4H2AA 4XNYH 4Y1SA 4Y5XA 3TEYA 2NW2B 4JG1L 4F33A 4R7NA 4HIJB 2AQTA 2Y5TB 3FUDA 3LQAC 4YUEL 1SQ2N 4ABWA 3ECWA 2D03H 3NACL 1D9KA 4AGMA 4PJ8D 4GQ9L 4NQCB 1VEMA 4G1EB 1J05B 3LPFA 2J6EH 2JB6B 2MNWA 1FFNA 1UT1A 4JDZA 3D69B 4CDGC 5CM1A 2YJQA 2G2PA 5AVXB 3IMSA 1G1CA 3VYPA 5DC0A 4AM0B 4WKZA 1CFSB 2FLBT 2R1XA 3PJSB 5CS7A 2AHIA 3BEWA 3P77A 5TF0A 2DLFL 5FYLD 1ZLSL 1BAFH 3MOQA 3AT8A 3NSFA 3QUMA 3TO4B 4XVJH 2MOQA 1WUNT 3O0LA 3EDFA 3FAXA 1RZKL 1GGYA 3QP3A 1RJLB 2IVFC 1JNNH 1AG6A 5GGVL 1SEBB 1ZWIA 4X8XA 1KJMA 1D7DA 3DX9B 3K71A 2HG5B 4TL4A 3L16A 5AQ0A 4GJTB 1I1FA 1MFNA 4EZLA 1X5JA 2ERJC 2X4UB 2CJ3A 1UASA 2IQAB 5FF6A 4GBXC 4QHMA 2VNCA 1SYVB 3MJGX 2XC8A 2BVOB 4A67A 5CP7A 3U4BH 1XR9A 2R4RL 5C09A 2P52A 5F3FA 1FYTE 2QHLA 2C9SA 1ZLDA 2B59A 3GNML 1WHOA 3T1FA 2DQIL 3G5ZA 4FTVE 1URIA 2G60H 1E27A 1K8IA 4ICXA 3ROOB 1RZGB 1B0GA 2OJ1A 1CICB 2GT9B 4A7GF 2ZCHL 3NIFE 2ATPB 4IRSC 2EDDA 2C9QA 4PGCA 5ICZA 1H8LA 1JOIA 4NWTL 3FQNA 2W60A 5G4NA 1IFHL 2EVHA 4XH2B 3NJGA 1SMDA 4ZUTA 4PS7A 1DLFL 1EA9C 2DLIA 2DQEL 3V0VA 1X4YA 4GRLC 1AXTL 4PRHA 1NOFA 2X2IA 3LOWA 3B4NA 3QIUA 1UURA 1S8DB 2XETA 2M1KA 2J20A 4Y4KB 1KV3A 3GSUA 1RPQA 2NRDA 4GG6E 3LEYL 4JKPH 1OTUC 4HUUA 5J89A 3UAJD 3DOSA 4NKMB 4BRVA 1ZA6A 2VCOA 5IK3A 4CJ1A 5K33A 2G5UA 1BZ9A 4XP9L 5DFWH 1CDGA 5F3HA 4Z3TA 4DW2L 3ZMNA 2DKMA 3NSYA 3VM7A 1HSBB 5FS5A 1LM8V 1KIQB 1WA0X 4ODWB 4XBEH 4HIJA 5I18L 2G5RA 4OZFH 2VW4A 2Y5TA 4NZTH 3UBHA 3WIIH 1VZHA 4I89A 3CBJB 5CJOL 4AZ8B 4U6TA 3HR6A 1BOYA 4WW1B 4NQCA 3FOLB 3GZPA 2E9WA 1J05A 2PTTB 1GR7A 3VXSE 1GAFL 1N0XH 1IGFH 2JB6A 1D6VH 1UHVA 3GI9L 5F9WB 3EYSL 3NEXA 3SDAD 4N8VA 1WISA 5JPMC 2BH0A 3M7OA 2Z7ZA 4AM0A 1YJDC 3GMPA 1CFSA 3BH9B 3DO3A 5AB0A 2W91A 2JIXD 3PJSA 1BFVL 2YKLH 5KW9L 1Q0YL 1VRSA 3FMGL 2ZWZA 4FNUA 5D7KE 3TJEH 2XT1B 2NMSA 3VFUB 3TO4A 4J3WA 4E0RB 3F12B 4I7ZC 4JPWH 4KJWC 3L4TA 5ITBL 4TL5A 5K9KB 1RJLA 1DQLH 1DVQA 3TYFB 1LQSR 3VQMA 5EH1A 4JR9L 2IPUG 1CFMA 4Q9QL 1JHKL 1SEBA 4JFTA 1SXBA 1TVBB 1USZA 2HG5A 1ZT1A 2FT6A 3FN0H 2XZCL 3HZ3A 5FFOA 5CFAA 3ELAT 1DLHB 2OZNA 4O9HH 2BIMA 4NUJB 4ZQTA 1JYNA 3ZTEA 4DH2A 2Z7WA 4LDOB 5D8JH 3BCDA 1E8XA 3BT2H 1V54B 3LMJH 3KPMB 4BIKA 1SYVA 2F08A 2DTSA 2KUTA 2RH0A 3CC1A 3TIEB 2BVOA 2Q1EA 4KXAA 1M3IA 4XCFL 4WFHE 5E4IA 3CX5K 5B7MA 3EDDA 1W0WA 5BZXA 5IW6A 2I07A 3U1PA 2UXGA 4OT1H 3CLEL 4Q58C 3RX9A 2XWTA 2VSKB 2EZ0D 4YSAA 1G6RB 3CN4A 3ROOA 1RZGA 1H3UA 1CICA 2GT9A 3QDJA 3V0JA 1OTSC 1RV6X 2WLLB 3BMWA 3W82A 1HYRC 1B90A 4D7BA 1KLGB 4ATTA 4XH2A 4P0DA 3CH8A 4OLYH 1B0IA 1WZ1L 3C9NA 5ESVB 1UZGA 4TQHA 4G71B 5ETUB 4WSJA 1U3ZA 5IREA 3TN0C 4CA4A 5IMKB 1VSCA 4Q9CA 5HGHB 2GG1A 3CLWA 4JE4B 1YC7A 1NMAH 3MLXL 2R69L 2OCCB 1S8DA 3UABA 2NDGA 3LRMA 4Y4KA 5F7MC 2ENJA 5EEVA 4PGZA 1E7VA 1N8ZB 1BZQK 2YGNA 4DPCX 1FFOB 4NNXB 1DL7L 4MD5A 3B5TA 3TH4T 4JY6A 4MMZB 4BH7B 1QPKA 4J3TA 5F7EL 5EC1B 3K74B 4UTAA 3TIDB 1JAEA 1HSBA 2Q7NA 1KWKA 4Y89A 1AHMA 1KIQA 1KXTB 1T5XB 1W9XA 3ZW3A 3BHBB 3OPZH 2JVUA 4AZ8A 5ILTH 2Z91B 1OTTC 1M9WA 3FOLA 3D0LB 2PTTA 5E0FA 1OCRB 3E2HB 4GUCA 2FBRA 4XOEA 4WI7A 1JZIA 5K59E 1BVLB 2ICWB 4AVIA 2H5UA 1YMME 1U8OB 3V4VL 4ZMNA 5I73B 43CAB 3GSVB 3BH9A 1OPOA 5F9OL 3SE9H 4D0DB 1LNUB 4YBQC 3N85H 3RVVC 1BQKA 4OCXH 5JMOC 5CNHA 3LH9A 4YHOH 3BISA 3BDYL 4MJIA 1QRND 3DGGA 2D3LA 5C7XL 3OF6A 4DKEL 4E0RA 3L7EA 1QI5A 5ALCH 5K9KA 5IHUH 3L4ZA 1RFDL 1KGIA 3TYFA 1DVUA 4F9PC 2YBRB 4XB7A 5DHEA 2HN7B 1TVBA 3TBWB 1A14H 1BXUA 4MAZA 3W2DL 3SHSA 3W5NA 4O4YL 1YYLL 4D9LL 3U4AA 4NUJA 5JA9A 2CK2A 2YOAA 4ZMZA 3I6LE 1FP5A 1JI1A 5B7EA 1O6SB 1PLGL 3IM1A 4Z23A 1CO1A 3KPMA 4JFDE 1DN2A 3CVHB 3TIEA 1QQDB 4PJBE 2XSKA 3ZX1A 2BZCA 2DQHH 1N6QH 1MHEB 5C0FB 3BE1H 3KPRD 3O6FD 3DTDA 5KVEL 5AFAA 3SGEH 1GJUA 3TF4A 4NJ9L 4XMKL 5CU5A 1G6RA 2OPCA 4LF3B 4IBVA 2ZQKA 5ANME 3UGEA 4TNWF 4O02H 2WLLA 5KG9B 5C0CB 1AOHA 5BUGA 1KLGA 2KZ1B 4QOKE 2QMKA 4PJ7B 2HMID 4D3CL 4W68A 4QEGA 2R51A 2CUAA 4NM4H 5ICUA 5KSAC 5ETUA 1U91A 3HG3A 4DQOH 4P9HH 1RY7B 1F2QA 1SXCA 3OMAB 4KKBD 4K8RH 4WJG3 4XPTL 4ZFOB 1FVCB 5DK0B 5IMKA 5HGHA 3H9YA 3SQBB 4A68A 4WEBH 3NGBC 4EUPA 4DCQA 4L4TE 1P4IH 1DBBH 3WTUA 3KBEA 4XO5A 4X0KB 3BRFA 1LEGB 5GRVL 2FVNA 2P5EB 1Y1UA 3L2NA 4RGNC 4WI5A 4JNXA 2HVJB 4J7RA 4MMZA 1WEJH 3ZYOA 3NJJA 3NCCB 5EC1A 2P5WB 4MD4B 3ETTA 4ELDA 2AMUA 1J5CA 3TIDA 1SHWA 1CFQB 1KCLA 4PCTA 5F6IC 5HXMA 3FO2B 1KXTA 1T5XA 2OBGA 4P06A 1EEYB 7PAZA 4XMVA 2G75B 3VGAB 3BHBA 4CMMB 2CHWA 2ZP8A 3L5JA 3EO1B 4PLJD 3SDCC 2Z91A 3MLUL 3S98A 3UBXA 1VAHA 3SGJC 4FFZA 3SPGA 3D0LA 3ZIYA 2B15A 3GK8L 1FFPB 3DXAB 4P57B 2BNQB 3LRGA 4PRPA 1I85C 2BY1A 4TVPL 5HDBB 5AB9A 2CIKA 2P26A 1YNTF 5AVUB 3L1OL 5DZ9A 2ICWA 2IC2A 2MRYA 5C07D 5IVXF 3OKDB 3OLEA 4OZHF 2RMNA 43CAA 3GSVA 3BSZH 3N3EA 1RP8A 4ZD3L 3MRKA 3VFOA 1LNUA 3DWTA 3MLWL 3R0NA 4U0QB 5ELIA 5FA3B 3EYUL 2H26B 1HIMH 4LK4A 3QUYB 3HE7A 1JI2A 3OM3B 2W1NA 4PMEA 4Q6YA 1IT9L 1UB5B 1J1PL 3SPCA 1OALA 4YHYC 2HN7A 3TBWA 3QEUA 3H2PA 4XP4L 1CLOH 4X2UA 4ES8A 4IKKA 1NGXB 4D94A 4FLSA 3QWRA 4HT1L 3RTQB 5D71L 3LRKA 1PPIA 3IDXL 2D0FA 2OMBA 2DTMH 2VR8A 4TUKH 4YHPA 3GSXB 3IJHB 3NN8A 5EEWA 3GSQA 3DV6A 5AVRB 4DP9X 1M2OA 1CYXA 3ARDC 3WDIA 2G2RB 4HD9A 1MDTA 2AK4B 3E0GA 4XNZC 5IEKB 3BQUD 2AJYL 4HS6A 1MHEA 4YLQT 2YIHA 3C5ZC 3FYIB 1SMOA 4PJ6A 1X9UA 3DX2A 5HHVL 4LSTL 2R29L 1T2JA 1G7IA 3G9AB 4BEIA 2V7HB 4ZMWA 2KLRA 3GXIA 1D9KD 1A6VL 3BPOB 3LB6C 4LF3A 4NO3B 4MRCA 1Q8MA 5DHYB 4I1PA 1BPLB 1BM3L 4IU3B 4RWHA 2BY3A 5KG9A 2NY3D 2X10A 1JF5A 4WU7B 5D72H 3K8LA 2Z64C 4PJ7A 1D5ZA 2GTWB 5E5UB 1XF2B 1D6EB 4XO3A 1CXKA 4IJTA 1JHLL 3MRPB 1MI5B 2H8PA 1A4JB 2EE6A 4KO9A 5HJGA 3WJMB 5J11B 3UZVB 4ZFOA 3H56A 5DI8B 2ESVE 1KSRA 1FVCA 5DK0A 1XXFC 1JGUH 3A6BH 4AYEC 4HWUA 3SQBA 5A2FA 3G6DH 5K69A 1KPRB 3RYMA 2YD6A 2ZX8A 4X0KA 3WEOA 5DLML 5DZAA 3C2SA 2P5EA 5EA0L 1V7ML 3B2PA 3FOMB 1KJVB 2A1WL 2HVJA 4EPSA 3KNBA 4RISH 2EEAA 3RDTC 4TMPA 4BA8A 3W81A 4NUQA 2P5WA 4NWUL 1ZS8B 2XRAH 4L3AA 1NMCB 1CFQA 4WI2A 1MREL 3H53A 4FQ2L 3MLSH 3W56A 3FO2A 4BHUI 1NCNA 3QRGL 4I0CC 5I66B 1EEYA 4CMMA 2G75A 5TDNB 4GO6B 2NCMA 4KFMA 2EXSA 5J12B 1C1EL 3D48R 5PCYA 2VDQL 2HX8A 2H2SD 2XTSA 4AGQA 3DUUB 4P57A 2D0HA 2BNQA 4R5VA 5HDRA 4BQ9A 2FT8A 1WA2X 4DGUA 4ODHL 5IIEA 3FFDB 5C09D 2ADYA 3HBGA 4MGXA 4FYRA 5FYKD 1JYWA 3DIDA 3OKDA 3CHOA 3QXUA 1KXVC 3FHAA 5JW3H 1KGXA 3WDJA 5IMOB 4AVHA 2ZKYA 5IHZB 2GHZA 3CSBA 5CXPA 3ZGIA 4RAUB 2H26A 3HAEH 3QUYA 2CKBL 2ZG1A 4UOJA 4P5RA 1FZJA 1L7TL 3VWJC 1UM5H 5D1ZB 1ZY9A 3F58L 4PRHD 4FQXC 4FQLH 1HZKA 1UB5A 2ZZUT 4FA6A 4NO2B 4Z7AA 3QIUD 1R3HB 2F15A 3V6ZA 4NDMB 1TTRA 1NGXA 3VU1A 2ENYA 3JVFC 5DD3L 5IG7B 3RTQA 2DD8H 5I0YA 1ES0B 2P48B 4L1LA 5KSBE 4OGYL 4Z7VF 3VX1A 3GSXA 2VDRH 3IJHA 1H3XA 4DPAX 1ZSHA 3S4SB 5ICYB 5KVFH 1TVDA 1OK8A 3VH8A 3NZHH 2PYEE 4WCYH 5DEFB 3QK0A 2AK4A 5A2KH 5IEKA 4GEIA 3AB0B 1I7RB 3MLRL 2Q7YB 3ZDXF 3OWRA 1DQDH 1KGWA 1EGJL 1BQLL 1I31A 2D7PA 3D3VA 2LTQB 2V7HA 4YWGH 3EFFB 4XPHH 4QLWA 4NO3A 4NQCD 1OCCB 1RZPA 4KWUA 5DHYA 1UWXK 4WU7A 1S78D 3HRZC 5AW2B 4LCYB 2GTWA 3UBXI 1XF2A 4L4VB 1D6EA 2EE3A 1O6TA 3VXQA 1JNJA 1FHNA 1NCDH 1MI5A 3MRPA 3A4FA 2XQ0A 3VI3F 3WJMA 5CLTA 4XB8A 3UZVA 1LVEA 2VMJA 3T04D 4S1DD 5DI8A 4HMCA 3SDDC 3LDBC 2ICWI 1QO3A 3KYKH 4B96A 2YGQA 5DHVH 3RWIA 1KPRA 3WY4A 3TO4D 4F8OA 5KYUB 3GMRB 1NA8A 4M7ZB 1NICA 5BRZB 3CZGA 2X42A 4CC0A 1KJVA 3AAZB 3DNKA 4J8QA 3INUL 2YZ1A 2HUEA 4PJ5E 5KBLA 4XAKD 1ZS8A 4LEBA 4EI0A 1SXAA 5B4MD 2A77L 2WBWB 2BHZA 2JTYA 1UACL 3IFPA 2CA4A 5I66A 4Z7WF 5TDNA 2VC2H 1R0AL 3K6IA 4LCWB 3DETC 1C16B 4GSRA 3QXVA 1AZZC 3IXAB 4MNQB 4GAGL 3L9BA 5HTSA 1NMBH 5C9KA 3MV7B 1N5YH 3FFDA 5D7IB 5DJ8A 1SEQH 3ZU8A 5CIPB 3AU1B 3B9KC 1HKLH 3DJZA 2ZKHL 4X8JB 1CICD 1Q9OB 3C2AL 1Q0EA 2IADA 2IXQB 3CMOL 5IMOA 4XXCC 5L9DL 4RAUA 1P4LB 5AW8B 4QHPA 4FMFA 1FH5H 1T66C 5GGRB 3QXAB 5D1ZA 2R2EB 1OD9A 5L2JB 1R19A 4J23A 1AI1H 2OR9H 4JM4L 4N4YB 4XO9A 4B50A 4JY4B 3B9VA 1R3HA 4AV5A 3X3FH 4NZ8A 4XE0A 4L8CB 1WZLA 4W4OC 5C3LD 2CCVA 4K9EC 1A5FL 1KYOJ 3V52L 5AD0B 4Y4KD 3U30C 5B3JE 4FFWC 1ES0A 4XI5C 3Q9PA 2LHAA 1BZOA 5I1JH 3CN1A 1AZVA 5ICYA 4KMTH 4X6FA 3S4SA 3U25A 1WAPA 2PO6C 4PWJA 4GRWB 2LQRA 4K3GA 3T3PE 2Y7QB 3DI2B 1ASPA 3RUGB 3DYOA 5JOPD 4OM0H 3LCYA 1YZZA 3MACL 1RVFH 2JXMB 1H6TA 2C3GA 2NNRA 2Q7YA 4F1ZA 5E24E 3ZHDA 3HI5L 4KO7A 4ZNEE 2IMNA 5A16B 3A4DA 3EFFA 1B2WH 2IDSA 4UT9L 5FM5O 5I0ZA 1TU2B 1KC5H 4R4FH 1UWGL 2V2XA 4Z3EA 1GYWA 1S5IL 2DLGA 4LCYA 2Y6SD 4QTFA 3JVGC 3NT0A 1BXVA 2D4DA 4L2LA 4HETA 5LNDA 5HDQL 4R7XA 3VGFA 3N1QC 3MOAL 3S34H 4OZIF 1L3WA 4I85A 2XKSA 5JW4M 2ETWA 4RZKA 2MFNA 3QUHA 5BV7C 5I0DA 2IFFL 5KYUA 3OF6D 3GMRA 1FORH 4RGOH 3MI6A 4JM0A 4WWKC 5ICXA 5BRZA 1JGLH 3UDWC 1I8KB 1KJ2H 3AAZA 1HC1A 4XMPH 4JFOB 5AVZB 2K7PA 4YGVB 3ESUF 5JPMB 2GC4C 3BYYA 3HEIB 1GHFL 2X9YA 1E9PB 1MVFA 4QYAA 3FN9A 1CT8B 4XWGL 1JTTA 3CHXA 1QFWL 3EJYC 3CFCH 4JRXA 4LCWA 2AEQH 3IE4A 1C16A 1I8UA 4BSVB 2VH5L 3IXAA 5CGBA 4F8QA 4FFVD 1JK9B 3HTLX 5B8CC 4MMXB 2F5BL 3QQXA 4XVUC 5CZXD 2IWFA 4PGBB 5AZ2H 2OULB 5I1CH 4ALAH 1INEL 4WIQA 5D7IA 5CIPA 3AU1A 3W0WE 2TSBA 4OIIL 5KSVB 2N59A 4X8JA 2P1YA 4HXAH 1Q9OA 1F5WA 5AOMA 4Q9BA 4ONFL 1RKRA 1RMFL 1MUJB 3F04A 1E4KA 2LU3A 2XWCA 5AVSB 1P4LA 1L6PA 2CLZB 1DJZA 4LMQI 3QXAA 3UOAB 4M03A 4JPVL 2R2EA 5IBUB 4NKIL 5D5MB 3EF4A 1GGTA 2XKUA 4HOZA 5M94B 4JY4A 2WXIA 1HXYB 1CGTA 3SCMB 4L8CA 5D2NB 3T8XB 1MCHA 5AD0A 3VXRE 4UILL 1IGTB 3GSNB 1WGVA 2A9NH 2EDOA 1NFIB 2MKWA 4IRSA 4FFTA 4ODVL 5KN5B 1EXUB 3GZKA 4X6BB 32C2B 4WLCA 4LOEA 4ATWA 1IQWH 2Y7QA 1G9NH 1L0XA 3RUGA 2DQCH 4L18A 2JXMA 4KK9C 4LDEB 1F90H 1BZ8A 3L2MA 3MLRH 3WLBB 2YPKB 4G9FB 3AW5A 5DVPA 3TH2T 4YIQB 2R8SH 5A16A 1DBJH 3GXMA 4Y1TA 1PZSA 1CURA 1TU2A 2WV3A 4DGVL 2R0LH 4WV1C 1A6UL 5DQ9B 3N9GH 4M7LH 1ZVSB 4MXWH 4YDLC 1MJUH 1NSNL 2VW7A 4G6KL 4LE8A 5FO7B 3RKDC 3RLSA 4UT7H 2X70A 3SDYL 2PP8A 2VDOL 3ZYZA 2NY7H 2WY3B 3VYOA 1R3KB 4HIIB 1ETJA 5EOTB 4FZ8L 3EFDL 3O9WC 4WRLA 4POUB 4Y9FA 4NZRL 2V5SA 1WCQA 1J0ZA 1I8KA 2HFTA 4QHUB 3FU0A 4JFOA 5IBLD 2BNUB 2AJZB 3ULVE 5JPMA 3FF7A 2L7EA 5ACMA 5CEYA 2CBMA 3VCLB 1CF8L 3QWRD 4LKXB 3VGDA 1E9PA 1KJ3L 1OGAE 1XTMA 1LK3L 3ARPA 5C0RL 2LABA 1TJMA 3QEHB 1CT8A 1JPFB 2CD0A 3KJ4C 3QEQB 5DJYB 1B3JA 4JO4L 5GGTA 4XNMB 3KVPA 2AANA 3QA3B 2ZOOA 3CFNA 4L1TA 2LGNA 4DUVA 5F96L 5HYSG 2EILB 4XN7A 1JK9A 1X7SA 2WLIB 4MMXA 4X7EC 4DK6A 2I5YH 5KZCB 2YUXA 1EDQA 2EDRA 3SDXF 3VXOB 3S9DB 4M5ZH 2N7AA 5KSVA 5F9DC 1VGEL 4F7TB 2BW4A 2OAAA 1BPVA 1SLWA 1I9RL 1NIFA 1MUJA 3L3OC 4HWBA 4W9ZA 5C0CD 1IKOP 3CFTA 3WTTA 1BQUA 2HFGH 4RETB 1ZE3C 2W0FB 4Q6IB 2CLZA 2W65A 1Q94B 2Z4QA 5FGBA 1C5BH 5D5MA 3QUML 4I3SH 4NO5A 4PJCF 1JXDA 3ENEA 4M56A 3OV6A 3D52A 4YE4L 5D6DC 3O3UN 4LZKA 3I3DA 1KCVH 2YAEA 4IS6B 4Z7NE 1HXYA 2WVUA 3SCMA 4ZQKB 2YO3A 2YEQA 1BV8A 5L88H 3T8XA 5FAAA 4PWFA 1WHPA 1IGTA 3GSNA 5ESQB 5I8OH 1SXSA 1NFIA 2P5PA 1EFQA 3RVUD 2P5ED 1E90A 2C3HA 1EXUA 4X6BA 4NP4H 3IU4L 3VRIA 4BA0A 3WOVA 1OSEA 3Q2VA 5KSAB 2ZTBA 2P5WD 4BM7A 1FIGH 3V2AR 1NLDL 1KBVA 3QVAA 4JY5L 5F2FA 4GIAA 4FG6D 2ORBH 1U2CA 3WXWL 12E8H 2A6IB 5KTEH 1LQBC 2C7UA 1VCAA 3HB3C 3WLBA 1ZIBA 4N6RB 4G9FA 3PIQB 1QBLH 5BS0E 3VD3A 4YSQA 2Y7OA 5IMLB 4YIQA 3KR3H 2XPGB 1DQKA 3IDIB 5C0JB 2Y3NA 5JYLA 5FYKL 3SJVE 3DXAD 5CINL 5EBGA 2BNQD 3JYCA 3ZHKA 1TITA 5DQ9A 1ZVSA 4R83A 1JG9A 1M42A 1TJIH 3ZKNC 5D7JC 3FQYA 3LZFL 3ZT5A 2VDLL 5F7BA 1HWGB 3GRWH 1FDLH 1T6VN 3OBAA 5T3XE 5HI5D 2CNYA 4YDKL 4YQXH 3WAKA 1IC4H 1AD9A 2VITB 3EBGA 5E4EB 1R3KA 3QORB 4HIIA 1UQSB 4PG9B 5EOTA 3QUYD 4A2DA 3T0BA 2HP4A 1QR1B 1S3RA 2IDTA 3MRHA 4YC2C 1ADQA 4XMTA 5IHWA 4P48A 4U1KB 3BXNA 5F7UA 2EUZA 3MV11 5EZLB 1RU9H 1BF2A 2GEEA 5EG6C 5E8DH 3MLTA 2BNUA 3TASA 2AJZA 2NCEA 5JQ6L 1DANU 1SRDA 3VCLA 1NCCL 3RTQD 4QLRA 1CLCA 4LLMB 4OKDA 4CAGA 1YMHB 5EU3A 3QEHA 3NSXA 2I27N 4YZFF 1JPFA 3KYAA 3GO1L 4V1DB 2KC0A 5DJYA 3HUJF 5KOVC 2FYYB 3BGFC 3HRPA 3QS2A 4XNMA 5JW4N 4ERSL 3DSFL 5HHNB 1QLEL 5C3IA 1X7TA 3Q7JA 3QA3A 1FNAA 3T1WA 4RMUA 2VDPB 1GYVA 2AK4D 4CC4C 3E9UA 4DN4H 3U1SL 2WLIA 4F9PA 3KW7A 4R7DA 4BK8A 3ULUH 3MLZH 1OPGH 5LB1A 3LH2L 4NRXB 2FYVA 1UH3A 4N1HB 4U33A 3VXOA 2H41A 1RUMH 1T22B 4HHAB 3M1CA 4F7TA 2KZBA 3VDCA 4JO2L 4YX2H 2FIKB 3PP4L 5DT1L 3UPRB 4JHWH 4TQ8A 2YEVB 3RJOA 1WIPA 2W0FA 4Q6IA 2EUWA 1Q94A 3P2TA 3N91A 1I3RB 1IC0A 1ETA1 1MI5D 5C0BE 1OANA 3QJSB 1KIUB 1KBGH 3TV3L 4AQEA 5CGTA 5IM7B 4IS6A 4IYKA 3SBRA 3IGAB 3EH4B 4ZQKA 5KYWB 3IETB 4KRMB 3SYCA 3FRPB 1QSEE 1A6WH 4M7JL 4PWIA 1T7XA 1KPVB 2KERA 4AQZA 4Z7UE 5EU4B 2HCZX 3OPUA 3Q5OA 4XP6H 2FWLB 5L7XH 3BRGC 5EEUA 4GXFA 4GUOA 1HEHC 5A2IH 1Z3GH 2AABH 2GK0B 2H6OA 4TLUA 4C54A 5KSAA 3GDCA 4HXBH 5E9AA 4PRAB 3DARA 2XZQL 3ESVF 2A6IA 2FNBA 1PKQE 2WQSA 3QR1A 4N6RA 4X6CE 1V5JA 2PXYB 3PIQA 1UUNA 1MHHB 3MGOB 2AJSH 3NFPA 1G5AA 1KCBA 4MXQC 1KENH 4NBXB 2XPGA 3BOVA 2A83B 3IDIA 4XOAA 4YK4B 4GKOA 5C0JA 4KJPD 2OV0A 1ZLVH 3FBQA 1GOFA 4NPKA 4K55A 1NKRA 3CD4A 3ZVVA 5T1LB 4L9LC 1A9BA 1EAOA 4HWEL 3RDTB 3Q6FA 3DYMA 3ATBA 4YHNB 2AK1L 3U7YH 1V55B 4J4PC 4Q7DA 2EDBA 1JF1A 1T1YB 1HTYA 2UXFA 4P4KC 2BP3A 4UNVA 1MDAA 1M7UA 2BS9A 4MB1A 3ZQXA 5I1EL 4NQEE 2VITA 2NTFB 2R9HD 2WM0A 3ALPA 1UQSA 3QORA 2GQHA 4PG9A 4L1SA 1QR1A 3OAZK 3TA4D 3K6DA 4OJFL 3BZ4A 3L3JB 3SGJA 4NRYA 5D1ZD 3ZHFA 5JUEH 1C08B 2L8AA 5K39B 4NN7B 4AW7A 1I85A 2LVEA 4U1KA 1U3JA 1VFAA 4KOBA 5EZLA 1D5RA 2O1AA 1MAKA 2YD8A 3BP4B 1R3JB 1GH7A 3ET9F 1G87A 4M1DL 1R33A 4K7PL 3TBVB 2MCPL 3BDBA 3F84A 4LLMA 4KHXL 4QHLB 4YO0A 3GI8H 4HU8A 1T7VA 4UTAL 4V1DA 2EYSA 5E2VH 1E43A 2FYYA 2ADFH 3MRNB 2I26N 5EZOL 3VWJB 5DJ6A 2AXGA 3RPIB 3HN8A 3GPEA 5FYJH 3S88L 3HC4L 3TURA 3RIAF 1UWXH 3F7PC 1A8ZA 2GIMA 3P3YA 1QVOB 2ZYIA 1YNKL 1U0QA 3U6XA 2EINB 3D39E 4ZFGL 3QRFM 5AYUH 1MEXL 5B1JC 1T22A 1G7QB 3QHZL 2RJMA 4HHAA 1KY7A 4XPFH 1IFGA 4N22A 4AUJA 2FIKA 3UPRA 5GRUH 4PUBL 1MJ8H 2AZAA 4HLEA 1EHKB 2OM5A 1QZ1A 1LO2L 3S3BB 2R2HB 4L4VD 1ET8A 1B0RA 2DL9A 4GG6B 1N7ML 5I15H 4FJYA 1I3RA 1TEYA 4HPYH 2IBZY 4FXTA 5JHLH 1KIUA 1PD0A 2EDLA 4NZUL 4Z7QF 2VISB 2VLMD 2QPEB 3VG0L 5IZ7A 2JFCA 3C5JB 3IGAA 1ZV9A 2GTQA 3IETA 1YEHH 5LJYH 5JQHC 3FRPA 1A8JH 2FH8A 3QC6X 2B16A 2VSMB 2EDNA 4PV1C 2CGRL 5EU4A 1MFDH 5BRZD 1KV7A 4WAFA 2OX5B 3JV4A 2AW2A 1TSRA 1E30A 2GPZA 1W2KT 3LKRB 3O6KH 3U83A 3TGXA 2GK0A 3VXSB 4KTEH 2DRUA 4HAGA 3LS4H 3P3UA 4J12A 4JUSA 1Z5LB 3EOTL 3SDDB 3BKML 2M8XA 3LDBB 1Y0LB 4PJXE 2QZ5A 1XVSA 2PXYA 2J1YA 1ZTXH 1YEWA 5D70H 4CU6A 1W80A 1T7YA 1MHHA 1LO3L 1FO0H 2QR0B 4FJ6A 4KZEL 4ABUA 4LCWD 1FRGL 1YEJL 2A83A 5F1IA 3UACA 4OLVH 2Z92B 1BAGA 1S9KC 4MNQD 1KCRH 3MV7D 3ZE2F 1ZEAH 1BFTA 3EJUA 2ODHA 3HNVL 3TBBA 2ZKWA 5CAYB 4X83A 3PJNA 3RDTA 4PJEE 1IGCL 2WQ8A 4XXDB 4R84A 2UZXB 4W9JC 1EDYA 4YH6A 4NM8H 1T1YA 2DL2A 1RZ7L 4E2OA 4CRPA 1GC1C 5LDSA 3MTXA 2NTFA 4J3BA 3VDBA 4MKMA 2DBJA 1I75A 2OLDA 1IBFA 4IRZA 4ZXBB 3KYMB 3L3JA 1MFEL 3ZQ9A 3LXUX 5HHPB 1G7HB 3BIAX 4MB4A 5G4OA 4OJYA 3ZDYE 5I0WA 4YPJA 3BP4A 4BFKA 4CW1B 3B9KB 5DVNA 3O0RL 4U05A 4U3HA 2ZPKL 1E8YA 2BIHA 1CGXA 1KXVA 3V5DB 1FYTA 4HCGA 1USQA 4JK0D 4FTVA 4EXPX 1JGVL 2D2CC 3MRNA 2IQ9H 3S37H 2OSYA 1ZHBA 3VWJA 3ZUNC 3IPEA 5GS0H 3TZVC 3RPIA 2HTLD 2JI1A 4HEPA 2JJTC 2DLEA 3CZNA 1WZAA 5TQ2H 1H0DA 1OE2A 4FFZL 1PTZA 2HPOA 2QHRH 1GZPB 1N5AB 1QVOA 3KEHA 5J13C 4MVBC 2GIYA 1MKFA 2I60H 3TV8A 1NDGB 3WS3B 3ZL2A 1G7QA 4GQZA 1MCFA 1P0SE 2K9FB 3U36B 1M4KA 1PG7L 3HHMA 1OTUD 2WUCH 2A74B 3D51A 1TKWA 1MQ8A 2XXMB 2R2HA 4FQJH 4JCLA 3RA7L 4Y4HC 4GG6A 3MUGB 4G6JH 4DZ8B 5EZIL 3QZWA 1EHLH 1BBDL 5JXEC 3WI9A 3DTUB 1OVZA 4MQXD 2VISA 4JJHA 3UERA 1OE1A 4UOW0 4GT0A 3C5JA 1J87A 2HT3C 1N6UA 3BAEH 3V4UH 3D50A 4TLSA 2JJSC 2QLVB 2FQFA 3QZMA 3HRZA 2XV0A 3JWOC 1B4TA 2W92A 2VZVA 3OHMB 2OX5A 1A7PL 4KJQC 3LKRA 1RUAH 3NA9H 1A64A 3VXSA 5JDJA 5KANG 2B4CH 3OD3A 3LS5H 3FHEA 3MRIB 4HCRH 5C92A 3SDDA 4J5VA 2XX1A 1Y0LA 3ULVC 4KY2A 1K5WA 1YMMB 4U4BA 1D5IH 4RZCB 1RIUL 2QR0A 2CMRH 5BV7B 3IGLA 1RJZA 1QUPA 4AIZA 5HHXH 3N42B 4NKQB 4XMWA 4ZS6C 2XWRA 3O6ML 4MNHB 1JPTL 1CFNA 4DP0X 4PJHB 5TE7H 4NCC2 1LD9B 4OM1H 2MKLC 5JOEA 1SHMA 3ECQA 2O72A 5A3IC 4N0FB 3CCHB 4ZDHB 3RILA 4FNQA 3GBML 4XXDA 1C5CH 2YGVA 2O6PA 5HJDA 2B0SL 1JPGA 2BS71 4UAOC 4XMLH 4E9LA 1AGFA 3CX2A 3OXSA 3QQ9C 3BUPA 4ZFOL 3NVQA 1A0QH 2YN3A 4P9ML 3RGVC 4ZXBA 3KYMA 4N2BA 5HHPA 5DVLA 1G7HA 4H2CA 5B8CB 3LIZA 4JVUA 4EO5A 1E2WA 3FF8A 4XVSL 5CSZB 4JFDB 2MCMA 4HS8H 5IQ9B 5EO9A 2YMXL 5ALBH 1A6ZB 4PJBB 3CN2A 3SCMD 3HPJB 4AV4A 4CW1A 3B9KA 1ACYL 1Y1DA 3IJSB 3D34A 4JB9H 1CI3M 1OTSD 1ECYA 3OLGA 3V5DA 2WKLA 5T5NG 1TYEB 2X87A 3QQ3B 4XXCA 3QO0B 3RWEB 2N1TE 2ZWKA 1GGBH 1DVFB 2HWZL 2YQBA 5ANMB 3RJQB 1UWEH 2VM3A 2ED9A 3EO9L 3OJ2C 4JLRB 5I82A 3CHRA 3VYNA 3GKWL 1CFVH 5AAPA 3FH8A 2R27A 1GZPA 1N5AA 3QDGE 4G9FD 2DLFH 3DMMC 3MLVH 3QCTL 5B1AB 1RULH 3QUXC 3R4RA 4X99B 5E1QA 1KBBA 2N0MA 2QLYA 4JHBA 5LQBH 3WS3A 3HVDA 1NUNB 3U36A 1Z9LA 1RZKH 5GISH 3RI5F 1UFUA 2GJZB 3GJFH 1EJOL 5GGVH 3PGDB 2PO6A 2WQXA 4O2CA 4PM1A 3B9DA 3N1GC 3ZZQA 2D7QA 4DZ8A 4JVWA 3FAWA 4PB0L 1N64H 4ORZC 3CMGA 5JLZB 4JGMA 4B9FA 2R1WA 3GSOB 2BFGA 5F9JB 5C6WH 3ZE1B 1D2OA 3CTTA 2LV4A 3FU3A 3OKKB 4LEOA 2FATL 5D7HA 4QHKJ 5T1MB 9CGTA 5TFSH 5BJTB 1L0PA 1ND0B 1UOLA 3A23A 4KNQA 3K5RA 3O3BB 4O51B 5DJZA 4YDLB 4BWTA 1O9ZA 5DA4A 1D7FA 3JVGA 2YQ3A 2DQIH 3I2CH 2GJ6E 2QMJA 4LPCA 3VRLE 3MRIA 3N44B 2GI0A 4GIPD 4YMPA 3LXBA 4EIGB 3DRTB 4XC1H 1FZOB 1ZKAA 5E00B 4D8OA 1YCSA 1YMMA 2WZAA 3QEQD 5GGQL 1TJGH 3CBKB 4RZCA 3ABMB 3O9WB 2K9UA 1RJYB 4MNHA 2IDFA 4WZ9A 2MCG1 2MJWA 1LD9A 4HOMA 5KZCD 3ME0B 3HZYB 3MNMA 1E7UA 5CCKL 2NSQA 1AY1L 1E4WL 4ADIA 4N0FA 3CCHA 4ZDHA 3JV5A 4XPBH 4OBSA 4APQC 5F7HA 5IWLC 2ZSWB 2EDTA 3WCYA 1KFAL 3KJ4B 3Q8CA 5LAXB 4F3FB 3LPWA 2FLMA 3S3PA 5I0XA 1FG9C 1XSOA 1MY5A 3ABZA 3KPTA 1PY9A 4JZOB 5E8NB 4YOKA 1C12B 2GITB 1BVNP 1WBYA 4IOIA 5FHBH 3AQXA 4DW2H