2AHJB

Nitrile hydratase complexed with nitric oxide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
211
structure length
211
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRILE HYDRATASE
molecule tags Lyase
publication title Novel non-heme iron center of nitrile hydratase with a claw setting of oxygen atoms.
pubmed doi rcsb
total genus 55
structure length 211
sequence length 211
chains with identical sequence D
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 1997-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2ahjB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ahjB02
4OB1B 4KT0E 3QZ5B 3A8MB 2WSEE 2WSCE 4OB0B 1QP2A 4ZGDB 4FM4B 1DJ7B 2DXCA 1UGQB 1AHJB 4L6V5 2ZCFB 3A8LB 3QZ9B 2PUKB 3WVEB 3QYGB 2ZPEB 3QYHB 2WSFE 1PSEA 2DXCB 5L8RE 3X28B 3X25B 4OB3B 2DD4A 2PUOB 3X26B 3A8GB 4ZGEB 2CYZB 2DD4B 2D0QB 2PU9B 2DXBA 4Y28E 1QP3A 3A8HB 3HHTB 2ZPGB 2CZ0B 4ZGJB 1UGSB 3VYGA 1UGRB 2ZPFB 2ZZDB 3QXEB 2CZ7B 1JB0E 2AHJB 1UGPB 1IREB 3X20B 2O01E 3A8OB 2DPPB 4OB2B 4XK8E 2ZZDA 3VYGB 3VYHB 1PSFA 3LW5E 2ZPIB 2CZ1B 3WVDB 3X24B 2ZPBB 2ZPHB 2DXBB 2PVGB 4RKUE 1GXIE 2PVDB 2DD5B 2QDYB 2PVOB 1V29B 2CZ6B 2DD5A
chains in the Genus database with same CATH superfamily
1ZLMA 4M7AA 4M77B 3JRZA 1M5Q1 3M53A 4M7AD 3EG3A 1M3CA 2F69A 8ATCB 3HFOA 2DM1A 2L0AA 1WX6A 2EPDA 5HVYB 4XTVA 3SDZA 3EG1A 3HRSA 4NOYA 4M7DD 2MOXA 2LJ0A 2OTJA 1S72A 2KRNA 3CMET 4BE2A 1G5VA 2QYZA 3F5XB 1N6AA 1H26B 2K9GA 4HCKA 1N9RA 3GNFB 4HVUA 3CCLA 4QW2A 4DBHA 2E5KA 3D7SB 2WACA 2DF6A 1TFBA 1WHMA 2LQ8A 1XQHA 3TVTA 4X34A 1MV0B 3OA6A 3QWLA 1VQ8A 4EOMB 2EAYA 2M51A 4B9XA 4JZ3A 5GAOl 3CQTA 1EZZB 3OB9A 1VQ7Q 3P8HA 5KYUB 2GQIA 2HQXA 4DQ2A 1VQ5T 2QGGA 3M4YA 2D0QB 3H4CA 4JX6A 2JMAA 1BU1A 4F7UF 3E9FA 3NMZC 1M1KR 4M77E 1M90U 3HHTB 2DTIA 1M1GA 4RTVA 2C06A 2B86A 2E64A 3V7SA 2EJ9A 1NPPA 2BZ8A 4C8QA 2P0QA 2CP5A 1RLPC 4UC4A 1VQ7A 2MK5A 1Q7YU 2QTVA 4YOZA 3E19A 4RTYA 2HBWA 1UJ0A 3MCAB 2LMJA 3CPFA 2M0YA 3DL1A 1VUBA 2EFIA 4RUGA 3JB9I 1YI2Q 2FYKA 1JU5C 1AT1B 4BDZA 2DJQA 3I35A 4E2FB 5HY6A 2ZPBB 2A0FB 5A2QE 4DOVA 1N4MA 2PVGB 4HNVA 1X2QA 2XDBA 1PC0A 5KYUA 3EFOA 4RTUA 2EUFA 1T0JA 1JBMA 4M75D 1I5OB 1RABB 3HP9A 5A0GA 2RB6A 1HD3A 5LJ3d 6AT1B 2L89A 5D6WA 3JCMV 4M77G 1I81A 1K9AA 4JRPA 3G71Q 1VQNQ 4FM4B 1A0NB 1SHGA 3PFSA 1K73R 1ABQA 2EQMA 2JUFA 3AT1B 2LNHB 1PD0A 2GF7A 3SEMA 5GAOq 3Q1JA 4RTWA 4R56A 3CCVA 3DJBA 1ZUUA 1KHCA 3L2WA 5I5ZB 3CC7Q 4QQ6A 3TEEA 4F7UG 3MP6A 4F6WB 1OX8A 2RHIA 2JVVA 3X28B 4OB3B 2QK0A 3M54A 4A4FA 4JPBW 2MIOA 1NJIR 2KMGA 1TXQA 1QCNA 3BW1A 2IW6B 1TSFA 3EFSA 4ZGEB 4I3ZB 2R5AA 1S72Q 3EGUA 2CYZB 1ACMB 2FVUA 3JCMh 4EOQB 1MMGA 1KD1C 3JSCA 1IGUA 4O6JA 4A63B 2KEAA 1UB4A 3M03A 2ZZDB 2DJZA 3QXEB 2QEXA 1H25B 4C92G 2RM4A 2AHJB 5KYYB 2R5MA 2RQUA 4CC7A 2E4HA 2VVKA 2CT4A 3VS5A 3CMAQ 1I5LA 3A8OB 3QHRB 2QQAA 4PFZA 1AISB 2K3XA 2X1NB 4RMOA 2MWOA 2G3RA 2HCKA 2BE9B 1PSFA 5CKHA 5LJ5e 2ZPIB 3BDLA 1VOMA 2VXFA 5FRNA 3M0SA 4HT9A 2HL3A 1B34A 1VYTA 3CC4T 2LCLA 2F5TX 3RR6A 1UGVA 2QDLA 3ULRB 1U06A 2M9UA 2YLBA 4PJOE 1IGQA 2RA2A 1OI9B 1GBQA 3G71A 3EFOB 2W10A 8AT1B 3JB9G 3GOXA 3EG2A 3TNWB 4CFNB 2FEIA 4BCQD 1FYNA 2LZ6B 4KT0E 3NGPA 2RH2A 3CXCP 2Z0WA 1GBRA 2DRKA 2I2LA 4IUPA 1W2BS 1Q7YC 3CC7T 3G6EA 3O8VA 5LL6S 1VQ9Q 4ZGDB 1TU0B 1JEGA 2G6FX 4IIMA 4ELJA 4IUTA 2RQWA 1AHJB 1D1BA 4C92C 4C0FA 4PJJA 3OYGA 2L5QA 4CXAB 1ZA1B 4N0AC 2KNBB 3DB4A 4JRKA 1GCPA 5M9OA 2CH4W 3FRNA 4FT4A 5EC7A 1YJNA 2CJMB 2LTOA 1QWEA 3G4SQ 1VQMQ 2VKNA 4JJCA 7AT1B 2ZPEB 1U1TA 4GLMA 4JX5A 2K2VA 1PSEA 3EAEA 5DLQE 1RAIB 1BYMA 2DD4A 1YIJA 1X6GA 4OGCA 1GCQA 1PRLC 4C92A 2QA4Q 4F17A 3JCMP 5GAN4 1YJ9T 5GANd 4IURA 2QFZA 2W9ZA 1X43A 2QEXQ 2RQRA 3P8DA 1MUZA 1WXBA 2WEVB 2C0TA 4J6XA 4NS5A 4XU1A 2PTKA 4JJNK 3LLRA 2UZLB 1VQOA 1Y07A 2D8HA 4BXXX 1TOVA 5FU7C 2JOYA 2CZ7B 3OYDA 4PJOC 3GBQA 2YRDA 3H41A 1KQ1A 4D6WA 4RG8A 5GMKm 4RTZA 3L2VA 3MKDA 1W6XA 4D8DA 2JTFA 4DEYA 4BI4A 2WMAB 4LNPA 2H3JA 4HLQA 4Z6YA 1B07A 3ZEHA 1WXTA 2JN0A 2QQRA 1C0MA 1EX4A 1AWXA 1BK2A 3M4GA 2GFUA 3TW7A 1H641 5GANj 5CAIA 4KGZB 1BI3A 1M1FA 1ZP2A 5GJWB 2JS0A 4OR5B 4N4IA 3RUXA 2QEXT 1GCQC 4EIKA 2HDAA 1D3BA 3CMEQ 1YITQ 2A7YA 4JLGA 4EMKB 3I55T 2GCXA 4A4HA 2C5OB 1Q81C 3V8JA 4A4KA 5LJ5d 5LMKB 2MWPA 2MI6A 4ROCA 5GMKh 1T3SA 4EC8B 2J6FA 3CCST 1CKAA 1RAHB 3BLRB 3QJYA 3TNHB 2DK3A 2XDDA 3QSUA 2DZCA 4M77C 5L2WB 1U1SA 1Z9QA 3QIIA 2GNCA 1YCYA 2EBPA 2ROLA 3EG9A 4OMNA 2A36A 2D8JA 3X26B 1Y96A 1G3NC 2O9SA 2KVQG 1RUWA 1VQKA 1WHLA 3H9NA 3H0HA 3HL8A 2VB6A 3FEOA 5ICPB 2DXBA 3VU3C 1PM3A 1YFNA 2JW4A 2K5IA 1MNDA 1ZHIA 1H1RB 4PFPA 3UATA 1YJWQ 2EKHA 1VQ4Q 1KSWA 2CKKA 4MFDA 1WJSA 4HVVA 3G7ZA 1FXXA 3FLGA 1WYXA 4LDVA 3PIOA 1HSQA 3HRUA 1OYXA 4AKIA 2WFYB 1UNLD 5LJ5h 2DPPB 1VQ5A 1W70A 3ME9A 2HZYA 3OS2A 2EYXA 3LW5E 3PVLA 2F2WA 3I5SA 1SSHA 4YC3B 5L23A 4HL4A 1WXUA 3I9QA 4FW1A 2HSPA 3TCJA 4G6LB 3M0UA 4ZN3A 1AD5A 5CO7A 2PVDB 2RJCA 3M0TA 4LE9A 1OKWB 3VS3A 2M1HA 3URGA 1M1KC 1KIKA 4EONB 4FSSA 4BCNB 1BIBA 4OGRB 4PJOF 1QW1A 2OAWA 3JCMc 1EIFA 1MHNA 1ARKA 2IW9B 3JCMJ 2KXCA 4K11A 3OYMA 2DIGA 5CKBA 1XOVA 2B9RA 3LH5A 3CXCS 1DJ7B 4CFWB 1N8RU 4PJMA 2DBMA 3E9GA 5GAMj 2XMFA 4LN2A 1BBZA 1M9SA 2IVXA 4FIBA 2KYMA 2C5XB 3RKXA 2NUTB 2WIHB 5FWCA 3QYHB 2D0NA 4MZTA 2HKQB 3VKGA 1C1AA 4E7SA 3CD6A 1QQJA 1Q82C 2X4JA 2AZVA 2AT1B 4PJLA 3BDUA 2F2VA 2PU9B 4KGXB 4ANJA 4EMKC 4HVWA 1N27A 2LJ1A 2KRMA 2L2PA 1O9SA 1QVPA 3OMCA 2AKLA 4NL2A 4C0DB 3DTOA 2FL7A 5FW9A 2ED0A 1VQPA 2UZBB 1OIYB 1JO8A 3J80E 1BI1A 1R0BG 3MP1A 2X4WA 4RTXA 4A4EA 3UWNA 2HEQA 3EH2A 3HPWA 3WXMB 3UA6A 5CCAA 1H92A 4OVAA 1O9KB 2G9XB 5GANf 3JB9F 1WIEA 5C6SA 3VS2A 4M6VA 2YWWA 1G3WA 4EOOB 3VYGB 2PK2A 4XTXA 4IUUA 1VQ7T 4L5GA 4LUDA 1YHQQ 3OS0A 3B57A 3M56A 3G6EQ 1M4ZA 2W0ZA 3LYIA 2XKOC 1AZGB 5EJCA 1QMCA 3VS1A 5I21A 2YUOA 4P5NA 2LNVA 1NPRA 2FHDA 2P4TA 1SSFA 4C92B 4ZTJA 1UE9A 3ASKA 3ER0A 2WIPB 3EG9B 5GANe 4C0GA 2WHBB 2QI2A 4EOPB 1YIJT 3G4SA 5KYNA 1VQMA 2WSCE 4IMYB 1X01A 3PO3S 1TD6A 2J05A 5DY9A 2DXCA 2KQWA 1JJ2A 1ZUYA 4IKFA 2FG0A 3M58A 1YJNT 3DLLA 3GTMS 2NWMA 1IHWA 2NUTA 1JSUB 1O9KA 5HNBB 3INZA 5EFQB 2DMEA 3QKJA 3RERA 2EVRA 4C8QB 3VS0A 1FMWA 4WTOB 1SEMA 3OYKA 4M7AC 2QQ8A 1M90C 4PK4A 2I0NA 5CIUA 1E6GA 5CQYA 5LJ3h 3O5ZA 2EJFA 4XQ3A 1I07A 3G71T 3CCVT 1K73C 5LQFB 3CD6T 1Q7YR 1Q86R 3PMTA 4KH0B 3JCMd 1KQSP 2BPMB 3MPUB 2C5NB 5HCKA 3L1AA 4AFSC 2EJGA 1N8RC 2EWNA 2CZ0B 1Z9ZA 1N5ZA 3SB2A 1T3LA 3CCMQ 1GH6B 3HRTA 2DIQA 5GJVB 4B9WA 1V76A 1AWWA 2QGSA 1WQ7A 4O5VA 2VASA 1PRMC 4F16A 1I4K1 2YUPA 1BI0A 4DBFA 2BKDN 1QKXA 1RAEB 3CCSQ 4BACA 4IIOA 2CZ1B 3G6ET 4CC4B 4JZ4A 1RADB 4E7IA 3NTKA 5CYIB 3CCMA 1OU8A 1WHJA 2JZ2A 4DBQA 4II1A 4LDXA 2L3QA 4EOSB 3JB9D 4BCOB 2V8KA 2EYQA 3OBWA 3BLQB 3V7RA 4C5EA 1QCFA 5LJ5g 1NG2A 3QDFA 4JLIA 3GIBA 1M8VA 5GAOr 4M7DF 2NUZA 1PCXA 3CC4A 1LNXA 2WSEE 5KE2A 2SRCA 4Y91A 1NE8A 5IF1B 4JRQA 2BZXA 1NZ9A 1KFZA 4ZNXA 5GAMe 1UGQB 2LQWA 4KRDB 4MFEA 1BIAA 3NFCA 1Y57A 3UF4A 2GTJA 3QBYA 1K0XA 1I0CA 1UFFA 3WVEB 4C92F 1EFNA 3MEVA 4M75C 3CC2Q 1SRMA 2HD0A 2ESWA 2NUPA 1VQKT 3K7AM 4YTLA 2J6OA 5IHNA 2CREA 2FZGB 1ZSZA 2V22B 2P84A 2QQSA 2OTLT 3BLHB 2DD4B 2DVEA 4CRLB 4HNTA 3CCUA 1VQ8Q 3OS5A 2LT1A 4Y28E 2IPOB 3NTIA 1AOJA 1NYFA 4ESRA 1QP3A 4HXJA 1G3YA 1UGSB 5CKEA 3CEYA 3V8LA 5FGKB 1Q81U 1M2VA 1OULA 1VIEA 3QHSA 2QA4A 1JSTB 3LX7A 3L42A 2A08A 3OYHA 4LDWA 2K5LA 1WFWA 2RJDA 1FVVB 2RD1A 5I11A 3M0QA 1UHFA 4TVRA 3OYFA 3M57A 2BTTA 4M75B 4CI0C 1VQPT 4EOIB 2I53A 1YWPA 4BCGB 4E7HA 1YI2A 1S72T 2DL3A 4BCMB 1F5QB 4E7ZA 2MCNA 5HKCA 2SEMA 2OTLQ 1OPLA 2COWA 2FPDA 3META 1OL2B 4BUGA 3A8MB 1X6BA 3VKHA 3UA7A 1E9HB 1B34B 1JRIA 2RI3A 2ROTA 3V7CA 4KRCB 4XU3A 2E6ZA 1R77A 1XJWB 4M7DC 1I8FA 4RODA 5IXFA 4JUVA 1KK7A 1K73U 4CFXB 3LQ5B 2OI3A 4A54A 4NC6A 1NM7A 3SHWA 2YHTA 3GF5A 2M02A 4C5HA 2LJ3A 1OIUB 2WSFE 1K8AC 4J8OA 2E3HA 3KXTA 3EGDA 2DILA 2EYWA 1QCOA 3V8KA 2CSIA 4M75E 3JCMe 2DRMA 2XG8D 1YITT 2J06A 3TN8B 3DKMA 5EG2A 1YJWA 4VUBA 3S3NA 3CCRA 1QWFA 2VC8A 1YP5A 1X69A 1TH7A 1KQSS 4OMLA 5KYXB 1BI2A 1VOLA 3SWNC 5HBEB 4LD9K 2DL8A 2C6TB 1ZX6A 3L2UA 2CGHA 5KYWA 3REBB 3S6WA 3LWIA 1OZ3A 2HL5C 4J7IA 3VYHB 3ZFJA 1RI9A 2XDPA 3I5RA 2O4XB 4EOJB 1VINA 2EGEA 4QQGA 2E41A 4KUIA 1K8AR 2QTXA 2DZ9A 1QVGP 3JB9J 4QSHA 1MMAA 1Y96B 4CC3A 4PJOD 3EHRA 1OOTA 4M7AF 4LXCA 4C0DC 3QZ5B 1JQQA 4RG2A 1H28B 3OYCA 2OTJQ 5GAMh 2JJ9A 3JCMQ 3I56A 4QVZA 3MHXA 4BE1A 2VUBA 4BB7A 4OP0A 1ZQ1A 3CCJQ 4IUQA 3VJPA 2DYBA 1M27C 4CFMB 1MNEA 1WLPB 3UDCA 2L3PA 4ELZC 3CCUT 5IHIA 3RNJA 2OTLA 2PUKB 1PKTA 2CP7A 3CCET 2LT4A 2E65A 1RAFB 2AK5A 5HK3A 3BHVB 3TSWA 2IG0A 1E6HA 2KAFA 5IHYA 2X9HA 5ACBA 2YT6A 4J5YA 2E12A 2V8JA 2KE9A 3QUIA 1W4SA 2PZ1A 3R6NA 3RKYA 2KT1A 2BS2A 2WXVB 2J7IA 3VKIA 1QLBA 3JCMX 1UJYA 3QO3A 3RMSA 2KI7A 2KR6A 3VS4A 5FROA 1VYVA 2F5KA 2FZCB 1H4LD 1VQ6T 3A8HB 5GMKl 2ZPGB 4BE0A 3NHNA 2CP3A 5KE3A 3S3OA 4XTYA 3GPLA 1PG5B 1IREB 4AKHA 4PKCC 1C6VX 4DBRA 4D8KA 2QGFB 3H0IA 4AFZC 4M78G 5KYWB 3DDPB 2ZZDA 2LX9A 1JXMA 5CVIA 2CP0A 5J3BA 2YXYA 1SF9A 2LDMA 4CFUB 1D1AA 5KYYA 1K0SA 4OF1A 3M0PA 5ECAA 4LOCA 3CC4Q 4HT8A 1H3HA 1ZBXA 2Y4YA 1QVGS 1U8RA 2XK0A 4FYYB 2COZA 4QKUA 1H8KA 2AIRB 5KH6A 3C94A 2CUDA 1UEBA 3VUZA 2X3WD 4B6MA 1FINB 4BI3A 1LVKA 3EGXB 2K3YA 2PVOB 1N8RR 4ZN1A 1G8XA 2BKZB 1K1ZA 1KJWA 2FPFA 1F1BB 3EFRA 2JGZB 4ORZA 2UZDB 4OB0B 1KC8R 2IW8B 1B7TA 1VQ6Q 1D0ZA 1GY3B 1GUXB 2K7AA 3CBMA 2I40B 3JCMb 3PIPA 4OMMA 4OMPA 2D6FA 3N5BB 4JS5A 1KXUA 4L6V5 4OMOA 4M7DB 2KT8A 1YITA 3MI9B 2FRYA 3C95A 2YUNA 1JJ2P 4LUEA 3QYGB 1SKUB 2D1XA 2OAUA 1WJQA 1X75C 3OYNA 2O2OA 1WI7A 5BNJB 1VIFA 2X3XD 2GGRA 4RCBA 3CC7A 2C5VB 2PUOB 1UNHD 1KQSA 4XU2A 2LCCA 2HKNA 1K9MR 1BB9A 1VQPQ 4BCND 2FZKB 3FB9A 2NUPB 2KRSA 2DL7A 1YCSB 3E1SA 2A37A 2VGMA 1VQ5Q 1YJ9Q 2JM9A 1PHTA 2DL4A 3BY7A 2DA9A 1KD1R 5J39A 1M3BA 4M78A 2V26A 3CCLT 4BCPB 3RESA 3UT1A 2ZPFB 1Y71A 4QQDA 1P92A 3BHTB 3BG9A 1X2KA 1QVFA 3JCMf 4QVDA 2O01E 2BE7D 1UG1A 5I22A 4M7DA 3A5ZB 1YI2T 4M7DE 1M3AA 2E3IA 2L3SA 1D1CA 4BD3A 4HCZA 3VS6A 4FSXA 2E70A 3JB9H 1O75A 4E7JA 2WMBB 3L2ZA 5I2SA 1MV3A 4HKEA 4CC2A 3OMGA 3RIRA 3J81E 1AWOA 4JDSA 3OYLA 3CC2T 2CCHB 2QDYB 1AWJA 4JRIA 1KD1U 4DA4A 2DD5A 3HBLA 1WGSA 3MEAA 4FT2A 3QYEA 1D3UB 2K57A 4AKGA 1UTIA 2WPAB 1E7PA 1D0XA 5GANg 2W9FA 1GFDA 3HB9A 1FMVA 1YN8A 5GAN6 3PT9A 4DEXA 1M2VB 4FL6A 3I56Q 1LOJA 4Z89A 5HQ0B 1IRXA 2IIMA 4MDXA 2W96A 3PMIA 3OYJA 1OEBA 3CCJA 4PLIA 5DM7R 1Q86U 3I55A 3HSBA 3RDVA 3MO8A 2DFUA 2CCIB 1MMNA 2GFAA 4HA8A 1ENWA 5DQVA 2M0OA 1WDXA 2C0OA 2DXTA 3CBOA 1NYGA 5CEIB 1ABOA 4AI6A 4E7KA 2R58A 4Z02A 2KK4A 1YIJQ 3L2RA 1VYWB 2VYTA 2H8HA 3UPUA 5FU7B 3TSZA 3QDRB 3I55Q 3J7AF 1PKDB 4QT7A 1QKWA 2H3EB 4LDUA 5GAOm 2AKKA 1VYUA 3GP8A 1UGRB 2HSEB 1KQ2A 1IHVA 3OW2A 1JB0E 1OL1B 3P8BB 2JS2A 4F7SB 5GMKj 1YWOA 1RLQC 3H6ZA 4EOKB 1CKBA 1HJDA 3HO8A 3DLMA 2K3BA 1YNZA 5IDNB 2LC4A 3G4ST 1VQMT 2VXEA 4M7AB 1VQLA 1TS9A 4YOOA 4C8QC 2LW4A 1QMZB 4MMLA 2DD5B 3VS7A 2RI5A 5A0LA 3JCMW 2EQIA 4ELLA 1Q82U 2KROA 1WQWA 3MY1B 2DE0X 4RCCA 4RTTA 1GL5A 1H1PB 2DBKA 1ZSZC 1H1SB 2Y4XA 5LJ3f 1H3ZA 4F70B 2C0IA 1QVFP 3CPWP 1NJIU 2DL5A 2QF7A 4Y72B 1UECA 2R57A 4BCKB 1D0YA 1NBEB 3IQLA 3M59A 4PJOB 3QZ9B 2EQUA 3CMEA 2BUDA 1PNJA 4M4ZA 2EQJA 5AT1B 3GNGA 3LH0A 5GMKe 3CCMT 1LJOA 5CR2A 1M2OA 3DOGB 2R7GA 4PLLA 4F6SB 5KCHA 4KUDK 1WHGA 4FU6A 5GAN5 5GAN2 5LJ3e 4X1VA 5DQWA 3EOCB 4ELYC 1JJ2S 2XU8A 4M7AE 4AG2C 2QXFA 3C0CA 3PGGA 4LD6A 4V2SA 3M5AA 2X51A 4PFOA 1X27A 2E6NA 3THKA 2COYA 3TREA 3M55A 4AFQC 2EIFA 2DO3A 5GANh 2DNUA 1Q81R 1Q82R 2CUBA 4MIMA 1LPLA 4J9HA 1AZEA 3LGLA 3PTAA 3BFMA 2XI9A 4J9BA 4EMHA 4MZMA 1JOWA 2D9TA 3FC3A 4F7LB 3EJ1B 4XAXB 3NPFA 4C92E 2VWFA 2GTOA 2KXDA 4GY5A 1G3TA 1KG1A 4E47A 4M78E 5D6YA 2PK9B 2DMOA 2CS7A 2ZGWA 2K5FA 3KUFA 1HYOA 2CT3A 2EGAA 1SG5A 3C4SA 2G77A 1SRLA 2IN3A 3OBYA 4RKUE 4YOSA 4M77A 5GMKi 1P5EB 3C12A 5HK0A 2DEQA 4M75F 3REAB 4J9CA 3PNWC 3GLXA 4C8QE 3CPWS 5C0MA 4OB1B 1WZOA 1PKSA 4F14A 2KDSA 2A3LA 4M75A 1ZSZB 3RGFB 4ZTFA 4BI8B 4N0AA 2RPNA 3MJXA 4HCCA 2ATCB 4F7UA 3OYIA 1TTHB 4C5GA 3SWNB 5FRMA 2W99A 5HBHB 2BS3A 1OKVB 1TG0A 9ATCB 2JMCA 2HQHA 4XU0A 1Y0MA 1R0CB 5GAN7 3JV3A 4M78B 3OSVA 4BBRM 1YHQT 4AG1C 5FLXE 3KHIA 3CCRQ 5IT9E 3QPHA 1RAGB 4MMKA 4M77D 1NEBA 1W98B 1TUGB 4TTHA 3A98A 3CCEA 2JTMA 4A53A 3OW2S 4M75G 1BCOA 2LVMA 3PVQA 1BU2A 4GLKA 3F70A 1ZUKA 3CD6Q 1GFCA 1VQ4T 1NLOC 1FKMA 3CMAA 3DB3A 3I56T 3DDQB 4E7LA 2UUEB 4X9CA 3CCEQ 3CCSA 1OX9A 4M78D 1WHHA 4MZPA 2NYSA 1SHFA 1RAAB 1OU9A 3HFNA 4BY6C 3O0GD 2XHCA 4JX4A 2JXBA 2RJEA 5FU6C 4ATOA 5GAN8 2KBTA 3EG0A 2DTHA 5GAMg 3CBPA 1R8OB 2V1RA 1K9MC 4F7NB 2QASA 1Y7XA 3X24B 4X9DA 5KYXA 4ME7A 4AT1B 2Y90A 4AFUC 1VQNA 3MEWA 1GXIE 4JS4A 5DLOA 3ZBDA 2CZ6B 3OYYA 1ZA2B 3U23A 2RN8A 2GBQA 4JJDA 2F2CA 1BKBA 1U3OA 2QDJA 4N4HA 5FWBA 2VV5A 1W1FA 4EDUA 5IH2A 4CFVB 4UN0A 1AVZC 1YBYA 3S3MA 2CP2A 3AHUA 3CC2A 4F7JB 3H8ZA 3CCRT 1TUDA 2E10A 3A8LB 2KR3A 2KY9A 2OTJT 2YDLA 2PHGA 2YLCA 3SD4A 2X4XA 2RF0A 2RQTA 4HNUA 3ZL7C 1JXOA 4M7DG 3QYBA 4PJOA 1XO2A 1VQOT 3RKWA 4JJBA 4BY1X 4XTZA 2K6DA 5AYFA 2DXCB 3BHUB 3CCUQ 4J7FA 5FU6B 1H27B 2HBPA 2RI2A 1VQ4A 2P0KA 2HMAA 4FYVB 1NJIC 5I2MA 4CFUD 1M90R 4M7AG 3NTHA 3TNIB 2F2XA 3CPWA 4J9DA 1S1NA 3OYBA 2FRWA 4OGEA 1KC8C 3VUBA 4J9FA 2RO0A 2YSQA 2BZYA 4EOLB 2QG9B 4FX3B 4NSTB 3EGXA 1Q86C 1M30A 4J83A 1VQ8T 3OQ5A 1IXDA 4C8QF 2DTOA 1YHQA 3H0FA 3G33B 4KBMB 2EGCA 4EPCA 2DEUA 1OGUB 2LRQA 3TW6A 1W2BA 2MYSA 3EH1A 1UGPB 4BDYA 3TQ7P 2KGTA 2ENMA 4BCMD 3BG5A 4WF2A 1Q95G 3SWNA 5GAN3 4GBQA 2V8IA 1RACB 3EHQA 1FX7A 4M78F 1M8MA 2O9VA 4XTWA 4EMKA 1JKWA 1WJRA 1WA7A 1VQ9A 2DXBB 1B3QA 3MP8A 2OJ2A 5LJ3j 3A1PA 2IVWA 1N9SA 2DETA 1KHIA 3RMQA 2RHXA 2RK1A 1FWZA 4BY6B 1YJNQ 2L3RA 4C8QG 4J6WA 4CRIA 5LJ5f 2UZEB 1VQLQ 3FJPA 2PNIA 1LCKA 3M0RA 3EGDB 2MAMA 4PL6A 1J3TA 2DX1A 1PD1A 4EORB 2ED1A 2RHYA 3JAME 1OV3A 4J9IA 1H1QB 4II5B 2C4GB 2ZCFB 1GRIA 2EYZA 1D09B 2PMIB 4BCFB 2FPEA 4C92D 5IHKA 2X35A 2KYBA 3QWXX 3CCQT 1QVGA 1K8AU 1G2BA 5GAMd 1IB8A 1X6OA 1XNIA 1QLYA 4OMFB 3OS1A 1WPYA 1HXDA 5L8RE 3X25B 4BCIB 4HCBA 3OYEA 2PQWA 4R55A 3FIFA 5A0DA 2KSSA 3MIAB 1D3BB 3CCVQ 2RMOA 3QWYA 4R0KA 4AMCA 2EKOA 3A8GB 1UNGD 2EQKA 3M9QA 2CH4A 1UDLA 2CSQA 2DVJA 1NEGA 2P4RA 2CDTA 2OX7A 4F04B 3OW2P 2E5QA 2BS4A 1XTDA 2P0PA 4A4GA 2O4XA 2E1HA 1TUCA 2LQKA 4BY7X 4J9GA 1VQNT 2O31A 2EW3A 2XIDA 1URCB 5HBJB 3BE3A 2WJ9A 1ZBJA 4L59A 1YJ9A 3LWHA 1RL2A 3X20B 1VA7A 4F6UB 2DLPA 1TWBA 2NLUA 2QQ9A 4DOWA 3EIDB 2MF2A 4F7UB 2YUQA 3MEUA 2V1QA 3TU4K 2JM8A 5IXBA 3OY9A 4OB2B 2QA4T 4PNOA 3MY5B 1FMKA 2AZSA 2RJFA 2VGNA 5IDPB 1HK9A 4EMGA 4Z88A 1BCMA 2RQVA 5IAYA 1MMDA 2B8AA 1H24B 3WVDB 2M16A 1VQ6A 1M1KU 3G1JA 3CMAT 1V1CA 2DAQA 2JT4A 2K4YA 1C9BA 2HQEA 4BCJB 2X4YA 4KH1B 3NDQA 3FJ5A 5CKDA 5GAOp 4NL3A 4PJNA 2KMTA 3FDRA 3JCMg 5CK9A 4M78C 5GAOn 2DERA 2K79A 3PE0A 4IUVA 1K76A 3HKSA 5D6XA 1K4US 3KFVA 1VQLT 2DXUA 3CCLQ 4FYWB 4E6RA 1QVFS 1QP2A 3R6OA 2ECZA 3CCQQ 1UUEA 2LQNA 2DKGA 2MMPA 2RK2A 5LJ3g 4Y92A 1OI1A 2XD0A 1G83A 2RNAA 1YJWT 4M77F 3HTRA 4BCHB 2JTEA 1VQKQ 1NLPC 2A28A 4F7UE 3OYAA 4WCIA 2JNGA 1G3SA 2L8DA 1OPKA 2J6KA 4C5IA 1GUXA 5D7UA 1IZ6A 2QAZA 4J6YA 3KBGA 3RBBB 1I1JA 4C8QD 1AD6A 1SPKA 2MPXC 4XTUA 3POMA 1UHCA 1KC8U 1OZ2A 1OQKA 4BBSM 1ZSGA 4FYXB 2PJQA 4FCYA 1K9MU 3T9NA 3QHWB 2XICA 4Z8AA 1E7OA 4KGVB 2ZAEA 4LDYA 1IO6A 2LX7A 2EYYA 4EC9B 3VRZA 1WHKA 3BG3A 1VQ9T 1CSKA 1U5SA 2LCSA 4QVCA 4ZGJB 4J9EA 2QQBA 2RHUA 4OMQA 3CCJT 3VYGA 2YRVA 1T0HA 2FO0A 2ABLA 4KRTA 3SFMA 3VV0A 4C0ZA 4BCQB 2HNIA 2HAXA 2BIVA 3LGFA 4MDWA 2GQVA 3CXCA 2O88A 4XK8E 2F1LA 5J26A 2LP5A 3E2UA 1RI0A 2RHZA 2CP6A 1VQOQ 1MGQA 4FW2A 5KCOA 3HZJA 3VRYA 2K2MA 3QJ6A 5CQXA 4KULA 5LJ5j 5GAMf 5IN1A 1PWTA 4N4GA 2ZPHB 2FB7A 3L2QA 4PJOG 1WNLA 3OSSC 4Q5WA 2YRCA 3QG1A 4ROEA 2W2HA 3CCQA 1AEYA 5CKFA 1V29B 1W2BP 2DYIA
chains in the Genus database with same CATH topology
3PNWC 3GLXA 4PJOD 4M7AA 1BIBA 4C8QE 3CPWS 5C0MA 4M77B 4OB1B 3JRZA 4M7AF 4PJOF 1M5Q1 3QZ5B 4C0DC 3M53A 1QW1A 3JCMc 4M7AD 1EIFA 1MHNA 2A3LA 2KDSA 4M75A 4RG2A 3OYCA 3JCMJ 5GAMh 4ZTFA 4BI8B 4N0AA 2F69A 3JCMQ 3HFOA 4QVZA 3OYMA 3MHXA 3I56A 2DIGA 4BE1A 2VUBA 5CKBA 4BB7A 4HCCA 4OP0A 4F7UA 1XOVA 3OYIA 1ZQ1A 3CXCS 4IUQA 1DJ7B 4XTVA 3VJPA 4C5GA 3SDZA 3HRSA 3SWNB 4NOYA 5FRMA 1N8RU 4M7DD 2BS3A 3UDCA 3E9GA 4ELZC 5GAMj 3CCUT 2OTJA 1S72A 1M9SA 4XU0A 2OTLA 4BE2A 3CMET 2PUKB 1G5VA 1N6AA 4FIBA 5GAN7 4M78B 3RKXA 1N9RA 3OSVA 3GNFB 3CCET 4BBRM 4QW2A 1YHQT 3CCLA 2LT4A 5FLXE 2E65A 3KHIA 3QYHB 5HK3A 2WACA 4MZTA 5IT9E 2IG0A 1XQHA 2LQ8A 3QPHA 2KAFA 4MMKA 4X34A 1VQ8A 4M77D 3QWLA 3OA6A 3VKGA 2EAYA 4B9XA 3CD6A 3CCEA 4J5YA 2JTMA 2E12A 1Q82C 2V8JA 4A53A 5GAOl 3QUIA 2X4JA 3OB9A 3P8HA 3OW2S 1W4SA 4M75G 3RKYA 2HQXA 4DQ2A 1VQ5T 3BDUA 2LVMA 2BS2A 2D0QB 3M4YA 4GLKA 3VKIA 1QLBA 3H4CA 2PU9B 3JCMX 4JX6A 3QO3A 3RMSA 4EMKC 3F70A 4F7UF 3E9FA 1N27A 2KR6A 1O9SA 1QVPA 3OMCA 4NL2A 5FROA 4C0DB 2F5KA 1VQ4T 4M77E 2FL7A 1VQ6T 1VQPA 1M90U 3A8HB 1FKMA 3HHTB 5GMKl 2ZPGB 3DB3A 2DTIA 1M1GA 1BI1A 3J80E 3I56T 3CMAA 3MP1A 2X4WA 4BE0A 2C06A 2E64A 3V7SA 4E7LA 2EJ9A 1NPPA 4X9CA 3CCSA 4A4EA 4C8QA 2P0QA 3UWNA 5KE3A 3S3OA 3HPWA 3WXMB 4UC4A 1VQ7A 1Q7YU 4XTYA 3GPLA 4M78D 5CCAA 4MZPA 1IREB 4AKHA 4PKCC 4OVAA 3E19A 4ZN3A 3HFNA 4BY6C 2XHCA 3MCAB 5GANf 3CPFA 3JB9F 4JX4A 4M78G 5C6SA 3DL1A 2LX9A 4M6VA 1G3WA 1VUBA 2EFIA 2RJEA 2ZZDA 3VYGB 4XTXA 5CVIA 2FYKA 4IUUA 5GAN8 3JB9I 5J3BA 1VQ7T 4ATOA 2LDMA 4L5GA 4OF1A 4LOCA 2DTHA 5GAMg 4BDZA 3CBPA 1R8OB 4HT8A 1K9MC 5HY6A 1ZBXA 2Y4YA 3OS0A 1QVGS 1Y7XA 3M56A 3X24B 2ZPBB 2XK0A 4X9DA 4ME7A 1U8RA 1M4ZA 2Y90A 3LYIA 5A2QE 2XKOC 1VQNA 4DOVA 5EJCA 3MEWA 2PVGB 5KH6A 5I21A 3C94A 1GXIE 4HNVA 1UEBA 3VUZA 4P5NA 4BI3A 2LNVA 2XDBA 1NPRA 2FHDA 2P4TA 1SSFA 4C92B 4JS4A 5DLOA 2K3YA 2PVOB 3ZBDA 1JBMA 2CZ6B 3OYYA 3ASKA 4ZTJA 3ER0A 4M75D 4ZN1A 5GANe 5A0GA 3HP9A 4C0GA 2RB6A 2QI2A 1YIJT 5LJ3d 3G4SA 1VQMA 2WSCE 1BKBA 2L89A 1X01A 5D6WA 4M77G 3JCMV 3EFRA 2QDJA 4OB0B 4N4HA 1I81A 4EDUA 2VV5A 4JRPA 4FM4B 3PFSA 1YBYA 5DY9A 3S3MA 3CBMA 2DXCA 2KQWA 3JCMb 3PIPA 1JJ2A 2EQMA 2JUFA 4IKFA 2D6FA 3AHUA 3N5BB 2GF7A 3M58A 3DLLA 4JS5A 1YJNT 5GAOq 3CC2A 3H8ZA 3Q1JA 4L6V5 4R56A 3CCRT 2E10A 3CCVA 3A8LB 1KHCA 2KY9A 3L2WA 4M7DB 2OTJT 1YITA 2YLCA 3SD4A 2X4XA 4QQ6A 3INZA 3C95A 4HNUA 3QKJA 3RERA 4M7DG 3TEEA 3QYBA 4F7UG 4PJOA 3MP6A 1VQOT 4C8QB 3QYGB 2OAUA 3RKWA 1WJQA 1X75C 2RHIA 3OYNA 2JVVA 4XTZA 3OYKA 1VIFA 5AYFA 2DXCB 1VQ4A 3X28B 4J7FA 2QQ8A 4OB3B 2HBPA 2RI2A 5CIUA 5FU6B 1M90C 4M7AC 4RCBA 5CQYA 3CC7A 2P0KA 3M54A 2PUOB 4A4FA 5I2MA 1NJIC 1KQSA 4M7AG 3NTHA 2LCCA 4XU2A 5LJ3h 2EJFA 3CPWA 4XQ3A 3OYBA 1KC8C 2KMGA 4OGEA 3VUBA 3EFSA 3BW1A 2RO0A 4ZGEB 2R5AA 3FB9A 3G71T 3CCVT 2CYZB 1K73C 2FVUA 3E1SA 3JCMh 3CD6T 2VGMA 1KD1C 3PMTA 3JSCA 3JCMd 3BY7A 1Q86C 3L1AA 4J83A 1VQ8T 4O6JA 2EJGA 5J39A 3OQ5A 4C8QF 1N8RC 1UB4A 2EWNA 2DTOA 2CZ0B 4M78A 3CCLT 1YHQA 3SB2A 3RESA 3UT1A 2ZPFB 2ZZDB 1Y71A 3QXEB 2DJZA 4KBMB 4EPCA 2QEXA 4QQDA 1P92A 2LRQA 4C92G 3TW6A 2RM4A 1W2BA 3HRTA 2AHJB 2DIQA 1UGPB 4B9WA 2R5MA 3BG9A 4BDYA 1QVFA 3JCMf 4QVDA 2O01E 1WQ7A 4O5VA 1I5LA 4M7DA 3A5ZB 3A8OB 2QQAA 1I4K1 1YI2T 5FU6C 2K3XA 4M7DE 1BI0A 4RMOA 2BKDN 2MWOA 3BG5A 2G3RA 4WF2A 3SWNA 5GAN3 4BACA 1PSFA 5CKHA 4BD3A 2ZPIB 3BDLA 4HCZA 5LJ5e 2V8IA 2VXFA 4FSXA 5FRNA 2CZ1B 1FX7A 2E70A 3G6ET 3JB9H 1O75A 4HT9A 4M78F 4E7JA 3NTKA 4XTWA 1B34A 4EMKA 1WJRA 3CC4T 3CCMA 4E7IA 3L2ZA 1VQ9A 2LCLA 2DXBB 2F5TX 2JZ2A 4II1A 3MP8A 5I2SA 4LDXA 3JB9D 5LJ3j 4HKEA 2M9UA 2IVWA 2YLBA 4PJOE 1N9SA 2EYQA 2RA2A 2V8KA 3OBWA 3OMGA 3V7RA 3RIRA 3J81E 4JDSA 3OYLA 3CC2T 4C5EA 2QDYB 4JRIA 5LJ5g 3G71A 1KD1U 4DA4A 2DD5A 3HBLA 1KHIA 4JLIA 3RMQA 1WGSA 3GOXA 2RHXA 3MEAA 2RK1A 3GIBA 5GAOr 4M7DF 1FWZA 4BY6B 4FT2A 1M8VA 4KT0E 2L3RA 3QYEA 4C8QG 2RH2A 4J6WA 3CC4A 1LNXA 2WSEE 5KE2A 4Y91A 1NE8A 2K57A 2I2LA 4CRIA 4IUPA 5LJ5f 4AKGA 1W2BS 3FJPA 1Q7YC 3CC7T 3G6EA 3O8VA 5LL6S 1E7PA 2MAMA 4ZGDB 4PL6A 4JRQA 5GANg 1NZ9A 4ELJA 5GAMe 4IUTA 2RHYA 3JAME 1AHJB 1UGQB 3HB9A 4C92C 4C0FA 3OYGA 2L5QA 5GAN6 2ZCFB 3PT9A 4MFEA 4N0AC 3DB4A 4JRKA 1BIAA 3NFCA 5M9OA 4FL6A 3QBYA 1LOJA 4C92D 2X35A 3FRNA 4FT4A 3CCQT 1QVGA 1YJNA 1K8AU 5GAMd 3WVEB 4C92F 4MDXA 2LTOA 1X6OA 3MEVA 3PMIA 3CCJA 3OYJA 1XNIA 4M75C 2ZPEB 1U1TA 4OMFB 4PLIA 5DM7R 3OS1A 1Q86U 2HD0A 1WPYA 4JX5A 1HXDA 2K2VA 3I55A 3HSBA 1PSEA 3EAEA 5DLQE 5L8RE 3X25B 3MO8A 1BYMA 4HCBA 2DD4A 1YIJA 3OYEA 2PQWA 4OGCA 2GFAA 4R55A 4HA8A 1VQKT 3FIFA 4YTLA 5A0DA 2KSSA 1D3BB 2M0OA 4C92A 2EKOA 3A8GB 2EQKA 2QQSA 2OTLT 3M9QA 3JCMP 2DXTA 5GAN4 2DD4B 3CBOA 2DVEA 4HNTA 1YJ9T 5GANd 4IURA 2QFZA 3CCUA 4AI6A 4E7KA 2R58A 3OS5A 3P8DA 2KK4A 4Z02A 3L2RA 2LT1A 2E5QA 2BS4A 2VYTA 4Y28E 1XTDA 2P0PA 3NTIA 4A4GA 2O4XA 3UPUA 4J6XA 2E1HA 4NS5A 1QP3A 3QDRB 4XU1A 5FU7B 2LQKA 4JJNK 3J7AF 1VQNT 1G3YA 3LLRA 2XIDA 1UGSB 5CKEA 1VQOA 1Y07A 4LDUA 5GAOm 3CEYA 2WJ9A 3V8LA 1Q81U 3GP8A 1UGRB 5FU7C 1VIEA 3QHSA 4L59A 1KQ2A 1YJ9A 3OW2A 2JOYA 2CZ7B 1JB0E 3OYDA 2QA4A 3LWHA 4PJOC 1RL2A 3X20B 3P8BB 1YJWA 2QQ9A 2NLUA 4DOWA 3LX7A 2MF2A 5GMKj 4F7UB 3TU4K 3MEUA 1KQ1A 3H6ZA 3L42A 4D6WA 3OY9A 4RG8A 4OB2B 5GMKm 3OYHA 3L2VA 4LDWA 2JTFA 3HO8A 2QA4T 4PNOA 2K5LA 3DLMA 2RJDA 4BI4A 2RJFA 2VGNA 2H3JA 1HK9A 4HLQA 4Z6YA 2LC4A 2RD1A 4EMGA 3G4ST 5IAYA 1VQMT 2VXEA 4M7AB 1VQLA 2B8AA 3WVDB 4TVRA 3OYFA 3ZEHA 2M16A 1VQ6A 1M1KU 2JN0A 2QQRA 3M57A 3CMAT 1VQPT 2DAQA 4M75B 4CI0C 2K4YA 4C8QC 5CKDA 2HQEA 2X4YA 5GAOp 4E7HA 4NL3A 1YI2A 1S72T 3M4GA 2KMTA 4MMLA 2DD5B 3TW7A 2GFUA 2RI5A 3FDRA 1H641 4M78C 3JCMg 5A0LA 5CAIA 5CK9A 5GAOn 5HKCA 3JCMW 5GANj 1BI3A 1M1FA 4IUVA 1Q82U 3META 4BUGA 1WQWA 3HKSA 5D6XA 4N4IA 4RCCA 3RUXA 3A8MB 2QEXT 1VQLT 2DXUA 3VKHA 2Y4XA 5LJ3f 1H3ZA 1D3BA 2A7YA 1B34B 4JLGA 4EMKB 1QP2A 3R6OA 1QVFS 3I55T 2GCXA 1JRIA 1NJIU 4A4HA 2QF7A 2RI3A 3V7CA 3V8JA 1Q81C 4XU3A 2E6ZA 4A4KA 2DKGA 4M7DC 2R57A 2MMPA 5LJ5d 1I8FA 2RK2A 2MWPA 5LJ3g 4JUVA 1OI1A 3M59A 2MI6A 2XD0A 1K73U 4PJOB 1YJWT 4M77F 5GMKh 3QZ9B 2EQUA 4A54A 3CMEA 4NC6A 2BUDA 3CCST 2EQJA 4F7UE 3OYAA 3GNGA 3LH0A 5GMKe 3CCMT 1LJOA 2YHTA 3GF5A 5CR2A 2JNGA 1G3SA 3QJYA 4PLLA 2DK3A 4C5HA 5KCHA 2XDDA 2DZCA 4KUDK 3QSUA 4M77C 2WSFE 4FU6A 5GAN5 2L8DA 1U1SA 5GAN2 4C5IA 5LJ3e 1K8AC 4J8OA 3QIIA 4ELYC 3KXTA 1IZ6A 1JJ2S 2XU8A 4J6YA 4M7AE 1YCYA 3KBGA 2QXFA 4V2SA 3PGGA 4LD6A 3X26B 3M5AA 4C8QD 1Y96A 4XTUA 3V8KA 3JCMe 4M75E 1KC8U 2E6NA 2XG8D 1OZ2A 3TREA 1YITT 3M55A 4BBSM 2EIFA 2DO3A 3DKMA 5EG2A 5GANh 2KVQG 1K9MU 4VUBA 3S3NA 1VQKA 3CCRA 3T9NA 3HL8A 3FEOA 2XICA 4MIMA 2DXBA 3VU3C 4LDYA 3LGLA 3PTAA 2VC8A 3BFMA 3JB9G 2K5IA 1ZHIA 3BG3A 1VQ9T 2XI9A 4QVCA 2CKKA 4EMHA 4ZGJB 4MFDA 4MZMA 1TH7A 2QQBA 2RHUA 3CCJT 1KQSS 2D9TA 3VYGA 1WJSA 2YRVA 3G7ZA 1BI2A 3VV0A 1FXXA 3SFMA 3FLGA 4C0ZA 3SWNC 3FC3A 4LD9K 4LDVA 4XAXB 3PIOA 4C92E 2HNIA 2HAXA 2BIVA 3HRUA 1OYXA 3LGFA 3L2UA 2CGHA 4GY5A 4AKIA 1G3TA 4MDWA 4E47A 1KG1A 5LJ5h 4M78E 2GQVA 2DPPB 5D6YA 3S6WA 3LWIA 3CXCA 1VQ5A 1OZ3A 3ME9A 4XK8E 3OS2A 2CS7A 4J7IA 3VYHB 5J26A 2ZGWA 3LW5E 3ZFJA 1RI0A 2K5FA 2XDPA 3KUFA 2RHZA 1MGQA 5KCOA 3HZJA 4HL4A 2O4XB 3QJ6A 4KULA 5CQXA 5GAMf 5LJ5j 5IN1A 4N4GA 2ZPHB 3C4SA 2FB7A 2G77A 3L2QA 4PJOG 4QQGA 3TCJA 3OBYA 1WNLA 4RKUE 2E41A 3OSSC 4KUIA 2QTXA 2DZ9A 4M77A 4Q5WA 3QG1A 5CO7A 3C12A 2PVDB 5GMKi 2RJCA 4QSHA 3JB9J 5HK0A 3CCQA 2DEQA 4M75F 2M1HA 5CKFA 1V29B 3URGA 1M1KC 1Y96B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OB1 B;  4KT0 E;  3QZ5 B;  3A8M B;  2WSE E;  2WSC E;  4OB0 B;  1QP2 A;  4ZGD B;  4FM4 B;  1DJ7 B;  2DXC A;  1UGQ B;  1AHJ B;  4L6V 5;  2ZCF B;  3A8L B;  3QZ9 B;  2PUK B;  3WVE B;  3QYG B;  2ZPE B;  3QYH B;  2WSF E;  1PSE A;  2DXC B;  5L8R E;  3X28 B;  3X25 B;  4OB3 B;  2DD4 A;  2PUO B;  3X26 B;  3A8G B;  4ZGE B;  2CYZ B;  2DD4 B;  2D0Q B;  2PU9 B;  2DXB A;  4Y28 E;  1QP3 A;  3A8H B;  3HHT B;  2ZPG B;  2CZ0 B;  4ZGJ B;  1UGS B;  3VYG A;  1UGR B;  2ZPF B;  2ZZD B;  3QXE B;  2CZ7 B;  1JB0 E;  2AHJ B;  1UGP B;  1IRE B;  3X20 B;  2O01 E;  3A8O B;  2DPP B;  4OB2 B;  4XK8 E;  2ZZD A;  3VYG B;  3VYH B;  1PSF A;  3LW5 E;  2ZPI B;  2CZ1 B;  3WVD B;  3X24 B;  2ZPB B;  2ZPH B;  2DXB B;  2PVG B;  4RKU E;  1GXI E;  2PVD B;  2DD5 B;  2QDY B;  2PVO B;  1V29 B;  2CZ6 B;  2DD5 A; 
#chains in the Genus database with same CATH topology
 1ZLM A;  4M7A A;  4M77 B;  3JRZ A;  1M5Q 1;  3M53 A;  4M7A D;  3EG3 A;  1M3C A;  2F69 A;  8ATC B;  3HFO A;  2DM1 A;  2L0A A;  1WX6 A;  2EPD A;  5HVY B;  4XTV A;  3SDZ A;  3EG1 A;  3HRS A;  4NOY A;  4M7D D;  2MOX A;  2LJ0 A;  2OTJ A;  1S72 A;  2KRN A;  3CME T;  4BE2 A;  1G5V A;  2QYZ A;  3F5X B;  1N6A A;  1H26 B;  2K9G A;  4HCK A;  1N9R A;  3GNF B;  4HVU A;  3CCL A;  4QW2 A;  4DBH A;  2E5K A;  3D7S B;  2WAC A;  2DF6 A;  1TFB A;  1WHM A;  2LQ8 A;  1XQH A;  3TVT A;  4X34 A;  1MV0 B;  3OA6 A;  3QWL A;  1VQ8 A;  4EOM B;  2EAY A;  2M51 A;  4B9X A;  4JZ3 A;  5GAO l;  3CQT A;  1EZZ B;  3OB9 A;  1VQ7 Q;  3P8H A;  5KYU B;  2GQI A;  2HQX A;  4DQ2 A;  1VQ5 T;  2QGG A;  3M4Y A;  2D0Q B;  3H4C A;  4JX6 A;  2JMA A;  1BU1 A;  4F7U F;  3E9F A;  3NMZ C;  1M1K R;  4M77 E;  1M90 U;  3HHT B;  2DTI A;  1M1G A;  4RTV A;  2C06 A;  2B86 A;  2E64 A;  3V7S A;  2EJ9 A;  1NPP A;  2BZ8 A;  4C8Q A;  2P0Q A;  2CP5 A;  1RLP C;  4UC4 A;  1VQ7 A;  2MK5 A;  1Q7Y U;  2QTV A;  4YOZ A;  3E19 A;  4RTY A;  2HBW A;  1UJ0 A;  3MCA B;  2LMJ A;  3CPF A;  2M0Y A;  3DL1 A;  1VUB A;  2EFI A;  4RUG A;  3JB9 I;  1YI2 Q;  2FYK A;  1JU5 C;  1AT1 B;  4BDZ A;  2DJQ A;  3I35 A;  4E2F B;  5HY6 A;  2ZPB B;  2A0F B;  5A2Q E;  4DOV A;  1N4M A;  2PVG B;  4HNV A;  1X2Q A;  2XDB A;  1PC0 A;  5KYU A;  3EFO A;  4RTU A;  2EUF A;  1T0J A;  1JBM A;  4M75 D;  1I5O B;  1RAB B;  3HP9 A;  5A0G A;  2RB6 A;  1HD3 A;  5LJ3 d;  6AT1 B;  2L89 A;  5D6W A;  3JCM V;  4M77 G;  1I81 A;  1K9A A;  4JRP A;  3G71 Q;  1VQN Q;  4FM4 B;  1A0N B;  1SHG A;  3PFS A;  1K73 R;  1ABQ A;  2EQM A;  2JUF A;  3AT1 B;  2LNH B;  1PD0 A;  2GF7 A;  3SEM A;  5GAO q;  3Q1J A;  4RTW A;  4R56 A;  3CCV A;  3DJB A;  1ZUU A;  1KHC A;  3L2W A;  5I5Z B;  3CC7 Q;  4QQ6 A;  3TEE A;  4F7U G;  3MP6 A;  4F6W B;  1OX8 A;  2RHI A;  2JVV A;  3X28 B;  4OB3 B;  2QK0 A;  3M54 A;  4A4F A;  4JPB W;  2MIO A;  1NJI R;  2KMG A;  1TXQ A;  1QCN A;  3BW1 A;  2IW6 B;  1TSF A;  3EFS A;  4ZGE B;  4I3Z B;  2R5A A;  1S72 Q;  3EGU A;  2CYZ B;  1ACM B;  2FVU A;  3JCM h;  4EOQ B;  1MMG A;  1KD1 C;  3JSC A;  1IGU A;  4O6J A;  4A63 B;  2KEA A;  1UB4 A;  3M03 A;  2ZZD B;  2DJZ A;  3QXE B;  2QEX A;  1H25 B;  4C92 G;  2RM4 A;  2AHJ B;  5KYY B;  2R5M A;  2RQU A;  4CC7 A;  2E4H A;  2VVK A;  2CT4 A;  3VS5 A;  3CMA Q;  1I5L A;  3A8O B;  3QHR B;  2QQA A;  4PFZ A;  1AIS B;  2K3X A;  2X1N B;  4RMO A;  2MWO A;  2G3R A;  2HCK A;  2BE9 B;  1PSF A;  5CKH A;  5LJ5 e;  2ZPI B;  3BDL A;  1VOM A;  2VXF A;  5FRN A;  3M0S A;  4HT9 A;  2HL3 A;  1B34 A;  1VYT A;  3CC4 T;  2LCL A;  2F5T X;  3RR6 A;  1UGV A;  2QDL A;  3ULR B;  1U06 A;  2M9U A;  2YLB A;  4PJO E;  1IGQ A;  2RA2 A;  1OI9 B;  1GBQ A;  3G71 A;  3EFO B;  2W10 A;  8AT1 B;  3JB9 G;  3GOX A;  3EG2 A;  3TNW B;  4CFN B;  2FEI A;  4BCQ D;  1FYN A;  2LZ6 B;  4KT0 E;  3NGP A;  2RH2 A;  3CXC P;  2Z0W A;  1GBR A;  2DRK A;  2I2L A;  4IUP A;  1W2B S;  1Q7Y C;  3CC7 T;  3G6E A;  3O8V A;  5LL6 S;  1VQ9 Q;  4ZGD B;  1TU0 B;  1JEG A;  2G6F X;  4IIM A;  4ELJ A;  4IUT A;  2RQW A;  1AHJ B;  1D1B A;  4C92 C;  4C0F A;  4PJJ A;  3OYG A;  2L5Q A;  4CXA B;  1ZA1 B;  4N0A C;  2KNB B;  3DB4 A;  4JRK A;  1GCP A;  5M9O A;  2CH4 W;  3FRN A;  4FT4 A;  5EC7 A;  1YJN A;  2CJM B;  2LTO A;  1QWE A;  3G4S Q;  1VQM Q;  2VKN A;  4JJC A;  7AT1 B;  2ZPE B;  1U1T A;  4GLM A;  4JX5 A;  2K2V A;  1PSE A;  3EAE A;  5DLQ E;  1RAI B;  1BYM A;  2DD4 A;  1YIJ A;  1X6G A;  4OGC A;  1GCQ A;  1PRL C;  4C92 A;  2QA4 Q;  4F17 A;  3JCM P;  5GAN 4;  1YJ9 T;  5GAN d;  4IUR A;  2QFZ A;  2W9Z A;  1X43 A;  2QEX Q;  2RQR A;  3P8D A;  1MUZ A;  1WXB A;  2WEV B;  2C0T A;  4J6X A;  4NS5 A;  4XU1 A;  2PTK A;  4JJN K;  3LLR A;  2UZL B;  1VQO A;  1Y07 A;  2D8H A;  4BXX X;  1TOV A;  5FU7 C;  2JOY A;  2CZ7 B;  3OYD A;  4PJO C;  3GBQ A;  2YRD A;  3H41 A;  1KQ1 A;  4D6W A;  4RG8 A;  5GMK m;  4RTZ A;  3L2V A;  3MKD A;  1W6X A;  4D8D A;  2JTF A;  4DEY A;  4BI4 A;  2WMA B;  4LNP A;  2H3J A;  4HLQ A;  4Z6Y A;  1B07 A;  3ZEH A;  1WXT A;  2JN0 A;  2QQR A;  1C0M A;  1EX4 A;  1AWX A;  1BK2 A;  3M4G A;  2GFU A;  3TW7 A;  1H64 1;  5GAN j;  5CAI A;  4KGZ B;  1BI3 A;  1M1F A;  1ZP2 A;  5GJW B;  2JS0 A;  4OR5 B;  4N4I A;  3RUX A;  2QEX T;  1GCQ C;  4EIK A;  2HDA A;  1D3B A;  3CME Q;  1YIT Q;  2A7Y A;  4JLG A;  4EMK B;  3I55 T;  2GCX A;  4A4H A;  2C5O B;  1Q81 C;  3V8J A;  4A4K A;  5LJ5 d;  5LMK B;  2MWP A;  2MI6 A;  4ROC A;  5GMK h;  1T3S A;  4EC8 B;  2J6F A;  3CCS T;  1CKA A;  1RAH B;  3BLR B;  3QJY A;  3TNH B;  2DK3 A;  2XDD A;  3QSU A;  2DZC A;  4M77 C;  5L2W B;  1U1S A;  1Z9Q A;  3QII A;  2GNC A;  1YCY A;  2EBP A;  2ROL A;  3EG9 A;  4OMN A;  2A36 A;  2D8J A;  3X26 B;  1Y96 A;  1G3N C;  2O9S A;  2KVQ G;  1RUW A;  1VQK A;  1WHL A;  3H9N A;  3H0H A;  3HL8 A;  2VB6 A;  3FEO A;  5ICP B;  2DXB A;  3VU3 C;  1PM3 A;  1YFN A;  2JW4 A;  2K5I A;  1MND A;  1ZHI A;  1H1R B;  4PFP A;  3UAT A;  1YJW Q;  2EKH A;  1VQ4 Q;  1KSW A;  2CKK A;  4MFD A;  1WJS A;  4HVV A;  3G7Z A;  1FXX A;  3FLG A;  1WYX A;  4LDV A;  3PIO A;  1HSQ A;  3HRU A;  1OYX A;  4AKI A;  2WFY B;  1UNL D;  5LJ5 h;  2DPP B;  1VQ5 A;  1W70 A;  3ME9 A;  2HZY A;  3OS2 A;  2EYX A;  3LW5 E;  3PVL A;  2F2W A;  3I5S A;  1SSH A;  4YC3 B;  5L23 A;  4HL4 A;  1WXU A;  3I9Q A;  4FW1 A;  2HSP A;  3TCJ A;  4G6L B;  3M0U A;  4ZN3 A;  1AD5 A;  5CO7 A;  2PVD B;  2RJC A;  3M0T A;  4LE9 A;  1OKW B;  3VS3 A;  2M1H A;  3URG A;  1M1K C;  1KIK A;  4EON B;  4FSS A;  4BCN B;  1BIB A;  4OGR B;  4PJO F;  1QW1 A;  2OAW A;  3JCM c;  1EIF A;  1MHN A;  1ARK A;  2IW9 B;  3JCM J;  2KXC A;  4K11 A;  3OYM A;  2DIG A;  5CKB A;  1XOV A;  2B9R A;  3LH5 A;  3CXC S;  1DJ7 B;  4CFW B;  1N8R U;  4PJM A;  2DBM A;  3E9G A;  5GAM j;  2XMF A;  4LN2 A;  1BBZ A;  1M9S A;  2IVX A;  4FIB A;  2KYM A;  2C5X B;  3RKX A;  2NUT B;  2WIH B;  5FWC A;  3QYH B;  2D0N A;  4MZT A;  2HKQ B;  3VKG A;  1C1A A;  4E7S A;  3CD6 A;  1QQJ A;  1Q82 C;  2X4J A;  2AZV A;  2AT1 B;  4PJL A;  3BDU A;  2F2V A;  2PU9 B;  4KGX B;  4ANJ A;  4EMK C;  4HVW A;  1N27 A;  2LJ1 A;  2KRM A;  2L2P A;  1O9S A;  1QVP A;  3OMC A;  2AKL A;  4NL2 A;  4C0D B;  3DTO A;  2FL7 A;  5FW9 A;  2ED0 A;  1VQP A;  2UZB B;  1OIY B;  1JO8 A;  3J80 E;  1BI1 A;  1R0B G;  3MP1 A;  2X4W A;  4RTX A;  4A4E A;  3UWN A;  2HEQ A;  3EH2 A;  3HPW A;  3WXM B;  3UA6 A;  5CCA A;  1H92 A;  4OVA A;  1O9K B;  2G9X B;  5GAN f;  3JB9 F;  1WIE A;  5C6S A;  3VS2 A;  4M6V A;  2YWW A;  1G3W A;  4EOO B;  3VYG B;  2PK2 A;  4XTX A;  4IUU A;  1VQ7 T;  4L5G A;  4LUD A;  1YHQ Q;  3OS0 A;  3B57 A;  3M56 A;  3G6E Q;  1M4Z A;  2W0Z A;  3LYI A;  2XKO C;  1AZG B;  5EJC A;  1QMC A;  3VS1 A;  5I21 A;  2YUO A;  4P5N A;  2LNV A;  1NPR A;  2FHD A;  2P4T A;  1SSF A;  4C92 B;  4ZTJ A;  1UE9 A;  3ASK A;  3ER0 A;  2WIP B;  3EG9 B;  5GAN e;  4C0G A;  2WHB B;  2QI2 A;  4EOP B;  1YIJ T;  3G4S A;  5KYN A;  1VQM A;  2WSC E;  4IMY B;  1X01 A;  3PO3 S;  1TD6 A;  2J05 A;  5DY9 A;  2DXC A;  2KQW A;  1JJ2 A;  1ZUY A;  4IKF A;  2FG0 A;  3M58 A;  1YJN T;  3DLL A;  3GTM S;  2NWM A;  1IHW A;  2NUT A;  1JSU B;  1O9K A;  5HNB B;  3INZ A;  5EFQ B;  2DME A;  3QKJ A;  3RER A;  2EVR A;  4C8Q B;  3VS0 A;  1FMW A;  4WTO B;  1SEM A;  3OYK A;  4M7A C;  2QQ8 A;  1M90 C;  4PK4 A;  2I0N A;  5CIU A;  1E6G A;  5CQY A;  5LJ3 h;  3O5Z A;  2EJF A;  4XQ3 A;  1I07 A;  3G71 T;  3CCV T;  1K73 C;  5LQF B;  3CD6 T;  1Q7Y R;  1Q86 R;  3PMT A;  4KH0 B;  3JCM d;  1KQS P;  2BPM B;  3MPU B;  2C5N B;  5HCK A;  3L1A A;  4AFS C;  2EJG A;  1N8R C;  2EWN A;  2CZ0 B;  1Z9Z A;  1N5Z A;  3SB2 A;  1T3L A;  3CCM Q;  1GH6 B;  3HRT A;  2DIQ A;  5GJV B;  4B9W A;  1V76 A;  1AWW A;  2QGS A;  1WQ7 A;  4O5V A;  2VAS A;  1PRM C;  4F16 A;  1I4K 1;  2YUP A;  1BI0 A;  4DBF A;  2BKD N;  1QKX A;  1RAE B;  3CCS Q;  4BAC A;  4IIO A;  2CZ1 B;  3G6E T;  4CC4 B;  4JZ4 A;  1RAD B;  4E7I A;  3NTK A;  5CYI B;  3CCM A;  1OU8 A;  1WHJ A;  2JZ2 A;  4DBQ A;  4II1 A;  4LDX A;  2L3Q A;  4EOS B;  3JB9 D;  4BCO B;  2V8K A;  2EYQ A;  3OBW A;  3BLQ B;  3V7R A;  4C5E A;  1QCF A;  5LJ5 g;  1NG2 A;  3QDF A;  4JLI A;  3GIB A;  1M8V A;  5GAO r;  4M7D F;  2NUZ A;  1PCX A;  3CC4 A;  1LNX A;  2WSE E;  5KE2 A;  2SRC A;  4Y91 A;  1NE8 A;  5IF1 B;  4JRQ A;  2BZX A;  1NZ9 A;  1KFZ A;  4ZNX A;  5GAM e;  1UGQ B;  2LQW A;  4KRD B;  4MFE A;  1BIA A;  3NFC A;  1Y57 A;  3UF4 A;  2GTJ A;  3QBY A;  1K0X A;  1I0C A;  1UFF A;  3WVE B;  4C92 F;  1EFN A;  3MEV A;  4M75 C;  3CC2 Q;  1SRM A;  2HD0 A;  2ESW A;  2NUP A;  1VQK T;  3K7A M;  4YTL A;  2J6O A;  5IHN A;  2CRE A;  2FZG B;  1ZSZ A;  2V22 B;  2P84 A;  2QQS A;  2OTL T;  3BLH B;  2DD4 B;  2DVE A;  4CRL B;  4HNT A;  3CCU A;  1VQ8 Q;  3OS5 A;  2LT1 A;  4Y28 E;  2IPO B;  3NTI A;  1AOJ A;  1NYF A;  4ESR A;  1QP3 A;  4HXJ A;  1G3Y A;  1UGS B;  5CKE A;  3CEY A;  3V8L A;  5FGK B;  1Q81 U;  1M2V A;  1OUL A;  1VIE A;  3QHS A;  2QA4 A;  1JST B;  3LX7 A;  3L42 A;  2A08 A;  3OYH A;  4LDW A;  2K5L A;  1WFW A;  2RJD A;  1FVV B;  2RD1 A;  5I11 A;  3M0Q A;  1UHF A;  4TVR A;  3OYF A;  3M57 A;  2BTT A;  4M75 B;  4CI0 C;  1VQP T;  4EOI B;  2I53 A;  1YWP A;  4BCG B;  4E7H A;  1YI2 A;  1S72 T;  2DL3 A;  4BCM B;  1F5Q B;  4E7Z A;  2MCN A;  5HKC A;  2SEM A;  2OTL Q;  1OPL A;  2COW A;  2FPD A;  3MET A;  1OL2 B;  4BUG A;  3A8M B;  1X6B A;  3VKH A;  3UA7 A;  1E9H B;  1B34 B;  1JRI A;  2RI3 A;  2ROT A;  3V7C A;  4KRC B;  4XU3 A;  2E6Z A;  1R77 A;  1XJW B;  4M7D C;  1I8F A;  4ROD A;  5IXF A;  4JUV A;  1KK7 A;  1K73 U;  4CFX B;  3LQ5 B;  2OI3 A;  4A54 A;  4NC6 A;  1NM7 A;  3SHW A;  2YHT A;  3GF5 A;  2M02 A;  4C5H A;  2LJ3 A;  1OIU B;  2WSF E;  1K8A C;  4J8O A;  2E3H A;  3KXT A;  3EGD A;  2DIL A;  2EYW A;  1QCO A;  3V8K A;  2CSI A;  4M75 E;  3JCM e;  2DRM A;  2XG8 D;  1YIT T;  2J06 A;  3TN8 B;  3DKM A;  5EG2 A;  1YJW A;  4VUB A;  3S3N A;  3CCR A;  1QWF A;  2VC8 A;  1YP5 A;  1X69 A;  1TH7 A;  1KQS S;  4OML A;  5KYX B;  1BI2 A;  1VOL A;  3SWN C;  5HBE B;  4LD9 K;  2DL8 A;  2C6T B;  1ZX6 A;  3L2U A;  2CGH A;  5KYW A;  3REB B;  3S6W A;  3LWI A;  1OZ3 A;  2HL5 C;  4J7I A;  3VYH B;  3ZFJ A;  1RI9 A;  2XDP A;  3I5R A;  2O4X B;  4EOJ B;  1VIN A;  2EGE A;  4QQG A;  2E41 A;  4KUI A;  1K8A R;  2QTX A;  2DZ9 A;  1QVG P;  3JB9 J;  4QSH A;  1MMA A;  1Y96 B;  4CC3 A;  4PJO D;  3EHR A;  1OOT A;  4M7A F;  4LXC A;  4C0D C;  3QZ5 B;  1JQQ A;  4RG2 A;  1H28 B;  3OYC A;  2OTJ Q;  5GAM h;  2JJ9 A;  3JCM Q;  3I56 A;  4QVZ A;  3MHX A;  4BE1 A;  2VUB A;  4BB7 A;  4OP0 A;  1ZQ1 A;  3CCJ Q;  4IUQ A;  3VJP A;  2DYB A;  1M27 C;  4CFM B;  1MNE A;  1WLP B;  3UDC A;  2L3P A;  4ELZ C;  3CCU T;  5IHI A;  3RNJ A;  2OTL A;  2PUK B;  1PKT A;  2CP7 A;  3CCE T;  2LT4 A;  2E65 A;  1RAF B;  2AK5 A;  5HK3 A;  3BHV B;  3TSW A;  2IG0 A;  1E6H A;  2KAF A;  5IHY A;  2X9H A;  5ACB A;  2YT6 A;  4J5Y A;  2E12 A;  2V8J A;  2KE9 A;  3QUI A;  1W4S A;  2PZ1 A;  3R6N A;  3RKY A;  2KT1 A;  2BS2 A;  2WXV B;  2J7I A;  3VKI A;  1QLB A;  3JCM X;  1UJY A;  3QO3 A;  3RMS A;  2KI7 A;  2KR6 A;  3VS4 A;  5FRO A;  1VYV A;  2F5K A;  2FZC B;  1H4L D;  1VQ6 T;  3A8H B;  5GMK l;  2ZPG B;  4BE0 A;  3NHN A;  2CP3 A;  5KE3 A;  3S3O A;  4XTY A;  3GPL A;  1PG5 B;  1IRE B;  4AKH A;  4PKC C;  1C6V X;  4DBR A;  4D8K A;  2QGF B;  3H0I A;  4AFZ C;  4M78 G;  5KYW B;  3DDP B;  2ZZD A;  2LX9 A;  1JXM A;  5CVI A;  2CP0 A;  5J3B A;  2YXY A;  1SF9 A;  2LDM A;  4CFU B;  1D1A A;  5KYY A;  1K0S A;  4OF1 A;  3M0P A;  5ECA A;  4LOC A;  3CC4 Q;  4HT8 A;  1H3H A;  1ZBX A;  2Y4Y A;  1QVG S;  1U8R A;  2XK0 A;  4FYY B;  2COZ A;  4QKU A;  1H8K A;  2AIR B;  5KH6 A;  3C94 A;  2CUD A;  1UEB A;  3VUZ A;  2X3W D;  4B6M A;  1FIN B;  4BI3 A;  1LVK A;  3EGX B;  2K3Y A;  2PVO B;  1N8R R;  4ZN1 A;  1G8X A;  2BKZ B;  1K1Z A;  1KJW A;  2FPF A;  1F1B B;  3EFR A;  2JGZ B;  4ORZ A;  2UZD B;  4OB0 B;  1KC8 R;  2IW8 B;  1B7T A;  1VQ6 Q;  1D0Z A;  1GY3 B;  1GUX B;  2K7A A;  3CBM A;  2I40 B;  3JCM b;  3PIP A;  4OMM A;  4OMP A;  2D6F A;  3N5B B;  4JS5 A;  1KXU A;  4L6V 5;  4OMO A;  4M7D B;  2KT8 A;  1YIT A;  3MI9 B;  2FRY A;  3C95 A;  2YUN A;  1JJ2 P;  4LUE A;  3QYG B;  1SKU B;  2D1X A;  2OAU A;  1WJQ A;  1X75 C;  3OYN A;  2O2O A;  1WI7 A;  5BNJ B;  1VIF A;  2X3X D;  2GGR A;  4RCB A;  3CC7 A;  2C5V B;  2PUO B;  1UNH D;  1KQS A;  4XU2 A;  2LCC A;  2HKN A;  1K9M R;  1BB9 A;  1VQP Q;  4BCN D;  2FZK B;  3FB9 A;  2NUP B;  2KRS A;  2DL7 A;  1YCS B;  3E1S A;  2A37 A;  2VGM A;  1VQ5 Q;  1YJ9 Q;  2JM9 A;  1PHT A;  2DL4 A;  3BY7 A;  2DA9 A;  1KD1 R;  5J39 A;  1M3B A;  4M78 A;  2V26 A;  3CCL T;  4BCP B;  3RES A;  3UT1 A;  2ZPF B;  1Y71 A;  4QQD A;  1P92 A;  3BHT B;  3BG9 A;  1X2K A;  1QVF A;  3JCM f;  4QVD A;  2O01 E;  2BE7 D;  1UG1 A;  5I22 A;  4M7D A;  3A5Z B;  1YI2 T;  4M7D E;  1M3A A;  2E3I A;  2L3S A;  1D1C A;  4BD3 A;  4HCZ A;  3VS6 A;  4FSX A;  2E70 A;  3JB9 H;  1O75 A;  4E7J A;  2WMB B;  3L2Z A;  5I2S A;  1MV3 A;  4HKE A;  4CC2 A;  3OMG A;  3RIR A;  3J81 E;  1AWO A;  4JDS A;  3OYL A;  3CC2 T;  2CCH B;  2QDY B;  1AWJ A;  4JRI A;  1KD1 U;  4DA4 A;  2DD5 A;  3HBL A;  1WGS A;  3MEA A;  4FT2 A;  3QYE A;  1D3U B;  2K57 A;  4AKG A;  1UTI A;  2WPA B;  1E7P A;  1D0X A;  5GAN g;  2W9F A;  1GFD A;  3HB9 A;  1FMV A;  1YN8 A;  5GAN 6;  3PT9 A;  4DEX A;  1M2V B;  4FL6 A;  3I56 Q;  1LOJ A;  4Z89 A;  5HQ0 B;  1IRX A;  2IIM A;  4MDX A;  2W96 A;  3PMI A;  3OYJ A;  1OEB A;  3CCJ A;  4PLI A;  5DM7 R;  1Q86 U;  3I55 A;  3HSB A;  3RDV A;  3MO8 A;  2DFU A;  2CCI B;  1MMN A;  2GFA A;  4HA8 A;  1ENW A;  5DQV A;  2M0O A;  1WDX A;  2C0O A;  2DXT A;  3CBO A;  1NYG A;  5CEI B;  1ABO A;  4AI6 A;  4E7K A;  2R58 A;  4Z02 A;  2KK4 A;  1YIJ Q;  3L2R A;  1VYW B;  2VYT A;  2H8H A;  3UPU A;  5FU7 B;  3TSZ A;  3QDR B;  3I55 Q;  3J7A F;  1PKD B;  4QT7 A;  1QKW A;  2H3E B;  4LDU A;  5GAO m;  2AKK A;  1VYU A;  3GP8 A;  1UGR B;  2HSE B;  1KQ2 A;  1IHV A;  3OW2 A;  1JB0 E;  1OL1 B;  3P8B B;  2JS2 A;  4F7S B;  5GMK j;  1YWO A;  1RLQ C;  3H6Z A;  4EOK B;  1CKB A;  1HJD A;  3HO8 A;  3DLM A;  2K3B A;  1YNZ A;  5IDN B;  2LC4 A;  3G4S T;  1VQM T;  2VXE A;  4M7A B;  1VQL A;  1TS9 A;  4YOO A;  4C8Q C;  2LW4 A;  1QMZ B;  4MML A;  2DD5 B;  3VS7 A;  2RI5 A;  5A0L A;  3JCM W;  2EQI A;  4ELL A;  1Q82 U;  2KRO A;  1WQW A;  3MY1 B;  2DE0 X;  4RCC A;  4RTT A;  1GL5 A;  1H1P B;  2DBK A;  1ZSZ C;  1H1S B;  2Y4X A;  5LJ3 f;  1H3Z A;  4F70 B;  2C0I A;  1QVF P;  3CPW P;  1NJI U;  2DL5 A;  2QF7 A;  4Y72 B;  1UEC A;  2R57 A;  4BCK B;  1D0Y A;  1NBE B;  3IQL A;  3M59 A;  4PJO B;  3QZ9 B;  2EQU A;  3CME A;  2BUD A;  1PNJ A;  4M4Z A;  2EQJ A;  5AT1 B;  3GNG A;  3LH0 A;  5GMK e;  3CCM T;  1LJO A;  5CR2 A;  1M2O A;  3DOG B;  2R7G A;  4PLL A;  4F6S B;  5KCH A;  4KUD K;  1WHG A;  4FU6 A;  5GAN 5;  5GAN 2;  5LJ3 e;  4X1V A;  5DQW A;  3EOC B;  4ELY C;  1JJ2 S;  2XU8 A;  4M7A E;  4AG2 C;  2QXF A;  3C0C A;  3PGG A;  4LD6 A;  4V2S A;  3M5A A;  2X51 A;  4PFO A;  1X27 A;  2E6N A;  3THK A;  2COY A;  3TRE A;  3M55 A;  4AFQ C;  2EIF A;  2DO3 A;  5GAN h;  2DNU A;  1Q81 R;  1Q82 R;  2CUB A;  4MIM A;  1LPL A;  4J9H A;  1AZE A;  3LGL A;  3PTA A;  3BFM A;  2XI9 A;  4J9B A;  4EMH A;  4MZM A;  1JOW A;  2D9T A;  3FC3 A;  4F7L B;  3EJ1 B;  4XAX B;  3NPF A;  4C92 E;  2VWF A;  2GTO A;  2KXD A;  4GY5 A;  1G3T A;  1KG1 A;  4E47 A;  4M78 E;  5D6Y A;  2PK9 B;  2DMO A;  2CS7 A;  2ZGW A;  2K5F A;  3KUF A;  1HYO A;  2CT3 A;  2EGA A;  1SG5 A;  3C4S A;  2G77 A;  1SRL A;  2IN3 A;  3OBY A;  4RKU E;  4YOS A;  4M77 A;  5GMK i;  1P5E B;  3C12 A;  5HK0 A;  2DEQ A;  4M75 F;  3REA B;  4J9C A;  3PNW C;  3GLX A;  4C8Q E;  3CPW S;  5C0M A;  4OB1 B;  1WZO A;  1PKS A;  4F14 A;  2KDS A;  2A3L A;  4M75 A;  1ZSZ B;  3RGF B;  4ZTF A;  4BI8 B;  4N0A A;  2RPN A;  3MJX A;  4HCC A;  2ATC B;  4F7U A;  3OYI A;  1TTH B;  4C5G A;  3SWN B;  5FRM A;  2W99 A;  5HBH B;  2BS3 A;  1OKV B;  1TG0 A;  9ATC B;  2JMC A;  2HQH A;  4XU0 A;  1Y0M A;  1R0C B;  5GAN 7;  3JV3 A;  4M78 B;  3OSV A;  4BBR M;  1YHQ T;  4AG1 C;  5FLX E;  3KHI A;  3CCR Q;  5IT9 E;  3QPH A;  1RAG B;  4MMK A;  4M77 D;  1NEB A;  1W98 B;  1TUG B;  4TTH A;  3A98 A;  3CCE A;  2JTM A;  4A53 A;  3OW2 S;  4M75 G;  1BCO A;  2LVM A;  3PVQ A;  1BU2 A;  4GLK A;  3F70 A;  1ZUK A;  3CD6 Q;  1GFC A;  1VQ4 T;  1NLO C;  1FKM A;  3CMA A;  3DB3 A;  3I56 T;  3DDQ B;  4E7L A;  2UUE B;  4X9C A;  3CCE Q;  3CCS A;  1OX9 A;  4M78 D;  1WHH A;  4MZP A;  2NYS A;  1SHF A;  1RAA B;  1OU9 A;  3HFN A;  4BY6 C;  3O0G D;  2XHC A;  4JX4 A;  2JXB A;  2RJE A;  5FU6 C;  4ATO A;  5GAN 8;  2KBT A;  3EG0 A;  2DTH A;  5GAM g;  3CBP A;  1R8O B;  2V1R A;  1K9M C;  4F7N B;  2QAS A;  1Y7X A;  3X24 B;  4X9D A;  5KYX A;  4ME7 A;  4AT1 B;  2Y90 A;  4AFU C;  1VQN A;  3MEW A;  1GXI E;  4JS4 A;  5DLO A;  3ZBD A;  2CZ6 B;  3OYY A;  1ZA2 B;  3U23 A;  2RN8 A;  2GBQ A;  4JJD A;  2F2C A;  1BKB A;  1U3O A;  2QDJ A;  4N4H A;  5FWB A;  2VV5 A;  1W1F A;  4EDU A;  5IH2 A;  4CFV B;  4UN0 A;  1AVZ C;  1YBY A;  3S3M A;  2CP2 A;  3AHU A;  3CC2 A;  4F7J B;  3H8Z A;  3CCR T;  1TUD A;  2E10 A;  3A8L B;  2KR3 A;  2KY9 A;  2OTJ T;  2YDL A;  2PHG A;  2YLC A;  3SD4 A;  2X4X A;  2RF0 A;  2RQT A;  4HNU A;  3ZL7 C;  1JXO A;  4M7D G;  3QYB A;  4PJO A;  1XO2 A;  1VQO T;  3RKW A;  4JJB A;  4BY1 X;  4XTZ A;  2K6D A;  5AYF A;  2DXC B;  3BHU B;  3CCU Q;  4J7F A;  5FU6 B;  1H27 B;  2HBP A;  2RI2 A;  1VQ4 A;  2P0K A;  2HMA A;  4FYV B;  1NJI C;  5I2M A;  4CFU D;  1M90 R;  4M7A G;  3NTH A;  3TNI B;  2F2X A;  3CPW A;  4J9D A;  1S1N A;  3OYB A;  2FRW A;  4OGE A;  1KC8 C;  3VUB A;  4J9F A;  2RO0 A;  2YSQ A;  2BZY A;  4EOL B;  2QG9 B;  4FX3 B;  4NST B;  3EGX A;  1Q86 C;  1M30 A;  4J83 A;  1VQ8 T;  3OQ5 A;  1IXD A;  4C8Q F;  2DTO A;  1YHQ A;  3H0F A;  3G33 B;  4KBM B;  2EGC A;  4EPC A;  2DEU A;  1OGU B;  2LRQ A;  3TW6 A;  1W2B A;  2MYS A;  3EH1 A;  1UGP B;  4BDY A;  3TQ7 P;  2KGT A;  2ENM A;  4BCM D;  3BG5 A;  4WF2 A;  1Q95 G;  3SWN A;  5GAN 3;  4GBQ A;  2V8I A;  1RAC B;  3EHQ A;  1FX7 A;  4M78 F;  1M8M A;  2O9V A;  4XTW A;  4EMK A;  1JKW A;  1WJR A;  1WA7 A;  1VQ9 A;  2DXB B;  1B3Q A;  3MP8 A;  2OJ2 A;  5LJ3 j;  3A1P A;  2IVW A;  1N9S A;  2DET A;  1KHI A;  3RMQ A;  2RHX A;  2RK1 A;  1FWZ A;  4BY6 B;  1YJN Q;  2L3R A;  4C8Q G;  4J6W A;  4CRI A;  5LJ5 f;  2UZE B;  1VQL Q;  3FJP A;  2PNI A;  1LCK A;  3M0R A;  3EGD B;  2MAM A;  4PL6 A;  1J3T A;  2DX1 A;  1PD1 A;  4EOR B;  2ED1 A;  2RHY A;  3JAM E;  1OV3 A;  4J9I A;  1H1Q B;  4II5 B;  2C4G B;  2ZCF B;  1GRI A;  2EYZ A;  1D09 B;  2PMI B;  4BCF B;  2FPE A;  4C92 D;  5IHK A;  2X35 A;  2KYB A;  3QWX X;  3CCQ T;  1QVG A;  1K8A U;  1G2B A;  5GAM d;  1IB8 A;  1X6O A;  1XNI A;  1QLY A;  4OMF B;  3OS1 A;  1WPY A;  1HXD A;  5L8R E;  3X25 B;  4BCI B;  4HCB A;  3OYE A;  2PQW A;  4R55 A;  3FIF A;  5A0D A;  2KSS A;  3MIA B;  1D3B B;  3CCV Q;  2RMO A;  3QWY A;  4R0K A;  4AMC A;  2EKO A;  3A8G B;  1UNG D;  2EQK A;  3M9Q A;  2CH4 A;  1UDL A;  2CSQ A;  2DVJ A;  1NEG A;  2P4R A;  2CDT A;  2OX7 A;  4F04 B;  3OW2 P;  2E5Q A;  2BS4 A;  1XTD A;  2P0P A;  4A4G A;  2O4X A;  2E1H A;  1TUC A;  2LQK A;  4BY7 X;  4J9G A;  1VQN T;  2O31 A;  2EW3 A;  2XID A;  1URC B;  5HBJ B;  3BE3 A;  2WJ9 A;  1ZBJ A;  4L59 A;  1YJ9 A;  3LWH A;  1RL2 A;  3X20 B;  1VA7 A;  4F6U B;  2DLP A;  1TWB A;  2NLU A;  2QQ9 A;  4DOW A;  3EID B;  2MF2 A;  4F7U B;  2YUQ A;  3MEU A;  2V1Q A;  3TU4 K;  2JM8 A;  5IXB A;  3OY9 A;  4OB2 B;  2QA4 T;  4PNO A;  3MY5 B;  1FMK A;  2AZS A;  2RJF A;  2VGN A;  5IDP B;  1HK9 A;  4EMG A;  4Z88 A;  1BCM A;  2RQV A;  5IAY A;  1MMD A;  2B8A A;  1H24 B;  3WVD B;  2M16 A;  1VQ6 A;  1M1K U;  3G1J A;  3CMA T;  1V1C A;  2DAQ A;  2JT4 A;  2K4Y A;  1C9B A;  2HQE A;  4BCJ B;  2X4Y A;  4KH1 B;  3NDQ A;  3FJ5 A;  5CKD A;  5GAO p;  4NL3 A;  4PJN A;  2KMT A;  3FDR A;  3JCM g;  5CK9 A;  4M78 C;  5GAO n;  2DER A;  2K79 A;  3PE0 A;  4IUV A;  1K76 A;  3HKS A;  5D6X A;  1K4U S;  3KFV A;  1VQL T;  2DXU A;  3CCL Q;  4FYW B;  4E6R A;  1QVF S;  1QP2 A;  3R6O A;  2ECZ A;  3CCQ Q;  1UUE A;  2LQN A;  2DKG A;  2MMP A;  2RK2 A;  5LJ3 g;  4Y92 A;  1OI1 A;  2XD0 A;  1G83 A;  2RNA A;  1YJW T;  4M77 F;  3HTR A;  4BCH B;  2JTE A;  1VQK Q;  1NLP C;  2A28 A;  4F7U E;  3OYA A;  4WCI A;  2JNG A;  1G3S A;  2L8D A;  1OPK A;  2J6K A;  4C5I A;  1GUX A;  5D7U A;  1IZ6 A;  2QAZ A;  4J6Y A;  3KBG A;  3RBB B;  1I1J A;  4C8Q D;  1AD6 A;  1SPK A;  2MPX C;  4XTU A;  3POM A;  1UHC A;  1KC8 U;  1OZ2 A;  1OQK A;  4BBS M;  1ZSG A;  4FYX B;  2PJQ A;  4FCY A;  1K9M U;  3T9N A;  3QHW B;  2XIC A;  4Z8A A;  1E7O A;  4KGV B;  2ZAE A;  4LDY A;  1IO6 A;  2LX7 A;  2EYY A;  4EC9 B;  3VRZ A;  1WHK A;  3BG3 A;  1VQ9 T;  1CSK A;  1U5S A;  2LCS A;  4QVC A;  4ZGJ B;  4J9E A;  2QQB A;  2RHU A;  4OMQ A;  3CCJ T;  3VYG A;  2YRV A;  1T0H A;  2FO0 A;  2ABL A;  4KRT A;  3SFM A;  3VV0 A;  4C0Z A;  4BCQ B;  2HNI A;  2HAX A;  2BIV A;  3LGF A;  4MDW A;  2GQV A;  3CXC A;  2O88 A;  4XK8 E;  2F1L A;  5J26 A;  2LP5 A;  3E2U A;  1RI0 A;  2RHZ A;  2CP6 A;  1VQO Q;  1MGQ A;  4FW2 A;  5KCO A;  3HZJ A;  3VRY A;  2K2M A;  3QJ6 A;  5CQX A;  4KUL A;  5LJ5 j;  5GAM f;  5IN1 A;  1PWT A;  4N4G A;  2ZPH B;  2FB7 A;  3L2Q A;  4PJO G;  1WNL A;  3OSS C;  4Q5W A;  2YRC A;  3QG1 A;  4ROE A;  2W2H A;  3CCQ A;  1AEY A;  5CKF A;  1V29 B;  1W2B P;  2DYI A; 
#chains in the Genus database with same CATH homology
 3PNW C;  3GLX A;  4PJO D;  4M7A A;  1BIB A;  4C8Q E;  3CPW S;  5C0M A;  4M77 B;  4OB1 B;  3JRZ A;  4M7A F;  4PJO F;  1M5Q 1;  3QZ5 B;  4C0D C;  3M53 A;  1QW1 A;  3JCM c;  4M7A D;  1EIF A;  1MHN A;  2A3L A;  2KDS A;  4M75 A;  4RG2 A;  3OYC A;  3JCM J;  5GAM h;  4ZTF A;  4BI8 B;  4N0A A;  2F69 A;  3JCM Q;  3HFO A;  4QVZ A;  3OYM A;  3MHX A;  3I56 A;  2DIG A;  4BE1 A;  2VUB A;  5CKB A;  4BB7 A;  4HCC A;  4OP0 A;  4F7U A;  1XOV A;  3OYI A;  1ZQ1 A;  3CXC S;  4IUQ A;  1DJ7 B;  4XTV A;  3VJP A;  4C5G A;  3SDZ A;  3HRS A;  3SWN B;  4NOY A;  5FRM A;  1N8R U;  4M7D D;  2BS3 A;  3UDC A;  3E9G A;  4ELZ C;  5GAM j;  3CCU T;  2OTJ A;  1S72 A;  1M9S A;  4XU0 A;  2OTL A;  4BE2 A;  3CME T;  2PUK B;  1G5V A;  1N6A A;  4FIB A;  5GAN 7;  4M78 B;  3RKX A;  1N9R A;  3OSV A;  3GNF B;  3CCE T;  4BBR M;  4QW2 A;  1YHQ T;  3CCL A;  2LT4 A;  5FLX E;  2E65 A;  3KHI A;  3QYH B;  5HK3 A;  2WAC A;  4MZT A;  5IT9 E;  2IG0 A;  1XQH A;  2LQ8 A;  3QPH A;  2KAF A;  4MMK A;  4X34 A;  1VQ8 A;  4M77 D;  3QWL A;  3OA6 A;  3VKG A;  2EAY A;  4B9X A;  3CD6 A;  3CCE A;  4J5Y A;  2JTM A;  2E12 A;  1Q82 C;  2V8J A;  4A53 A;  5GAO l;  3QUI A;  2X4J A;  3OB9 A;  3P8H A;  3OW2 S;  1W4S A;  4M75 G;  3RKY A;  2HQX A;  4DQ2 A;  1VQ5 T;  3BDU A;  2LVM A;  2BS2 A;  2D0Q B;  3M4Y A;  4GLK A;  3VKI A;  1QLB A;  3H4C A;  2PU9 B;  3JCM X;  4JX6 A;  3QO3 A;  3RMS A;  4EMK C;  3F70 A;  4F7U F;  3E9F A;  1N27 A;  2KR6 A;  1O9S A;  1QVP A;  3OMC A;  4NL2 A;  5FRO A;  4C0D B;  2F5K A;  1VQ4 T;  4M77 E;  2FL7 A;  1VQ6 T;  1VQP A;  1M90 U;  3A8H B;  1FKM A;  3HHT B;  5GMK l;  2ZPG B;  3DB3 A;  2DTI A;  1M1G A;  1BI1 A;  3J80 E;  3I56 T;  3CMA A;  3MP1 A;  2X4W A;  4BE0 A;  2C06 A;  2E64 A;  3V7S A;  4E7L A;  2EJ9 A;  1NPP A;  4X9C A;  3CCS A;  4A4E A;  4C8Q A;  2P0Q A;  3UWN A;  5KE3 A;  3S3O A;  3HPW A;  3WXM B;  4UC4 A;  1VQ7 A;  1Q7Y U;  4XTY A;  3GPL A;  4M78 D;  5CCA A;  4MZP A;  1IRE B;  4AKH A;  4PKC C;  4OVA A;  3E19 A;  4ZN3 A;  3HFN A;  4BY6 C;  2XHC A;  3MCA B;  5GAN f;  3CPF A;  3JB9 F;  4JX4 A;  4M78 G;  5C6S A;  3DL1 A;  2LX9 A;  4M6V A;  1G3W A;  1VUB A;  2EFI A;  2RJE A;  2ZZD A;  3VYG B;  4XTX A;  5CVI A;  2FYK A;  4IUU A;  5GAN 8;  3JB9 I;  5J3B A;  1VQ7 T;  4ATO A;  2LDM A;  4L5G A;  4OF1 A;  4LOC A;  2DTH A;  5GAM g;  4BDZ A;  3CBP A;  1R8O B;  4HT8 A;  1K9M C;  5HY6 A;  1ZBX A;  2Y4Y A;  3OS0 A;  1QVG S;  1Y7X A;  3M56 A;  3X24 B;  2ZPB B;  2XK0 A;  4X9D A;  4ME7 A;  1U8R A;  1M4Z A;  2Y90 A;  3LYI A;  5A2Q E;  2XKO C;  1VQN A;  4DOV A;  5EJC A;  3MEW A;  2PVG B;  5KH6 A;  5I21 A;  3C94 A;  1GXI E;  4HNV A;  1UEB A;  3VUZ A;  4P5N A;  4BI3 A;  2LNV A;  2XDB A;  1NPR A;  2FHD A;  2P4T A;  1SSF A;  4C92 B;  4JS4 A;  5DLO A;  2K3Y A;  2PVO B;  3ZBD A;  1JBM A;  2CZ6 B;  3OYY A;  3ASK A;  4ZTJ A;  3ER0 A;  4M75 D;  4ZN1 A;  5GAN e;  5A0G A;  3HP9 A;  4C0G A;  2RB6 A;  2QI2 A;  1YIJ T;  5LJ3 d;  3G4S A;  1VQM A;  2WSC E;  1BKB A;  2L89 A;  1X01 A;  5D6W A;  4M77 G;  3JCM V;  3EFR A;  2QDJ A;  4OB0 B;  4N4H A;  1I81 A;  4EDU A;  2VV5 A;  4JRP A;  4FM4 B;  3PFS A;  1YBY A;  5DY9 A;  3S3M A;  3CBM A;  2DXC A;  2KQW A;  3JCM b;  3PIP A;  1JJ2 A;  2EQM A;  2JUF A;  4IKF A;  2D6F A;  3AHU A;  3N5B B;  2GF7 A;  3M58 A;  3DLL A;  4JS5 A;  1YJN T;  5GAO q;  3CC2 A;  3H8Z A;  3Q1J A;  4L6V 5;  4R56 A;  3CCR T;  2E10 A;  3CCV A;  3A8L B;  1KHC A;  2KY9 A;  3L2W A;  4M7D B;  2OTJ T;  1YIT A;  2YLC A;  3SD4 A;  2X4X A;  4QQ6 A;  3INZ A;  3C95 A;  4HNU A;  3QKJ A;  3RER A;  4M7D G;  3TEE A;  3QYB A;  4F7U G;  4PJO A;  3MP6 A;  1VQO T;  4C8Q B;  3QYG B;  2OAU A;  3RKW A;  1WJQ A;  1X75 C;  2RHI A;  3OYN A;  2JVV A;  4XTZ A;  3OYK A;  1VIF A;  5AYF A;  2DXC B;  1VQ4 A;  3X28 B;  4J7F A;  2QQ8 A;  4OB3 B;  2HBP A;  2RI2 A;  5CIU A;  5FU6 B;  1M90 C;  4M7A C;  4RCB A;  5CQY A;  3CC7 A;  2P0K A;  3M54 A;  2PUO B;  4A4F A;  5I2M A;  1NJI C;  1KQS A;  4M7A G;  3NTH A;  2LCC A;  4XU2 A;  5LJ3 h;  2EJF A;  3CPW A;  4XQ3 A;  3OYB A;  1KC8 C;  2KMG A;  4OGE A;  3VUB A;  3EFS A;  3BW1 A;  2RO0 A;  4ZGE B;  2R5A A;  3FB9 A;  3G71 T;  3CCV T;  2CYZ B;  1K73 C;  2FVU A;  3E1S A;  3JCM h;  3CD6 T;  2VGM A;  1KD1 C;  3PMT A;  3JSC A;  3JCM d;  3BY7 A;  1Q86 C;  3L1A A;  4J83 A;  1VQ8 T;  4O6J A;  2EJG A;  5J39 A;  3OQ5 A;  4C8Q F;  1N8R C;  1UB4 A;  2EWN A;  2DTO A;  2CZ0 B;  4M78 A;  3CCL T;  1YHQ A;  3SB2 A;  3RES A;  3UT1 A;  2ZPF B;  2ZZD B;  1Y71 A;  3QXE B;  2DJZ A;  4KBM B;  4EPC A;  2QEX A;  4QQD A;  1P92 A;  2LRQ A;  4C92 G;  3TW6 A;  2RM4 A;  1W2B A;  3HRT A;  2AHJ B;  2DIQ A;  1UGP B;  4B9W A;  2R5M A;  3BG9 A;  4BDY A;  1QVF A;  3JCM f;  4QVD A;  2O01 E;  1WQ7 A;  4O5V A;  1I5L A;  4M7D A;  3A5Z B;  3A8O B;  2QQA A;  1I4K 1;  1YI2 T;  5FU6 C;  2K3X A;  4M7D E;  1BI0 A;  4RMO A;  2BKD N;  2MWO A;  3BG5 A;  2G3R A;  4WF2 A;  3SWN A;  5GAN 3;  4BAC A;  1PSF A;  5CKH A;  4BD3 A;  2ZPI B;  3BDL A;  4HCZ A;  5LJ5 e;  2V8I A;  2VXF A;  4FSX A;  5FRN A;  2CZ1 B;  1FX7 A;  2E70 A;  3G6E T;  3JB9 H;  1O75 A;  4HT9 A;  4M78 F;  4E7J A;  3NTK A;  4XTW A;  1B34 A;  4EMK A;  1WJR A;  3CC4 T;  3CCM A;  4E7I A;  3L2Z A;  1VQ9 A;  2LCL A;  2DXB B;  2F5T X;  2JZ2 A;  4II1 A;  3MP8 A;  5I2S A;  4LDX A;  3JB9 D;  5LJ3 j;  4HKE A;  2M9U A;  2IVW A;  2YLB A;  4PJO E;  1N9S A;  2EYQ A;  2RA2 A;  2V8K A;  3OBW A;  3OMG A;  3V7R A;  3RIR A;  3J81 E;  4JDS A;  3OYL A;  3CC2 T;  4C5E A;  2QDY B;  4JRI A;  5LJ5 g;  3G71 A;  1KD1 U;  4DA4 A;  2DD5 A;  3HBL A;  1KHI A;  4JLI A;  3RMQ A;  1WGS A;  3GOX A;  2RHX A;  3MEA A;  2RK1 A;  3GIB A;  5GAO r;  4M7D F;  1FWZ A;  4BY6 B;  4FT2 A;  1M8V A;  4KT0 E;  2L3R A;  3QYE A;  4C8Q G;  2RH2 A;  4J6W A;  3CC4 A;  1LNX A;  2WSE E;  5KE2 A;  4Y91 A;  1NE8 A;  2K57 A;  2I2L A;  4CRI A;  4IUP A;  5LJ5 f;  4AKG A;  1W2B S;  3FJP A;  1Q7Y C;  3CC7 T;  3G6E A;  3O8V A;  5LL6 S;  1E7P A;  2MAM A;  4ZGD B;  4PL6 A;  4JRQ A;  5GAN g;  1NZ9 A;  4ELJ A;  5GAM e;  4IUT A;  2RHY A;  3JAM E;  1AHJ B;  1UGQ B;  3HB9 A;  4C92 C;  4C0F A;  3OYG A;  2L5Q A;  5GAN 6;  2ZCF B;  3PT9 A;  4MFE A;  4N0A C;  3DB4 A;  4JRK A;  1BIA A;  3NFC A;  5M9O A;  4FL6 A;  3QBY A;  1LOJ A;  4C92 D;  2X35 A;  3FRN A;  4FT4 A;  3CCQ T;  1QVG A;  1YJN A;  1K8A U;  5GAM d;  3WVE B;  4C92 F;  4MDX A;  2LTO A;  1X6O A;  3MEV A;  3PMI A;  3CCJ A;  3OYJ A;  1XNI A;  4M75 C;  2ZPE B;  1U1T A;  4OMF B;  4PLI A;  5DM7 R;  3OS1 A;  1Q86 U;  2HD0 A;  1WPY A;  4JX5 A;  1HXD A;  2K2V A;  3I55 A;  3HSB A;  1PSE A;  3EAE A;  5DLQ E;  5L8R E;  3X25 B;  3MO8 A;  1BYM A;  4HCB A;  2DD4 A;  1YIJ A;  3OYE A;  2PQW A;  4OGC A;  2GFA A;  4R55 A;  4HA8 A;  1VQK T;  3FIF A;  4YTL A;  5A0D A;  2KSS A;  1D3B B;  2M0O A;  4C92 A;  2EKO A;  3A8G B;  2EQK A;  2QQS A;  2OTL T;  3M9Q A;  3JCM P;  2DXT A;  5GAN 4;  2DD4 B;  3CBO A;  2DVE A;  4HNT A;  1YJ9 T;  5GAN d;  4IUR A;  2QFZ A;  3CCU A;  4AI6 A;  4E7K A;  2R58 A;  3OS5 A;  3P8D A;  2KK4 A;  4Z02 A;  3L2R A;  2LT1 A;  2E5Q A;  2BS4 A;  2VYT A;  4Y28 E;  1XTD A;  2P0P A;  3NTI A;  4A4G A;  2O4X A;  3UPU A;  4J6X A;  2E1H A;  4NS5 A;  1QP3 A;  3QDR B;  4XU1 A;  5FU7 B;  2LQK A;  4JJN K;  3J7A F;  1VQN T;  1G3Y A;  3LLR A;  2XID A;  1UGS B;  5CKE A;  1VQO A;  1Y07 A;  4LDU A;  5GAO m;  3CEY A;  2WJ9 A;  3V8L A;  1Q81 U;  3GP8 A;  1UGR B;  5FU7 C;  1VIE A;  3QHS A;  4L59 A;  1KQ2 A;  1YJ9 A;  3OW2 A;  2JOY A;  2CZ7 B;  1JB0 E;  3OYD A;  2QA4 A;  3LWH A;  4PJO C;  1RL2 A;  3X20 B;  3P8B B;  1YJW A;  2QQ9 A;  2NLU A;  4DOW A;  3LX7 A;  2MF2 A;  5GMK j;  4F7U B;  3TU4 K;  3MEU A;  1KQ1 A;  3H6Z A;  3L42 A;  4D6W A;  3OY9 A;  4RG8 A;  4OB2 B;  5GMK m;  3OYH A;  3L2V A;  4LDW A;  2JTF A;  3HO8 A;  2QA4 T;  4PNO A;  2K5L A;  3DLM A;  2RJD A;  4BI4 A;  2RJF A;  2VGN A;  2H3J A;  1HK9 A;  4HLQ A;  4Z6Y A;  2LC4 A;  2RD1 A;  4EMG A;  3G4S T;  5IAY A;  1VQM T;  2VXE A;  4M7A B;  1VQL A;  2B8A A;  3WVD B;  4TVR A;  3OYF A;  3ZEH A;  2M16 A;  1VQ6 A;  1M1K U;  2JN0 A;  2QQR A;  3M57 A;  3CMA T;  1VQP T;  2DAQ A;  4M75 B;  4CI0 C;  2K4Y A;  4C8Q C;  5CKD A;  2HQE A;  2X4Y A;  5GAO p;  4E7H A;  4NL3 A;  1YI2 A;  1S72 T;  3M4G A;  2KMT A;  4MML A;  2DD5 B;  3TW7 A;  2GFU A;  2RI5 A;  3FDR A;  1H64 1;  4M78 C;  3JCM g;  5A0L A;  5CAI A;  5CK9 A;  5GAO n;  5HKC A;  3JCM W;  5GAN j;  1BI3 A;  1M1F A;  4IUV A;  1Q82 U;  3MET A;  4BUG A;  1WQW A;  3HKS A;  5D6X A;  4N4I A;  4RCC A;  3RUX A;  3A8M B;  2QEX T;  1VQL T;  2DXU A;  3VKH A;  2Y4X A;  5LJ3 f;  1H3Z A;  1D3B A;  2A7Y A;  1B34 B;  4JLG A;  4EMK B;  1QP2 A;  3R6O A;  1QVF S;  3I55 T;  2GCX A;  1JRI A;  1NJI U;  4A4H A;  2QF7 A;  2RI3 A;  3V7C A;  3V8J A;  1Q81 C;  4XU3 A;  2E6Z A;  4A4K A;  2DKG A;  4M7D C;  2R57 A;  2MMP A;  5LJ5 d;  1I8F A;  2RK2 A;  2MWP A;  5LJ3 g;  4JUV A;  1OI1 A;  3M59 A;  2MI6 A;  2XD0 A;  1K73 U;  4PJO B;  1YJW T;  4M77 F;  5GMK h;  3QZ9 B;  2EQU A;  4A54 A;  3CME A;  4NC6 A;  2BUD A;  3CCS T;  2EQJ A;  4F7U E;  3OYA A;  3GNG A;  3LH0 A;  5GMK e;  3CCM T;  1LJO A;  2YHT A;  3GF5 A;  5CR2 A;  2JNG A;  1G3S A;  3QJY A;  4PLL A;  2DK3 A;  4C5H A;  5KCH A;  2XDD A;  2DZC A;  4KUD K;  3QSU A;  4M77 C;  2WSF E;  4FU6 A;  5GAN 5;  2L8D A;  1U1S A;  5GAN 2;  4C5I A;  5LJ3 e;  1K8A C;  4J8O A;  3QII A;  4ELY C;  3KXT A;  1IZ6 A;  1JJ2 S;  2XU8 A;  4J6Y A;  4M7A E;  1YCY A;  3KBG A;  2QXF A;  4V2S A;  3PGG A;  4LD6 A;  3X26 B;  3M5A A;  4C8Q D;  1Y96 A;  4XTU A;  3V8K A;  3JCM e;  4M75 E;  1KC8 U;  2E6N A;  2XG8 D;  1OZ2 A;  3TRE A;  1YIT T;  3M55 A;  4BBS M;  2EIF A;  2DO3 A;  3DKM A;  5EG2 A;  5GAN h;  2KVQ G;  1K9M U;  4VUB A;  3S3N A;  1VQK A;  3CCR A;  3T9N A;  3HL8 A;  3FEO A;  2XIC A;  4MIM A;  2DXB A;  3VU3 C;  4LDY A;  3LGL A;  3PTA A;  2VC8 A;  3BFM A;  3JB9 G;  2K5I A;  1ZHI A;  3BG3 A;  1VQ9 T;  2XI9 A;  4QVC A;  2CKK A;  4EMH A;  4ZGJ B;  4MFD A;  4MZM A;  1TH7 A;  2QQB A;  2RHU A;  3CCJ T;  1KQS S;  2D9T A;  3VYG A;  1WJS A;  2YRV A;  3G7Z A;  1BI2 A;  3VV0 A;  1FXX A;  3SFM A;  3FLG A;  4C0Z A;  3SWN C;  3FC3 A;  4LD9 K;  4LDV A;  4XAX B;  3PIO A;  4C92 E;  2HNI A;  2HAX A;  2BIV A;  3HRU A;  1OYX A;  3LGF A;  3L2U A;  2CGH A;  4GY5 A;  4AKI A;  1G3T A;  4MDW A;  4E47 A;  1KG1 A;  5LJ5 h;  4M78 E;  2GQV A;  2DPP B;  5D6Y A;  3S6W A;  3LWI A;  3CXC A;  1VQ5 A;  1OZ3 A;  3ME9 A;  4XK8 E;  3OS2 A;  2CS7 A;  4J7I A;  3VYH B;  5J26 A;  2ZGW A;  3LW5 E;  3ZFJ A;  1RI0 A;  2K5F A;  2XDP A;  3KUF A;  2RHZ A;  1MGQ A;  5KCO A;  3HZJ A;  4HL4 A;  2O4X B;  3QJ6 A;  4KUL A;  5CQX A;  5GAM f;  5LJ5 j;  5IN1 A;  4N4G A;  2ZPH B;  3C4S A;  2FB7 A;  2G77 A;  3L2Q A;  4PJO G;  4QQG A;  3TCJ A;  3OBY A;  1WNL A;  4RKU E;  2E41 A;  3OSS C;  4KUI A;  2QTX A;  2DZ9 A;  4M77 A;  4Q5W A;  3QG1 A;  5CO7 A;  3C12 A;  2PVD B;  5GMK i;  2RJC A;  4QSH A;  3JB9 J;  5HK0 A;  3CCQ A;  2DEQ A;  4M75 F;  2M1H A;  5CKF A;  1V29 B;  3URG A;  1M1K C;  1Y96 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...