2AHJB

Nitrile hydratase complexed with nitric oxide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRILE HYDRATASE
publication title Novel non-heme iron center of nitrile hydratase with a claw setting of oxygen atoms.
pubmed doi rcsb
molecule tags Lyase
total genus 55
structure length 211
sequence length 211
chains with identical sequence D
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 1997-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2ahjB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ahjB02
5L8RE 1PSFA 2PVOB 4XK8E 3QYGB 3WVDB 3A8HB 3X24B 2ZCFB 1QP2A 2DXBA 4KT0E 1V29B 4OB0B 2DD4A 2DD4B 2ZZDA 4RKUE 3LW5E 2CZ6B 2PU9B 1IREB 1JB0E 2AHJB 2CZ0B 2CZ7B 3X20B 1UGQB 1UGSB 3HHTB 2ZPFB 2DPPB 2PUKB 3QXEB 2O01E 3X25B 4FM4B 3QYHB 1QP3A 2WSEE 2CYZB 4OB3B 3VYHB 3VYGA 3A8MB 3A8LB 3VYGB 2ZPHB 2DD5B 2PVGB 2QDYB 3WVEB 1UGPB 3QZ9B 2ZPGB 4ZGJB 4ZGEB 2DXCA 2DXCB 3A8GB 4ZGDB 3X26B 2PVDB 4Y28E 4L6V5 2ZPBB 1GXIE 1PSEA 2ZPIB 4OB2B 2CZ1B 1DJ7B 3X28B 2DD5A 2D0QB 2WSCE 4OB1B 3A8OB 1AHJB 2DXBB 3QZ5B 2ZZDB 1UGRB 2WSFE 2PUOB 2ZPEB
chains in the Genus database with same CATH superfamily
3BDUA 1Q7YR 1WJQA 2BUDA 4DBRA 3CCVQ 3JCMb 3EG1A 1PSFA 2PVOB 3OYFA 1PM3A 5HBEB 1T3SA 4J9EA 1JO8A 1NEGA 3M59A 2EQIA 4WF2A 2V22B 2LCCA 3AHUA 3JB9G 1Q7YU 4M7DD 4BE1A 1H24B 1K9MC 5KCOA 1UECA 3CCLQ 1NZ9A 2DD4A 2K4YA 4J6WA 1OX9A 1N5ZA 1YCYA 2K2MA 3OA6A 2RK2A 2KMGA 1NBEB 2WXVB 1I0CA 1OZ3A 3VUZA 1IREB 3RERA 3RMSA 3VS1A 1H1PB 4OVAA 2C4GB 1HK9A 1FMVA 5KYYB 4D8KA 1UGQB 1QLBA 1AT1B 2DEUA 1G3TA 1VA7A 4EOJB 3NPFA 5CQYA 5I11A 3G71A 2OAUA 1WHKA 3GBQA 3L2RA 1M1GA 4EOIB 1D0YA 3A1PA 2NUTA 2DIQA 5KCHA 2E41A 3VYGB 1M9SA 1E6HA 3V8KA 1GH6B 4FYXB 3RKYA 3JCMW 1MNDA 4N4HA 1KQ1A 4C8QA 2EYXA 3BE3A 5GMKh 3TNWB 3WVEB 1M3BA 3F5XB 3TW6A 3CD6Q 2ROTA 2J7IA 3I56T 2JUFA 1G5VA 2BTTA 1T0JA 4XQ3A 2LC4A 2X4WA 2QFZA 2YUPA 3CMAT 5LJ5h 2G3RA 4FX3B 1JJ2P 1PNJA 3SWNA 2FYKA 2PTKA 3V8JA 4HKEA 1VQ9T 4K11A 2JVVA 2ZPIB 1WXTA 1W1FA 2R57A 1K0SA 5IDNB 1BBZA 1FINB 3DKMA 3DB3A 2K3YA 1Y71A 5J3BA 1JU5C 1WHMA 5ICPB 4F7SB 1H8KA 5HY6A 4II1A 5FRMA 2QEXA 4LE9A 2YRCA 3THKA 4NS5A 1UGRB 3CC7A 3UA7A 1X01A 1WHLA 4ANJA 4N0AA 3OYJA 5HBJB 4BE2A 3FB9A 2G6FX 4AI6A 3MEVA 3I56Q 2IN3A 2E3IA 3CMAQ 2GNCA 5DY9A 2OTJA 4LDUA 4F70B 2HBWA 2YRDA 1CKBA 2X51A 5J39A 4BY7X 1SKUB 4CC3A 1FX7A 4A4GA 4AMCA 1VQ9Q 3LWHA 2F2WA 2VGNA 4PKCC 1BCOA 3INZA 4IIMA 4M77G 2OTLT 2JGZB 3RDVA 4CC4B 2M02A 4I3ZB 1M2VB 2MWPA 2P84A 1S72A 4DBFA 2MI6A 1JEGA 3JB9F 2DLPA 3TVTA 1K9MR 2Z0WA 3JCMV 1GRIA 3HRSA 5KYYA 1VQLT 4QVCA 4M7DE 1TOVA 1JQQA 1OEBA 1K9MU 1OIYB 2LX7A 5EG2A 5GMKl 4FU6A 1KXUA 2L3QA 3M0TA 4KGZB 2RK1A 5GANh 3VYGA 3VKHA 5CYIB 5IHYA 2SRCA 4C92B 4C5GA 5CCAA 4ROEA 2XI9A 4M4ZA 3HRUA 2OTLQ 4BXXX 2HAXA 2QQSA 4EMKC 1RI0A 3NFCA 1TWBA 3GTMS 3QYEA 2QQRA 4N4GA 2RJFA 5IHNA 1QVPA 1OU8A 4KRDB 1ZHIA 3PIOA 1ZA1B 4M7AG 2X3XD 2IW9B 1OGUB 4BI4A 4BY1X 1NE8A 2QK0A 2GFAA 4BCMD 3EJ1B 3OW2A 2C0IA 2DEQA 1OL1B 1OL2B 4EORB 2RJCA 4LNPA 1PKSA 1R0BG 2XDDA 5GAOp 5A2QE 1YWPA 4M77B 4BBRM 3PFSA 4XU2A 2YSQA 5GAMh 2XKOC 1QW1A 2RQRA 1VQMT 2JTMA 4HNVA 2MWOA 4FL6A 4C92F 1PCXA 1NPPA 4CC7A 2FRYA 4EC8B 2P4RA 2COYA 2EUFA 3VS3A 2C5XB 2WMBB 2FPFA 4IUTA 1TFBA 1V1CA 4M78F 3JCMJ 4O5VA 3POMA 2A37A 4PLLA 2EYWA 2DNUA 2DVJA 5CKFA 4E7LA 3PNWC 2ZGWA 3GIBA 1X43A 5IDPB 2JTFA 5GMKe 3MPUB 3ME9A 2I0NA 4EOKB 3REAB 1KQSS 2CH4W 3URGA 1M2VA 2EJFA 3SD4A 2DL5A 4QQDA 4JRQA 4NL3A 3NTKA 3UPUA 3BG9A 3JCMX 4D6WA 1S72Q 1AOJA 2KDSA 3REBB 2DYBA 4M77F 1UGSB 2J6KA 4BB7A 1JKWA 1AVZC 2GBQA 3ZEHA 1VQMQ 4J7IA 3G6EA 3H0FA 4MFDA 2CREA 1Q95G 2CGHA 2K3XA 2Y90A 1IO6A 3PGGA 2DRMA 1R77A 1ABQA 1RADB 4M7AB 3HBLA 5D6YA 3M4GA 4C92A 2DD5B 2W96A 5I21A 2XD0A 1W2BA 2DTHA 4E2FB 4C92D 2XDPA 2YHTA 1C6VX 1ZP2A 1XOVA 1QVGP 1OPLA 4M78D 1N27A 2KY9A 3A8GB 4EOSB 1C0MA 3CCJT 2I53A 2PVDB 4L6V5 3QDRB 2KXCA 2PNIA 2V8IA 3OYAA 4OR5B 1EFNA 3V7SA 2QQ8A 1KK7A 2JM8A 1ZBXA 3JCMP 2G77A 5FW9A 4KRCB 1ZLMA 3S3OA 3G1JA 4J5YA 4CFNB 2O9VA 4M77A 5LJ3f 4LXCA 3I55A 1IHWA 3C4SA 1AD6A 4MDXA 3J7AF 4CFMB 3I35A 4F7UG 4NL2A 3UF4A 4HNUA 5LJ3d 2XIDA 3SHWA 3QYGB 2LJ3A 2HD0A 3WVDB 2LQNA 3OYBA 2Y4XA 3M0QA 2DE0X 2PK9B 1YHQA 3HSBA 3X24B 3CCJQ 1R8OB 4B9WA 2CT4A 4KUIA 4BCKB 2YLBA 2J6FA 3NGPA 2V8JA 3CPWP 2HKQB 2LJ1A 5DM7R 4YTLA 3SWNC 1YWOA 3ASKA 1BB9A 2I40B 3QHSA 3TSWA 5GMKi 2DETA 1OKVB 2DXUA 4OGEA 3A5ZB 2DF6A 2QI2A 1BKBA 4QSHA 1BI1A 3PMTA 5LJ3e 1M90C 1BI3A 1TUCA 1QLYA 4E7IA 1AWOA 5HQ0B 3ZBDA 1OYXA 1N9RA 2RD1A 4KH0B 2LQKA 3EGDB 3P8DA 2W9ZA 3MO8A 1MGQA 1WXBA 1NJIC 1AD5A 2BKDN 1AEYA 2HNIA 1F1BB 4KGVB 5HKCA 1BCMA 2BIVA 3L2ZA 4OP0A 5FWBA 3G6EQ 3CC4A 4YC3B 1TD6A 4LDWA 5D6XA 5EC7A 4M7AA 4N0AC 4RODA 3TQ7P 5CVIA 1V76A 2DBKA 2VXEA 2ECZA 4IKFA 2HQHA 1U06A 2CT3A 3MI9B 1K73U 4BD3A 1OU9A 4FSXA 5GAN7 4M7DG 4ZTFA 3ULRB 2KYMA 4F7UB 1B7TA 4DBQA 3M55A 1BYMA 6AT1B 1YJNT 4GLKA 1NLPC 1KQ2A 1OIUB 3EH2A 4OB2B 4C92E 1MNEA 3HRTA 4J9IA 2DTIA 2WSCE 1UEBA 2LNVA 1QVGA 3EGXB 4M78E 2C6TB 4KGXB 1HSQA 4O6JA 2D6FA 3UWNA 2CP5A 1J3TA 3BG3A 1PRLC 1ZUYA 5I2SA 2KAFA 1M8VA 1N9SA 3MEUA 5HK0A 5FLXE 5EFQB 5LJ5g 4X9DA 1EX4A 2X35A 2EYZA 3EHQA 2BZ8A 3JV3A 1D09B 2D1XA 1KFZA 4F7UF 4M77E 2KR6A 1YJNQ 2WACA 4FIBA 1N6AA 2MAMA 1N8RU 2XU8A 1G3YA 3TEEA 2UZDB 1M3CA 1CKAA 1YJWA 4C0DB 2A7YA 2E6ZA 4PJMA 3RIRA 3LW5E 2DA9A 4CI0C 1W70A 2M9UA 4FCYA 1CSKA 1I5OB 3KFVA 3KUFA 3QBYA 3SB2A 2J05A 4M7DB 3CPWA 3EGDA 3S3NA 1ZUKA 3LH5A 2RB6A 4CXAB 4Z88A 1Q82C 1M90R 1WX6A 2R7GA 4PNOA 4LN2A 1WJSA 1VUBA 3MCAB 1ZSGA 3EG9B 5GAN6 2EWNA 2FB7A 2V26A 4J7FA 1NJIR 3H9NA 1N4MA 1O9KB 2ZPHB 4L59A 4ZN3A 3EFRA 3ZFJA 1QCOA 3OYHA 1VYVA 3BFMA 1UHCA 4QVZA 4YOOA 2BS2A 5KH6A 2KK4A 1VQNA 2AK5A 1LVKA 4OMLA 4C5IA 4E6RA 1VQ7A 2JT4A 4F7UA 2ABLA 2EQKA 2ZPBB 3CC2A 3DLLA 3JSCA 3CCSA 2CZ1B 4RCCA 1NG2A 1ZSZB 5GANg 3EGXA 3CCVT 4BUGA 1WNLA 2IG0A 1NEBA 2FRWA 1ABOA 2DL4A 4HVVA 5IXBA 3GNGA 4MMKA 1UNGD 2JNGA 1I8FA 3CCLT 2HZYA 2DFUA 4GBQA 3EG3A 1QVFA 2EGCA 4C92C 1NPRA 1FMWA 3A8HB 4HCCA 2YT6A 1OULA 5DQVA 2DXBA 4AFUC 4RMOA 4OB0B 2W10A 2COWA 2O88A 2CCIB 1YP5A 3OYCA 5KYNA 4ZNXA 1HJDA 4IUVA 5GAMg 3VS6A 1YJWQ 1QVFS 1VINA 3KHIA 5DLOA 3V8LA 4DQ2A 3L2QA 4M7DA 3CXCA 1FVVB 3QXEB 3OSVA 1W98B 3UDCA 1Y07A 4M77C 1YNZA 1LOJA 1ZQ1A 3UT1A 1UUEA 4F16A 2F1LA 3CD6T 2M0OA 4JJDA 4XU1A 3G33B 2DZ9A 1LNXA 3EG9A 3F70A 5ACBA 3A8LB 2EFIA 4BI3A 1BI0A 4AT1B 4L5GA 1Q82R 1O9KA 2XHCA 2DXTA 2R5MA 2PVGB 3C0CA 4RG2A 1B07A 1D0XA 2M1HA 1AWWA 1UJYA 4UN0A 3G4SA 1Q82U 2FL7A 3X26B 3QSUA 2LCSA 1G2BA 1JSUB 2NYSA 1GCQA 1O9SA 3EG2A 4ORZA 2OJ2A 4HCBA 5FRNA 4TTHA 2L3RA 3X28B 1ZSZA 4OMPA 4IUUA 2JJ9A 4FYYB 1OV3A 1TUDA 1X75C 2AZSA 1M8MA 4F7UE 5IF1B 2WEVB 1WA7A 1HYOA 4IUPA 1E6GA 4R56A 2DL8A 4M7AC 5HK3A 4E7JA 3PTAA 3OYNA 2EVRA 1NYGA 2NUZA 4BCMB 4A53A 2WMAB 1M1FA 3L42A 1JOWA 2RA2A 8AT1B 4C92G 3OQ5A 3L1AA 1AISB 5IXFA 4M78G 2RPNA 5C6SA 2L89A 3PO3S 4CC2A 3BHVB 2H3JA 4RTXA 2E12A 2K57A 1WGSA 5GJVB 1M4ZA 3MY5B 1WFWA 2DVEA 3G71T 2RQTA 5GMKm 1Z9ZA 2K5FA 1X69A 4HCZA 2P4TA 1Y96B 4BCQD 4LDVA 5IHKA 4F7NB 2X1NB 2EPDA 2YDLA 2PJQA 1K8AC 4F04B 1M1KC 3M57A 5IH2A 2FZCB 2VXFA 3GPLA 4PK4A 4Y91A 4LDYA 2LCLA 3PIPA 4PJJA 5CR2A 2X4XA 4EOLB 2WIPB 2ZPGB 1VQ6A 4ZGEB 5GAOl 1H28B 2LQ8A 4ZGDB 1U5SA 2RI3A 5CKBA 1VOLA 2R5AA 3M9QA 1ACMB 4JLIA 1GXIE 3VV0A 3GF5A 7AT1B 3G71Q 5AT1B 3M4YA 2YUOA 2FPEA 2JMAA 1QWEA 2E70A 2E3HA 4LUDA 2QEXT 2A28A 4JRKA 2HKNA 2R58A 3CC7T 1G83A 3OYLA 4HL4A 4RTWA 4M78B 3EOCB 1GFDA 2QXFA 2ZZDB 2MMPA 3V7RA 5L2WB 1WHHA 1VIEA 3NDQA 2KMTA 3JCMh 3HP9A 4BCPB 4EDUA 1H3HA 2OTJT 1ZUUA 2KE9A 4XK8E 2YUQA 2RQUA 2UZLB 1XQHA 3QWXX 2ESWA 4MZMA 1UB4A 1X2KA 4QKUA 2CUDA 1ZBJA 2BZYA 4PJOF 3M0RA 2ZCFB 1RI9A 1KHCA 4BBSM 5LJ5f 1JJ2A 1S72T 4KT0E 4DOVA 1JXOA 2HL3A 3OYYA 3VU3C 4B6MA 1IB8A 1YITA 3EH1A 2QEXQ 1K4US 4OMMA 2FO0A 4ZN1A 2DJQA 3M53A 5LJ5d 3CC7Q 2K79A 3VUBA 3FIFA 1WYXA 2HDAA 1JB0E 5GMKj 5GAN3 4BDZA 5BNJB 4BCNB 1SPKA 3JRZA 3HHTB 1I07A 2HCKA 4BACA 3OW2S 4JJNK 2KR3A 3KXTA 2DPPB 1E9HB 1YJ9A 1SSFA 2E1HA 4JJCA 3X25B 2EBPA 2OTJQ 3R6OA 1PG5B 1D1CA 2GF7A 2JTEA 4JUVA 5EJCA 1IRXA 1YFNA 4YOZA 1QP3A 2QDLA 2O9SA 4KBMB 2BS4A 2YUNA 3LX7A 1RUWA 1RLQC 4J9GA 5LJ5e 3OYDA 5IHIA 1YI2A 2DO3A 4WTOB 4DEYA 2C0TA 4DBHA 3DOGB 1K8AR 1XO2A 1SEMA 4OMOA 1K73C 3QZ9B 1QKXA 2EQMA 4XU3A 1M1KR 3QHRB 2C5VB 3PVQA 3HPWA 3EIDB 3PMIA 4BY6B 4XAXB 3EAEA 4PJOD 4A4KA 1Y57A 1UTIA 1TUGB 1PD1A 1K8AU 1Q81U 2RN8A 4C0DC 1MV3A 1M1KU 2L0AA 1FMKA 2LP5A 5A0GA 3HB9A 3V7CA 4R55A 2B9RA 4XTVA 2CDTA 2RO0A 2D0QB 1E7OA 1GBRA 4JX4A 3HFOA 4M7DC 4M78A 1VYWB 3VJPA 3AT1B 4Y92A 1K0XA 2KRNA 3HTRA 5KE2A 2ZPEB 4OF1A 4JS5A 2QQ9A 5GANf 3I5RA 5IN1A 3M03A 4M75D 3BDLA 3J81E 2COZA 2BKZB 5FWCA 2QTVA 1JXMA 3D7SB 2K9GA 4BCIB 1W2BS 5GANd 2YXYA 5KYUB 4JS4A 1LCKA 2F2VA 4PJNA 4ROCA 1B34B 3OYIA 1JSTB 1VOMA 2ZAEA 4E7ZA 3RGFB 1N8RC 2JM9A 1SRMA 1TTHB 3PE0A 5DQWA 3OSSC 3EG0A 3H0IA 4HNTA 3JB9I 1RAGB 1GCQC 4EMHA 4CFUD 3NMZC 3O8VA 1TS9A 1VIFA 2WFYB 3G6ET 3MHXA 4JPBW 3RKXA 2CZ0B 4HLQA 5CO7A 4Z8AA 1ZSZC 3U23A 2OAWA 4BCND 4P5NA 4CRLB 4R0KA 5GANe 3ER0A 2HSPA 1M2OA 2C0OA 5LJ3j 1JBMA 5GAMf 1WIEA 3QO3A 1EZZB 4BCHB 1Y7XA 3M56A 4J6YA 4C0ZA 1KG1A 1M3AA 5GAMd 3CCMA 4AG2C 4BE0A 1M27C 3M5AA 3TSZA 2KT8A 4ZTJA 2DJZA 2RNAA 3BLQB 1YI2Q 1BU2A 2VUBA 2V1RA 3H8ZA 2KT1A 1H27B 2P0PA 2EKOA 3LGLA 2QA4A 1SHGA 2FVUA 2EYQA 4XTYA 2QYZA 2QGSA 1BIBA 4VUBA 1OI9B 3QYBA 3S3MA 3CCUA 1K73R 4LDXA 4ATOA 2LMJA 2BS3A 5GAMe 3DDQB 2LT4A 3I55T 1PC0A 2DD5A 2KYBA 2DILA 4OGCA 3JCMc 1FKMA 2DZCA 4F6SB 1RAFB 4JZ4A 2X3WD 2AKLA 2ED0A 3RMQA 1UNHD 5KYWB 4PJOE 2O4XB 4Z6YA 1K9AA 2WSFE 3MP8A 1VQOA 2PUOB 4C0GA 2Y4YA 1Z9QA 2QTXA 3UATA 2RF0A 1VQPA 1RL2A 4E7KA 1YHQT 1Q86U 3DJBA 2KRSA 1OI1A 1FXXA 4JX6A 3RUXA 2DK3A 3CBMA 2F2XA 1D3UB 2EQUA 2RI5A 1GFCA 3QUIA 2JMCA 5KYUA 2EQJA 3RKWA 4EC9B 1B34A 4PFPA 1H641 2HQEA 2X4JA 3C94A 3I55Q 2FZGB 2M0YA 4OMNA 4F14A 5I2MA 2CCHB 2KQWA 2AHJB 4II5B 1N8RR 2CZ7B 5IAYA 4ELLA 2ED1A 1H26B 4F7LB 4X1VA 1QVGS 2AKKA 2JXBA 2ZPFB 3CC4T 2F2CA 1VQKA 3TU4K 4BCGB 1YHQQ 1RACB 5FGKB 2VASA 4A54A 3L2VA 1I5LA 2FHDA 3O5ZA 4FM4B 4DOWA 3QYHB 1K1ZA 1WHGA 2CYZB 4MIMA 1O75A 2P0QA 5C0MA 2A36A 2BE7D 5I5ZB 1VQ5A 5L23A 1S1NA 3G7ZA 2LT1A 2BE9B 3CCMQ 2QASA 2OX7A 5IT9E 2DMOA 1A0NB 1M5Q1 3FLGA 4FSSA 1MMNA 2K3BA 1YN8A 3OS5A 4KH1B 1F5QB 2KNBB 2QG9B 3EGUA 2IW6B 2QGFB 3VS2A 1QMCA 1ENWA 3E9FA 2VC8A 2LZ6B 4C5HA 3JAME 3CC4Q 2KGTA 1Y0MA 3CCUQ 1U1TA 3HL8A 2KXDA 1UJ0A 2LX9A 4OB1B 2C5NB 5M9OA 4JDSA 1BU1A 1H3ZA 3L2WA 3CPWS 5KYWA 2O4XA 2L8DA 3LLRA 3BLRB 4RTZA 2RI2A 1TSFA 5HBHB 1G3WA 1W4SA 1D3BB 2GQVA 1KJWA 2JZ2A 2DX1A 3VRZA 1VQPQ 1OPKA 4HXJA 1KSWA 3CMEA 5A0DA 2CP2A 4HCKA 3QWYA 3FJPA 1YJWT 2EGEA 3JB9H 1TU0B 3OMGA 1BIAA 4RKUE 3BG5A 3OS2A 3H41A 2EJGA 1G8XA 1VYUA 5FU6B 1OZ2A 3JCMg 2WJ9A 1U1SA 2KRMA 4C8QB 4GLMA 3BY7A 2DAQA 5DLQE 1QKWA 2NLUA 2G9XB 3TNHB 2WHBB 4M78C 1H4LD 4FW1A 3PT9A 3JCMQ 5KYXB 1X6OA 2O01E 1E7PA 2BZXA 3M58A 1UNLD 2CJMB 4MZTA 4QQGA 1TXQA 3C12A 3MP6A 4OB3B 2FZKB 4C5EA 3VYHB 4QQ6A 4XU0A 1VQNT 2WIHB 2LJ0A 1VQ7T 4V2SA 4HVUA 2QDYB 3VKGA 4RCBA 3CC2T 1KD1C 4BCQB 1VQ5Q 2JS0A 2W99A 3FEOA 3CCEA 3MP1A 5J26A 3CCST 1IZ6A 2UUEB 1PSEA 3I56A 1H25B 1GCPA 2AZVA 2W2HA 4C8QF 3O0GD 3CMAA 2VGMA 2D8JA 3J80E 4MMLA 4EMGA 2QGGA 2O31A 1VQ9A 4FW2A 4FYVB 1H1QB 1AHJB 3CXCS 2NUPB 3MKDA 4DEXA 1AZGB 4KUDK 4F7JB 4AFSC 1KIKA 1D3BA 1VQNQ 3OS1A 2CH4A 3H0HA 1VQ7Q 1QMZB 2B8AA 3LQ5B 2MF2A 3CC2Q 5HCKA 1VYTA 2IIMA 1OX8A 4Q5WA 2V8KA 2EW3A 2P0KA 3CCSQ 3CMEQ 9ATCB 4PFZA 1ZX6A 1UE9A 1YIJA 4BY6C 3WXMB 3SFMA 2E10A 5CIUA 4PJOG 5GAOr 1G3SA 1U8RA 2RM4A 1X6GA 4LD9K 2PU9B 2JS2A 3E9GA 4FT2A 3N5BB 4MZPA 2OTLA 1FYNA 2HBPA 2W0ZA 3CCET 3X20B 2HMAA 3OB9A 4C8QD 5FU7B 3TN8B 4IUQA 3OW2P 3FDRA 4Z89A 4EOQB 2GCXA 5KYXA 2LTOA 5KE3A 3K7AM 4ESRA 2LNHB 1VQLA 2DTOA 1WQ7A 3P8BB 2WSEE 3VS7A 1KQSP 2L2PA 5GAOm 4QVDA 2HQXA 1MMDA 1WJRA 2CUBA 5FROA 4M75G 3OY9A 2C06A 2HEQA 3FJ5A 3G4ST 4EONB 1YCSB 4JJBA 2XICA 2LRQA 3CCRA 1KHIA 2BPMB 4QW2A 3QJ6A 2L3SA 2W9FA 1OKWB 5D6WA 1UDLA 1BI2A 1MHNA 1Q81C 4IURA 3CCEQ 1KD1R 4ELJA 3QG1A 3BLHB 5GAN4 1YIJT 1HXDA 2IVXA 4ELZC 1GUXB 2PZ1A 3H4CA 3MY1B 3P8HA 4RUGA 1M30A 2OI3A 1C9BA 3QWLA 1KD1U 2K6DA 2NUPA 1YBYA 2CS7A 1QCNA 2ATCB 4PJOB 3HO8A 1I1JA 4J9HA 1AWXA 3EHRA 1LJOA 4N4IA 2EJ9A 4RTVA 2B86A 3MJXA 3G4SQ 3GLXA 4FT4A 2PMIB 1SF9A 3QPHA 3OYMA 1VQMA 1UHFA 1PHTA 1X27A 2D8HA 1HD3A 2E4HA 5CKHA 4Z02A 1W2BP 1XTDA 5I22A 3GNFB 2RQWA 2CKKA 2HL5C 4TVRA 3VS4A 1YIJQ 3EFSA 2CZ6B 2CP7A 4M75B 3CCRT 2F5TX 3CCQA 1ARKA 2RHUA 4XTWA 2M51A 4QT7A 2O2OA 2DKGA 1NLOC 4J8OA 4PFOA 3DTOA 4E7HA 2PUKB 4AFZC 2E5KA 1RABB 2K5IA 4CFWB 2D9TA 2PHGA 3LWIA 5LJ3h 2IVWA 2GTJA 2PK2A 4CFUB 2KVQG 1VQLQ 5CAIA 2EIFA 1I81A 1VQ6T 5D7UA 4C8QE 1IXDA 3QIIA 3JB9D 4JLGA 2H3EB 3OYEA 3MEAA 5LJ5j 1Y96A 1JJ2S 5A0LA 1WZOA 1WI7A 3QKJA 3A98A 4M75F 3CCRQ 4Y28E 1KQSA 1LPLA 1PWTA 3DL1A 3M54A 1XJWB 2K5LA 3OYGA 3CCJA 3GOXA 2RHIA 2RJDA 3KBGA 2CP0A 4HVWA 1GUXA 5GAN8 1Q81R 1RLPC 2AIRB 4WCIA 5LQFB 3QZ5B 1H92A 1D0ZA 5CEIB 1RAIB 4XTUA 3CCQT 4JZ3A 4PJOA 2E65A 1VQ6Q 2KSSA 2E64A 1RAEB 1Q86C 2QQAA 3DB4A 3RBBB 3RNJA 2KROA 5GAN2 3EFOB 3ZL7C 2EYYA 1YITT 2K7AA 1MMAA 2H8HA 1IHVA 2CSQA 3M0PA 1RAAB 1SG5A 4JRPA 4LUEA 4MDWA 2ZZDA 2FPDA 2MYSA 4CFXB 1AZEA 4KRTA 2A0FB 4NOYA 2RHZA 4YOSA 2K2VA 3HKSA 3I9QA 4M75A 3FRNA 1YJ9T 2DBMA 2A3LA 4XTXA 5ECAA 5GJWB 3E19A 3CCQQ 2RHYA 2VYTA 4F17A 2E6NA 4A63B 4A4HA 3B57A 1YI2T 3JCMf 2MK5A 1IGUA 5GANj 4EOOB 2E5QA 4D8DA 2VV5A 1YITQ 1QQJA 3JCMd 1NYFA 2MIOA 4AKGA 1I4K1 2CP3A 4C0FA 3NHNA 4NC6A 2ENMA 2DXCB 2IPOB 4M7AF 4M77D 3QJYA 1X2QA 3META 2JN0A 1YJ9Q 5GAOq 1IGQA 4KULA 1QCFA 5FU6C 2JOYA 2A08A 1VQ8A 2VVKA 4JX5A 3MIAB 3E1SA 4J9FA 4C8QC 2GTOA 3JCMe 1YJNA 3A8OB 3SEMA 3LGFA 1QWFA 4HA8A 3Q1JA 3VS0A 2AT1B 5GAMj 1R0CB 4E7SA 5HNBB 2WPAB 1MUZA 1JRIA 2YRVA 3HFNA 1W6XA 3NTHA 1KC8C 1BK2A 2MOXA 2EAYA 4G6LB 1PD0A 2CP6A 1WPYA 3EFOA 5AYFA 1D1AA 4PL6A 4RTTA 1H1RB 1C1AA 1Q86R 1QP2A 2HSEB 2DMEA 4EMKB 5LMKB 4RG8A 2F69A 1SHFA 1WQWA 5HVYB 2M16A 2MPXC 4M7AD 4HT9A 1AWJA 2QF7A 2RQVA 1URCB 2DIGA 3CBPA 1B3QA 3VRYA 4IMYB 3DLMA 2C5OB 2RH2A 4EOPB 1VQ8T 1P92A 2PQWA 1SSHA 2DL7A 3CCMT 1G3NC 4XTZA 4J9BA 3OBYA 2SEMA 4BCFB 4AG1C 1OOTA 4M75E 1XNIA 2VWFA 1PKTA 1TH7A 2XK0A 3A8MB 1MMGA 4CRIA 1T3LA 2EGAA 1UGVA 2QA4T 1QVFP 4BCOB 3TCJA 3DDPB 4ZGJB 3LYIA 2DXCA 5CK9A 3CCUT 3OS0A 2L3PA 4HT8A 1H1SB 2UZEB 2LDMA 3GP8A 3I5SA 5GAN5 3E2UA 3UA6A 3OMCA 4UC4A 2XDBA 4F6UB 1VQ4A 1T0HA 2F5KA 3L2UA 3FC3A 4ELYC 3LH0A 1DJ7B 3S6WA 3BHTB 1VQ8Q 2XG8D 2KBTA 3H6ZA 1VQOT 1Q7YC 5FU7C 2DYIA 1VQPT 4C8QG 2VB6A 2DXBB 1PKDB 4ME7A 2QQBA 4RTUA 3CXCP 2VKNA 1WHJA 3M0SA 4J9CA 3QDFA 3CPFA 3CCVA 3MEWA 4RTYA 4FYWB 2J6OA 5CQXA 3QHWB 4LOCA 2LQWA 2QDJA 1MV0B 5L8RE 2QA4Q 2XMFA 1SRLA 3RR6A 4NSTB 2UZBB 2JW4A 1ZA2B 1U3OA 1GBQA 5LL6S 3VS5A 4MFEA 1EIFA 2YLCA 2NWMA 3TNIB 3C95A 3CCLA 3T9NA 3TREA 3BW1A 2DL3A 3SDZA 1D1BA 3TW7A 1KC8R 4EMKA 1V29B 1X6BA 2GQIA 2DD4B 1WLPB 4OMFB 2DRKA 2ROLA 4J9DA 4LD6A 4B9XA 4OMQA 4JRIA 2KEAA 4A4EA 2QAZA 1VQOQ 3VKIA 1KC8U 1P5EB 4AKHA 2DERA 4EOMB 1M90U 1VQKT 2X9HA 3RESA 3BHUB 3R6NA 2LVMA 5CKEA 4OGRB 1FWZA 4AFQC 2RMOA 2RHXA 1VQ4T 1NM7A 4J83A 1NJIU 4PJOC 2GGRA 2EKHA 3IQLA 4M7AE 1VQ5T 2V1QA 3M0UA 2NUTB 2LW4A 4EPCA 4M7DF 2L5QA 8ATCB 4PLIA 3CEYA 1OQKA 2YWWA 1K76A 3CD6A 2KI7A 2D0NA 5CKDA 4X34A 4Y72B 1UGPB 4EIKA 1GL5A 4J6XA 1UG1A 1RAHB 2FG0A 3NTIA 4M6VA 4BCJB 4BDYA 2MCNA 4GY5A 3SWNB 4F6WB 2I2LA 1VQKQ 4DA4A 4E47A 5LJ3g 4M75C 4CFVB 3OBWA 1UFFA 4X9CA 1VQ4Q 3PVLA 3JB9J 4BI8B 1GY3B 2FEIA 4AKIA 1TG0A 2RJEA 4IIOA 4PJLA 2IW8B 1WXUA 1PRMC 3HZJA 2GFUA 1WDXA 3OYKA 2CSIA 3CBOA 3CQTA 5GAOn 2J06A 3CMET 4A4FA 2X4YA 2DM1A
chains in the Genus database with same CATH topology
4OF1A 1N9SA 3MEUA 3BDUA 5HK0A 1WJQA 5FLXE 4JS5A 2QQ9A 5LJ5g 5GANf 2BUDA 3GLXA 4FT4A 4X9DA 5IN1A 3JCMb 1PSFA 2PVOB 4M75D 2X35A 3BDLA 3QPHA 3J81E 3OYFA 3OYMA 1VQMA 3M59A 4WF2A 1W2BS 5GANd 2LCCA 3AHUA 5CKHA 4Z02A 3JB9G 4F7UF 1Q7YU 4M7DD 4JS4A 4M77E 4BE1A 1K9MC 2KR6A 1XTDA 5KCOA 1B34B 3OYIA 1NZ9A 2DD4A 2WACA 2K4YA 4FIBA 1N8RC 1N6AA 2MAMA 4J6WA 2XU8A 1N8RU 1YCYA 1G3YA 3GNFB 3OA6A 2CKKA 4TVRA 3TEEA 3OSSC 2RK2A 3EFSA 2KMGA 1YJWA 4HNTA 4C0DB 3JB9I 2A7YA 2E6ZA 3RIRA 3LW5E 2CZ6B 4EMHA 1OZ3A 3O8VA 3VUZA 1IREB 4M75B 3CCRT 4CI0C 3RERA 1VIFA 2M9UA 2F5TX 3RMSA 3CCQA 3G6ET 2RHUA 4OVAA 3MHXA 4XTWA 3RKXA 2CZ0B 4HLQA 1HK9A 5CO7A 2DKGA 1UGQB 3KUFA 4J8OA 1QLBA 3QBYA 4P5NA 3SB2A 1G3TA 4E7HA 4M7DB 5GANe 3ER0A 2PUKB 3CPWA 3S3NA 1G5VA 5CQYA 3G71A 2K5IA 2RB6A 2OAUA 5LJ3j 2D9TA 1Q82C 1JBMA 5GAMf 3L2RA 3LWIA 5LJ3h 3QO3A 1M1GA 2IVWA 4PNOA 1Y7XA 2KVQG 1WJSA 3M56A 1VUBA 3MCAB 5CAIA 4J6YA 2DIQA 4C0ZA 5KCHA 1KG1A 2E41A 2EIFA 3VYGB 1I81A 5GAN6 5GAMd 1M9SA 3CCMA 4BE0A 2EWNA 3V8KA 2FB7A 1VQ6T 3M5AA 4J7FA 4C8QE 3RKYA 2ZPHB 3JCMW 4L59A 3QIIA 4N4HA 3EFRA 3ZFJA 4ZN3A 4ZTJA 1KQ1A 3OYHA 2DJZA 4C8QA 5GMKh 3WVEB 3JB9D 3BFMA 2VUBA 4JLGA 3H8ZA 4QVZA 2BS2A 3TW6A 5KH6A 2KK4A 1VQNA 3I56T 2JUFA 3OYEA 3MEAA 4C5IA 5LJ5j 2P0PA 1Y96A 2EKOA 4XQ3A 3LGLA 5A0LA 1JJ2S 2LC4A 2X4WA 2QFZA 1VQ7A 3CMAT 5LJ5h 2G3RA 2FVUA 3QKJA 2QA4A 4F7UA 4M75F 2EYQA 4XTYA 3SWNA 4Y28E 1KQSA 2EQKA 2FYKA 2ZPBB 1BIBA 3CC2A 3V8JA 4HKEA 3DL1A 4VUBA 3DLLA 1VQ9T 3QYBA 3M54A 3JSCA 3S3MA 2JVVA 3CCUA 4LDXA 4ATOA 2ZPIB 2R57A 3OYGA 2K5LA 3CCJA 3GOXA 2RHIA 2RJDA 3CCSA 2CZ1B 3DKMA 3KBGA 2BS3A 5GAMe 3DB3A 4RCCA 2LT4A 2K3YA 3I55T 2DD5A 1Y71A 3JCMc 4OGCA 5J3BA 1FKMA 5GANg 5GAN8 2DZCA 3CCVT 4BUGA 1WNLA 2IG0A 5HY6A 4II1A 5FRMA 3RMQA 2QEXA 4PJOE 3QZ5B 2O4XB 4Z6YA 4NS5A 1UGRB 3CC7A 2WSFE 3MP8A 4XTUA 3CCQT 1VQOA 2PUOB 4PJOA 4C0GA 2Y4YA 2E65A 2QTXA 1VQPA 1RL2A 2KSSA 1X01A 3GNGA 4MMKA 2E64A 2JNGA 4E7KA 1I8FA 1Q86C 2QQAA 3DB4A 3CCLT 1YHQT 1Q86U 4N0AA 3OYJA 4BE2A 1OI1A 3FB9A 1FXXA 1QVFA 4C92C 4AI6A 3MEVA 4JX6A 1NPRA 3RUXA 5GAN2 2DK3A 3CBMA 2EQUA 3A8HB 2RI5A 4HCCA 1YITT 5DY9A 2OTJA 3QUIA 4LDUA 2DXBA 2EQJA 5J39A 3RKWA 1B34A 1FX7A 4A4GA 3LWHA 4JRPA 4RMOA 4MDWA 4OB0B 2VGNA 2ZZDA 4PKCC 5KE2A 1H641 3INZA 2HQEA 4M77G 2OTLT 2X4JA 3OYCA 4NOYA 2MWPA 3C94A 2RHZA 2K2VA 4IUVA 3HKSA 1S72A 2MI6A 4M75A 3JB9F 3FRNA 5GAMg 1YJ9T 5I2MA 3JCMV 3HRSA 4N4IA 1QVFS 2KQWA 2AHJB 3KHIA 5DLOA 3V8LA 4DQ2A 2CZ7B 2A3LA 5IAYA 1VQLT 4QVCA 4M7DE 4XTXA 1QVGS 3L2QA 3E19A 2RHYA 2ZPFB 3CC4T 4M7DA 3CXCA 3QXEB 3OSVA 2VYTA 3UDCA 1Y07A 3TU4K 1VQKA 4M77C 1K9MU 3UT1A 1LOJA 1ZQ1A 2E6NA 4A4HA 3L2VA 4A54A 1YI2T 1I5LA 3JCMf 2FHDA 5EG2A 3CD6T 4FM4B 4DOWA 3QYHB 2M0OA 4FU6A 5GMKl 4XU1A 5GANj 2CYZB 4MIMA 2DZ9A 1O75A 1LNXA 3F70A 2E5QA 2RK1A 3VYGA 2VV5A 3A8LB 5GANh 2P0QA 2EFIA 4BI3A 1BI0A 5C0MA 3VKHA 4L5GA 3JCMd 2XHCA 4C92B 4C5GA 1VQ5A 2DXTA 2R5MA 2PVGB 3G7ZA 5CCAA 2LT1A 4AKGA 1I4K1 4RG2A 2XI9A 4C0FA 5IT9E 3HRUA 2M1HA 1M5Q1 3FLGA 2HAXA 2QQSA 4NC6A 2DXCB 4M7AF 4EMKC 4M77D 3G4SA 1RI0A 3OS5A 3NFCA 3QJYA 1Q82U 2FL7A 3META 2JN0A 3X26B 3QSUA 5GAOq 3QYEA 2QQRA 4N4GA 2RJFA 4KULA 1QVPA 1O9SA 5FU6C 1ZHIA 2JOYA 2VC8A 3E9FA 3PIOA 1VQ8A 4C5HA 4M7AG 3JAME 4HCBA 5FRNA 4BI4A 4JX5A 1NE8A 2GFAA 1U1TA 2L3RA 3X28B 3E1SA 4C8QC 3JCMe 1YJNA 3HL8A 3OW2A 4IUUA 2DEQA 2LX9A 4OB1B 3A8OB 3LGFA 4JDSA 5M9OA 4HA8A 2RJCA 3Q1JA 1H3ZA 2XDDA 3L2WA 1X75C 3CPWS 5GAOp 2O4XA 5A2QE 2L8DA 4M77B 3LLRA 4BBRM 4F7UE 5GAMj 3PFSA 2RI2A 4XU2A 5GAMh 2XKOC 1QW1A 1G3WA 1W4SA 2JTMA 1D3BB 1VQMT 4HNVA 1JRIA 4IUPA 2GQVA 2MWOA 4FL6A 2YRVA 3HFNA 1K8AU 4C92F 4R56A 4M7AC 1NPPA 2JZ2A 3NTHA 5HK3A 4E7JA 1KC8C 3PTAA 3OYNA 2EAYA 4IUTA 4M78F 3JCMJ 3CMEA 4A53A 4O5VA 1WPYA 5A0DA 1M1FA 3L42A 4PLLA 2RA2A 5AYFA 4PL6A 3OW2S 4C92G 5CKFA 4E7LA 3FJPA 3PNWC 3OQ5A 2ZGWA 1YJWT 3GIBA 1QP2A 3JB9H 3L1AA 2JTFA 4M78G 4EMKB 5GMKe 3OMGA 1BIAA 4RG8A 3ME9A 5C6SA 2L89A 2F69A 4RKUE 2H3JA 1KQSS 3BG5A 3URGA 3OS2A 1WQWA 2E12A 2EJFA 2EJGA 2K57A 2M16A 1WGSA 3SD4A 4QQDA 5FU6B 4JRQA 4M7AD 1OZ2A 4HT9A 4NL3A 3NTKA 1M4ZA 2QF7A 3UPUA 2DVEA 3JCMg 3BG9A 3JCMX 3G71T 2WJ9A 1U1SA 4D6WA 5GMKm 2KDSA 4C8QB 2DIGA 2K5FA 3CBPA 1UGSB 3BY7A 4M77F 2DAQA 4BB7A 3DLMA 5DLQE 2NLUA 2RH2A 4HCZA 4M78C 3ZEHA 3JCMQ 2P4TA 1Y96B 3PT9A 4J7IA 4LDVA 3G6EA 1VQ8T 4MFDA 1P92A 1X6OA 2O01E 2PQWA 2OTLA 3CCMT 1E7PA 2CGHA 3M58A 4XTZA 2K3XA 2Y90A 4QQGA 3OBYA 4MZTA 1K8AC 3PGGA 1M1KC 3M57A 3C12A 4M75E 1XNIA 3MP6A 3HBLA 4M7AB 4OB3B 5D6YA 4C5EA 2VXFA 3VYHB 1TH7A 2XK0A 3A8MB 4QQ6A 4CRIA 4XU0A 1VQNT 3M4GA 3GPLA 1M8VA 1VQ7T 4C92A 2DD5B 4Y91A 5I21A 4LDYA 4V2SA 2XD0A 1W2BA 2QA4T 2DTHA 2LCLA 3PIPA 2QDYB 4C92D 3VKGA 2XDPA 2YHTA 4RCBA 3TCJA 5CR2A 2X4XA 3CC2T 2ZPGB 1KD1C 4ZGJB 1VQ6A 1XOVA 4ZGEB 3LYIA 2DXCA 4M78D 1N27A 5CK9A 3OS0A 5GAOl 3CCUT 2KY9A 4HT8A 3A8GB 3FEOA 3CCEA 3MP1A 2LDMA 2LQ8A 1IZ6A 5J26A 3GP8A 4ZGDB 2RI3A 3CCJT 5CKBA 2PVDB 3CCST 5GAN5 4L6V5 3QDRB 2R5AA 3M9QA 3OMCA 4JLIA 1PSEA 4UC4A 1GXIE 3VV0A 3GF5A 3I56A 2XDBA 1VQ4A 3M4YA 4C8QF 3CMAA 2VGMA 2F5KA 2V8IA 3L2UA 2E70A 3J80E 3OYAA 4ELYC 3FC3A 3LH0A 1DJ7B 2QEXT 4MMLA 4EMGA 3V7SA 2QQ8A 4JRKA 3S6WA 2R58A 1VQ9A 3CC7T 2XG8D 3H6ZA 1VQOT 1ZBXA 3OYLA 1Q7YC 3JCMP 4HL4A 5FU7C 1VQPT 1AHJB 2G77A 4C8QG 2DXBB 3CXCS 4M78B 4ME7A 2QQBA 3S3OA 2QXFA 4J5YA 4M77A 4KUDK 5LJ3f 2ZZDB 2MMPA 3I55A 3C4SA 3V7RA 4MDXA 3CPFA 3CCVA 3MEWA 3J7AF 1VIEA 1D3BA 4F7UG 4NL2A 3OS1A 5CQXA 2KMTA 3JCMh 4LOCA 2QDJA 4HNUA 3HP9A 5L8RE 2B8AA 4EDUA 5LJ3d 2OTJT 4XK8E 2MF2A 2XIDA 3QYGB 2HD0A 3WVDB 1XQHA 4MZMA 3OYBA 5LL6S 1UB4A 2Y4XA 4MFEA 4Q5WA 2V8KA 1EIFA 2YLCA 4PJOF 3C95A 1YHQA 3CCLA 2P0KA 3HSBA 3X24B 1R8OB 3T9NA 2ZCFB 3TREA 3BW1A 3SDZA 4B9WA 4KUIA 3TW7A 1KHCA 1YIJA 4BBSM 2YLBA 5LJ5f 1JJ2A 1S72T 4BY6C 4KT0E 3WXMB 4DOVA 1V29B 4EMKA 2V8JA 2DD4B 4OMFB 3OYYA 3SFMA 2E10A 3VU3C 5DM7R 4YTLA 4LD6A 3SWNC 5CIUA 4B9XA 1YITA 4PJOG 3ASKA 5GAOr 1G3SA 1U8RA 2RM4A 3QHSA 4JRIA 4A4EA 4ZN1A 5GMKi 4LD9K 3M53A 2PU9B 5LJ5d 4OGEA 2DXUA 3E9GA 3FIFA 3A5ZB 3N5BB 1JB0E 4FT2A 3VKIA 3VUBA 1KC8U 4AKHA 2QI2A 4MZPA 1BKBA 4QSHA 1BI1A 3PMTA 5GMKj 5LJ3e 1M90U 1M90C 1BI3A 5GAN3 2HBPA 4BDZA 1VQKT 3CCET 3X20B 3RESA 4E7IA 3JRZA 3HHTB 1OYXA 3ZBDA 3OB9A 4BACA 1N9RA 4C8QD 5FU7B 2LVMA 2RD1A 1FWZA 2DPPB 4IUQA 5CKEA 3KXTA 4JJNK 1YJ9A 1SSFA 3FDRA 2RHXA 2LQKA 1VQ4T 3P8DA 2GCXA 2E1HA 3MO8A 1MGQA 2LTOA 5KE3A 4J83A 1NJIC 2BKDN 1NJIU 2HNIA 1VQLA 4PJOC 3X25B 2DTOA 1WQ7A 3R6OA 2GF7A 4JUVA 5HKCA 5EJCA 2BIVA 3L2ZA 3P8BB 4OP0A 3CC4A 4M7AE 1VQ5T 1QP3A 2WSEE 4KBMB 4LDWA 5D6XA 4M7AA 2BS4A 3LX7A 5GAOm 4QVDA 4EPCA 4N0AC 2HQXA 5LJ5e 3OYDA 4M7DF 2L5QA 1WJRA 3CEYA 4PLIA 4M75G 5CVIA 5FROA 3OY9A 2DO3A 1YI2A 2C06A 2VXEA 3CD6A 4IKFA 3G4ST 5CKDA 4X34A 1UGPB 1K73C 3QZ9B 2EQMA 2XICA 4XU3A 4BD3A 2LRQA 1K73U 3CCRA 4FSXA 4J6XA 3HPWA 5GAN7 1KHIA 3NTIA 4M7DG 4ZTFA 4M6VA 3PMIA 4BY6B 4XAXB 4QW2A 3QJ6A 4BDYA 3EAEA 4F7UB 4PJOD 4A4KA 5D6WA 4GY5A 3SWNB 3M55A 1BYMA 1BI2A 1MHNA 2I2LA 4IURA 4C0DC 4DA4A 1Q81C 1YJNT 4GLKA 1Q81U 1KQ2A 1M1KU 4E47A 5LJ3g 4M75C 4ELJA 3QG1A 5GAN4 4OB2B 3OBWA 1YIJT 4C92E 3HB9A 1HXDA 5A0GA 3V7CA 4ELZC 4R55A 3HRTA 4X9CA 4XTVA 2DTIA 3JB9J 2RO0A 3H4CA 4BI8B 2D0QB 2WSCE 1UEBA 2LNVA 1QVGA 4JX4A 3HFOA 3P8HA 4M78E 4M7DC 4AKIA 3QWLA 4O6JA 4M78A 2D6FA 2RJEA 1KD1U 3CMET 1YBYA 2CS7A 3UWNA 3VJPA 3HZJA 2GFUA 3BG3A 3OYKA 3CBOA 4PJOB 3HO8A 5GAOn 5I2SA 2KAFA 4A4FA 1LJOA 2X4YA 2EJ9A 2ZPEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L8R E;  1PSF A;  2PVO B;  4XK8 E;  3QYG B;  3WVD B;  3A8H B;  3X24 B;  2ZCF B;  1QP2 A;  2DXB A;  4KT0 E;  1V29 B;  4OB0 B;  2DD4 A;  2DD4 B;  2ZZD A;  4RKU E;  3LW5 E;  2CZ6 B;  2PU9 B;  1IRE B;  1JB0 E;  2AHJ B;  2CZ0 B;  2CZ7 B;  3X20 B;  1UGQ B;  1UGS B;  3HHT B;  2ZPF B;  2DPP B;  2PUK B;  3QXE B;  2O01 E;  3X25 B;  4FM4 B;  3QYH B;  1QP3 A;  2WSE E;  2CYZ B;  4OB3 B;  3VYH B;  3VYG A;  3A8M B;  3A8L B;  3VYG B;  2ZPH B;  2DD5 B;  2PVG B;  2QDY B;  3WVE B;  1UGP B;  3QZ9 B;  2ZPG B;  4ZGJ B;  4ZGE B;  2DXC A;  2DXC B;  3A8G B;  4ZGD B;  3X26 B;  2PVD B;  4Y28 E;  4L6V 5;  2ZPB B;  1GXI E;  1PSE A;  2ZPI B;  4OB2 B;  2CZ1 B;  1DJ7 B;  3X28 B;  2DD5 A;  2D0Q B;  2WSC E;  4OB1 B;  3A8O B;  1AHJ B;  2DXB B;  3QZ5 B;  2ZZD B;  1UGR B;  2WSF E;  2PUO B;  2ZPE B; 
#chains in the Genus database with same CATH topology
 3BDU A;  1Q7Y R;  1WJQ A;  2BUD A;  4DBR A;  3CCV Q;  3JCM b;  3EG1 A;  1PSF A;  2PVO B;  3OYF A;  1PM3 A;  5HBE B;  1T3S A;  4J9E A;  1JO8 A;  1NEG A;  3M59 A;  2EQI A;  4WF2 A;  2V22 B;  2LCC A;  3AHU A;  3JB9 G;  1Q7Y U;  4M7D D;  4BE1 A;  1H24 B;  1K9M C;  5KCO A;  1UEC A;  3CCL Q;  1NZ9 A;  2DD4 A;  2K4Y A;  4J6W A;  1OX9 A;  1N5Z A;  1YCY A;  2K2M A;  3OA6 A;  2RK2 A;  2KMG A;  1NBE B;  2WXV B;  1I0C A;  1OZ3 A;  3VUZ A;  1IRE B;  3RER A;  3RMS A;  3VS1 A;  1H1P B;  4OVA A;  2C4G B;  1HK9 A;  1FMV A;  5KYY B;  4D8K A;  1UGQ B;  1QLB A;  1AT1 B;  2DEU A;  1G3T A;  1VA7 A;  4EOJ B;  3NPF A;  5CQY A;  5I11 A;  3G71 A;  2OAU A;  1WHK A;  3GBQ A;  3L2R A;  1M1G A;  4EOI B;  1D0Y A;  3A1P A;  2NUT A;  2DIQ A;  5KCH A;  2E41 A;  3VYG B;  1M9S A;  1E6H A;  3V8K A;  1GH6 B;  4FYX B;  3RKY A;  3JCM W;  1MND A;  4N4H A;  1KQ1 A;  4C8Q A;  2EYX A;  3BE3 A;  5GMK h;  3TNW B;  3WVE B;  1M3B A;  3F5X B;  3TW6 A;  3CD6 Q;  2ROT A;  2J7I A;  3I56 T;  2JUF A;  1G5V A;  2BTT A;  1T0J A;  4XQ3 A;  2LC4 A;  2X4W A;  2QFZ A;  2YUP A;  3CMA T;  5LJ5 h;  2G3R A;  4FX3 B;  1JJ2 P;  1PNJ A;  3SWN A;  2FYK A;  2PTK A;  3V8J A;  4HKE A;  1VQ9 T;  4K11 A;  2JVV A;  2ZPI B;  1WXT A;  1W1F A;  2R57 A;  1K0S A;  5IDN B;  1BBZ A;  1FIN B;  3DKM A;  3DB3 A;  2K3Y A;  1Y71 A;  5J3B A;  1JU5 C;  1WHM A;  5ICP B;  4F7S B;  1H8K A;  5HY6 A;  4II1 A;  5FRM A;  2QEX A;  4LE9 A;  2YRC A;  3THK A;  4NS5 A;  1UGR B;  3CC7 A;  3UA7 A;  1X01 A;  1WHL A;  4ANJ A;  4N0A A;  3OYJ A;  5HBJ B;  4BE2 A;  3FB9 A;  2G6F X;  4AI6 A;  3MEV A;  3I56 Q;  2IN3 A;  2E3I A;  3CMA Q;  2GNC A;  5DY9 A;  2OTJ A;  4LDU A;  4F70 B;  2HBW A;  2YRD A;  1CKB A;  2X51 A;  5J39 A;  4BY7 X;  1SKU B;  4CC3 A;  1FX7 A;  4A4G A;  4AMC A;  1VQ9 Q;  3LWH A;  2F2W A;  2VGN A;  4PKC C;  1BCO A;  3INZ A;  4IIM A;  4M77 G;  2OTL T;  2JGZ B;  3RDV A;  4CC4 B;  2M02 A;  4I3Z B;  1M2V B;  2MWP A;  2P84 A;  1S72 A;  4DBF A;  2MI6 A;  1JEG A;  3JB9 F;  2DLP A;  3TVT A;  1K9M R;  2Z0W A;  3JCM V;  1GRI A;  3HRS A;  5KYY A;  1VQL T;  4QVC A;  4M7D E;  1TOV A;  1JQQ A;  1OEB A;  1K9M U;  1OIY B;  2LX7 A;  5EG2 A;  5GMK l;  4FU6 A;  1KXU A;  2L3Q A;  3M0T A;  4KGZ B;  2RK1 A;  5GAN h;  3VYG A;  3VKH A;  5CYI B;  5IHY A;  2SRC A;  4C92 B;  4C5G A;  5CCA A;  4ROE A;  2XI9 A;  4M4Z A;  3HRU A;  2OTL Q;  4BXX X;  2HAX A;  2QQS A;  4EMK C;  1RI0 A;  3NFC A;  1TWB A;  3GTM S;  3QYE A;  2QQR A;  4N4G A;  2RJF A;  5IHN A;  1QVP A;  1OU8 A;  4KRD B;  1ZHI A;  3PIO A;  1ZA1 B;  4M7A G;  2X3X D;  2IW9 B;  1OGU B;  4BI4 A;  4BY1 X;  1NE8 A;  2QK0 A;  2GFA A;  4BCM D;  3EJ1 B;  3OW2 A;  2C0I A;  2DEQ A;  1OL1 B;  1OL2 B;  4EOR B;  2RJC A;  4LNP A;  1PKS A;  1R0B G;  2XDD A;  5GAO p;  5A2Q E;  1YWP A;  4M77 B;  4BBR M;  3PFS A;  4XU2 A;  2YSQ A;  5GAM h;  2XKO C;  1QW1 A;  2RQR A;  1VQM T;  2JTM A;  4HNV A;  2MWO A;  4FL6 A;  4C92 F;  1PCX A;  1NPP A;  4CC7 A;  2FRY A;  4EC8 B;  2P4R A;  2COY A;  2EUF A;  3VS3 A;  2C5X B;  2WMB B;  2FPF A;  4IUT A;  1TFB A;  1V1C A;  4M78 F;  3JCM J;  4O5V A;  3POM A;  2A37 A;  4PLL A;  2EYW A;  2DNU A;  2DVJ A;  5CKF A;  4E7L A;  3PNW C;  2ZGW A;  3GIB A;  1X43 A;  5IDP B;  2JTF A;  5GMK e;  3MPU B;  3ME9 A;  2I0N A;  4EOK B;  3REA B;  1KQS S;  2CH4 W;  3URG A;  1M2V A;  2EJF A;  3SD4 A;  2DL5 A;  4QQD A;  4JRQ A;  4NL3 A;  3NTK A;  3UPU A;  3BG9 A;  3JCM X;  4D6W A;  1S72 Q;  1AOJ A;  2KDS A;  3REB B;  2DYB A;  4M77 F;  1UGS B;  2J6K A;  4BB7 A;  1JKW A;  1AVZ C;  2GBQ A;  3ZEH A;  1VQM Q;  4J7I A;  3G6E A;  3H0F A;  4MFD A;  2CRE A;  1Q95 G;  2CGH A;  2K3X A;  2Y90 A;  1IO6 A;  3PGG A;  2DRM A;  1R77 A;  1ABQ A;  1RAD B;  4M7A B;  3HBL A;  5D6Y A;  3M4G A;  4C92 A;  2DD5 B;  2W96 A;  5I21 A;  2XD0 A;  1W2B A;  2DTH A;  4E2F B;  4C92 D;  2XDP A;  2YHT A;  1C6V X;  1ZP2 A;  1XOV A;  1QVG P;  1OPL A;  4M78 D;  1N27 A;  2KY9 A;  3A8G B;  4EOS B;  1C0M A;  3CCJ T;  2I53 A;  2PVD B;  4L6V 5;  3QDR B;  2KXC A;  2PNI A;  2V8I A;  3OYA A;  4OR5 B;  1EFN A;  3V7S A;  2QQ8 A;  1KK7 A;  2JM8 A;  1ZBX A;  3JCM P;  2G77 A;  5FW9 A;  4KRC B;  1ZLM A;  3S3O A;  3G1J A;  4J5Y A;  4CFN B;  2O9V A;  4M77 A;  5LJ3 f;  4LXC A;  3I55 A;  1IHW A;  3C4S A;  1AD6 A;  4MDX A;  3J7A F;  4CFM B;  3I35 A;  4F7U G;  4NL2 A;  3UF4 A;  4HNU A;  5LJ3 d;  2XID A;  3SHW A;  3QYG B;  2LJ3 A;  2HD0 A;  3WVD B;  2LQN A;  3OYB A;  2Y4X A;  3M0Q A;  2DE0 X;  2PK9 B;  1YHQ A;  3HSB A;  3X24 B;  3CCJ Q;  1R8O B;  4B9W A;  2CT4 A;  4KUI A;  4BCK B;  2YLB A;  2J6F A;  3NGP A;  2V8J A;  3CPW P;  2HKQ B;  2LJ1 A;  5DM7 R;  4YTL A;  3SWN C;  1YWO A;  3ASK A;  1BB9 A;  2I40 B;  3QHS A;  3TSW A;  5GMK i;  2DET A;  1OKV B;  2DXU A;  4OGE A;  3A5Z B;  2DF6 A;  2QI2 A;  1BKB A;  4QSH A;  1BI1 A;  3PMT A;  5LJ3 e;  1M90 C;  1BI3 A;  1TUC A;  1QLY A;  4E7I A;  1AWO A;  5HQ0 B;  3ZBD A;  1OYX A;  1N9R A;  2RD1 A;  4KH0 B;  2LQK A;  3EGD B;  3P8D A;  2W9Z A;  3MO8 A;  1MGQ A;  1WXB A;  1NJI C;  1AD5 A;  2BKD N;  1AEY A;  2HNI A;  1F1B B;  4KGV B;  5HKC A;  1BCM A;  2BIV A;  3L2Z A;  4OP0 A;  5FWB A;  3G6E Q;  3CC4 A;  4YC3 B;  1TD6 A;  4LDW A;  5D6X A;  5EC7 A;  4M7A A;  4N0A C;  4ROD A;  3TQ7 P;  5CVI A;  1V76 A;  2DBK A;  2VXE A;  2ECZ A;  4IKF A;  2HQH A;  1U06 A;  2CT3 A;  3MI9 B;  1K73 U;  4BD3 A;  1OU9 A;  4FSX A;  5GAN 7;  4M7D G;  4ZTF A;  3ULR B;  2KYM A;  4F7U B;  1B7T A;  4DBQ A;  3M55 A;  1BYM A;  6AT1 B;  1YJN T;  4GLK A;  1NLP C;  1KQ2 A;  1OIU B;  3EH2 A;  4OB2 B;  4C92 E;  1MNE A;  3HRT A;  4J9I A;  2DTI A;  2WSC E;  1UEB A;  2LNV A;  1QVG A;  3EGX B;  4M78 E;  2C6T B;  4KGX B;  1HSQ A;  4O6J A;  2D6F A;  3UWN A;  2CP5 A;  1J3T A;  3BG3 A;  1PRL C;  1ZUY A;  5I2S A;  2KAF A;  1M8V A;  1N9S A;  3MEU A;  5HK0 A;  5FLX E;  5EFQ B;  5LJ5 g;  4X9D A;  1EX4 A;  2X35 A;  2EYZ A;  3EHQ A;  2BZ8 A;  3JV3 A;  1D09 B;  2D1X A;  1KFZ A;  4F7U F;  4M77 E;  2KR6 A;  1YJN Q;  2WAC A;  4FIB A;  1N6A A;  2MAM A;  1N8R U;  2XU8 A;  1G3Y A;  3TEE A;  2UZD B;  1M3C A;  1CKA A;  1YJW A;  4C0D B;  2A7Y A;  2E6Z A;  4PJM A;  3RIR A;  3LW5 E;  2DA9 A;  4CI0 C;  1W70 A;  2M9U A;  4FCY A;  1CSK A;  1I5O B;  3KFV A;  3KUF A;  3QBY A;  3SB2 A;  2J05 A;  4M7D B;  3CPW A;  3EGD A;  3S3N A;  1ZUK A;  3LH5 A;  2RB6 A;  4CXA B;  4Z88 A;  1Q82 C;  1M90 R;  1WX6 A;  2R7G A;  4PNO A;  4LN2 A;  1WJS A;  1VUB A;  3MCA B;  1ZSG A;  3EG9 B;  5GAN 6;  2EWN A;  2FB7 A;  2V26 A;  4J7F A;  1NJI R;  3H9N A;  1N4M A;  1O9K B;  2ZPH B;  4L59 A;  4ZN3 A;  3EFR A;  3ZFJ A;  1QCO A;  3OYH A;  1VYV A;  3BFM A;  1UHC A;  4QVZ A;  4YOO A;  2BS2 A;  5KH6 A;  2KK4 A;  1VQN A;  2AK5 A;  1LVK A;  4OML A;  4C5I A;  4E6R A;  1VQ7 A;  2JT4 A;  4F7U A;  2ABL A;  2EQK A;  2ZPB B;  3CC2 A;  3DLL A;  3JSC A;  3CCS A;  2CZ1 B;  4RCC A;  1NG2 A;  1ZSZ B;  5GAN g;  3EGX A;  3CCV T;  4BUG A;  1WNL A;  2IG0 A;  1NEB A;  2FRW A;  1ABO A;  2DL4 A;  4HVV A;  5IXB A;  3GNG A;  4MMK A;  1UNG D;  2JNG A;  1I8F A;  3CCL T;  2HZY A;  2DFU A;  4GBQ A;  3EG3 A;  1QVF A;  2EGC A;  4C92 C;  1NPR A;  1FMW A;  3A8H B;  4HCC A;  2YT6 A;  1OUL A;  5DQV A;  2DXB A;  4AFU C;  4RMO A;  4OB0 B;  2W10 A;  2COW A;  2O88 A;  2CCI B;  1YP5 A;  3OYC A;  5KYN A;  4ZNX A;  1HJD A;  4IUV A;  5GAM g;  3VS6 A;  1YJW Q;  1QVF S;  1VIN A;  3KHI A;  5DLO A;  3V8L A;  4DQ2 A;  3L2Q A;  4M7D A;  3CXC A;  1FVV B;  3QXE B;  3OSV A;  1W98 B;  3UDC A;  1Y07 A;  4M77 C;  1YNZ A;  1LOJ A;  1ZQ1 A;  3UT1 A;  1UUE A;  4F16 A;  2F1L A;  3CD6 T;  2M0O A;  4JJD A;  4XU1 A;  3G33 B;  2DZ9 A;  1LNX A;  3EG9 A;  3F70 A;  5ACB A;  3A8L B;  2EFI A;  4BI3 A;  1BI0 A;  4AT1 B;  4L5G A;  1Q82 R;  1O9K A;  2XHC A;  2DXT A;  2R5M A;  2PVG B;  3C0C A;  4RG2 A;  1B07 A;  1D0X A;  2M1H A;  1AWW A;  1UJY A;  4UN0 A;  3G4S A;  1Q82 U;  2FL7 A;  3X26 B;  3QSU A;  2LCS A;  1G2B A;  1JSU B;  2NYS A;  1GCQ A;  1O9S A;  3EG2 A;  4ORZ A;  2OJ2 A;  4HCB A;  5FRN A;  4TTH A;  2L3R A;  3X28 B;  1ZSZ A;  4OMP A;  4IUU A;  2JJ9 A;  4FYY B;  1OV3 A;  1TUD A;  1X75 C;  2AZS A;  1M8M A;  4F7U E;  5IF1 B;  2WEV B;  1WA7 A;  1HYO A;  4IUP A;  1E6G A;  4R56 A;  2DL8 A;  4M7A C;  5HK3 A;  4E7J A;  3PTA A;  3OYN A;  2EVR A;  1NYG A;  2NUZ A;  4BCM B;  4A53 A;  2WMA B;  1M1F A;  3L42 A;  1JOW A;  2RA2 A;  8AT1 B;  4C92 G;  3OQ5 A;  3L1A A;  1AIS B;  5IXF A;  4M78 G;  2RPN A;  5C6S A;  2L89 A;  3PO3 S;  4CC2 A;  3BHV B;  2H3J A;  4RTX A;  2E12 A;  2K57 A;  1WGS A;  5GJV B;  1M4Z A;  3MY5 B;  1WFW A;  2DVE A;  3G71 T;  2RQT A;  5GMK m;  1Z9Z A;  2K5F A;  1X69 A;  4HCZ A;  2P4T A;  1Y96 B;  4BCQ D;  4LDV A;  5IHK A;  4F7N B;  2X1N B;  2EPD A;  2YDL A;  2PJQ A;  1K8A C;  4F04 B;  1M1K C;  3M57 A;  5IH2 A;  2FZC B;  2VXF A;  3GPL A;  4PK4 A;  4Y91 A;  4LDY A;  2LCL A;  3PIP A;  4PJJ A;  5CR2 A;  2X4X A;  4EOL B;  2WIP B;  2ZPG B;  1VQ6 A;  4ZGE B;  5GAO l;  1H28 B;  2LQ8 A;  4ZGD B;  1U5S A;  2RI3 A;  5CKB A;  1VOL A;  2R5A A;  3M9Q A;  1ACM B;  4JLI A;  1GXI E;  3VV0 A;  3GF5 A;  7AT1 B;  3G71 Q;  5AT1 B;  3M4Y A;  2YUO A;  2FPE A;  2JMA A;  1QWE A;  2E70 A;  2E3H A;  4LUD A;  2QEX T;  2A28 A;  4JRK A;  2HKN A;  2R58 A;  3CC7 T;  1G83 A;  3OYL A;  4HL4 A;  4RTW A;  4M78 B;  3EOC B;  1GFD A;  2QXF A;  2ZZD B;  2MMP A;  3V7R A;  5L2W B;  1WHH A;  1VIE A;  3NDQ A;  2KMT A;  3JCM h;  3HP9 A;  4BCP B;  4EDU A;  1H3H A;  2OTJ T;  1ZUU A;  2KE9 A;  4XK8 E;  2YUQ A;  2RQU A;  2UZL B;  1XQH A;  3QWX X;  2ESW A;  4MZM A;  1UB4 A;  1X2K A;  4QKU A;  2CUD A;  1ZBJ A;  2BZY A;  4PJO F;  3M0R A;  2ZCF B;  1RI9 A;  1KHC A;  4BBS M;  5LJ5 f;  1JJ2 A;  1S72 T;  4KT0 E;  4DOV A;  1JXO A;  2HL3 A;  3OYY A;  3VU3 C;  4B6M A;  1IB8 A;  1YIT A;  3EH1 A;  2QEX Q;  1K4U S;  4OMM A;  2FO0 A;  4ZN1 A;  2DJQ A;  3M53 A;  5LJ5 d;  3CC7 Q;  2K79 A;  3VUB A;  3FIF A;  1WYX A;  2HDA A;  1JB0 E;  5GMK j;  5GAN 3;  4BDZ A;  5BNJ B;  4BCN B;  1SPK A;  3JRZ A;  3HHT B;  1I07 A;  2HCK A;  4BAC A;  3OW2 S;  4JJN K;  2KR3 A;  3KXT A;  2DPP B;  1E9H B;  1YJ9 A;  1SSF A;  2E1H A;  4JJC A;  3X25 B;  2EBP A;  2OTJ Q;  3R6O A;  1PG5 B;  1D1C A;  2GF7 A;  2JTE A;  4JUV A;  5EJC A;  1IRX A;  1YFN A;  4YOZ A;  1QP3 A;  2QDL A;  2O9S A;  4KBM B;  2BS4 A;  2YUN A;  3LX7 A;  1RUW A;  1RLQ C;  4J9G A;  5LJ5 e;  3OYD A;  5IHI A;  1YI2 A;  2DO3 A;  4WTO B;  4DEY A;  2C0T A;  4DBH A;  3DOG B;  1K8A R;  1XO2 A;  1SEM A;  4OMO A;  1K73 C;  3QZ9 B;  1QKX A;  2EQM A;  4XU3 A;  1M1K R;  3QHR B;  2C5V B;  3PVQ A;  3HPW A;  3EID B;  3PMI A;  4BY6 B;  4XAX B;  3EAE A;  4PJO D;  4A4K A;  1Y57 A;  1UTI A;  1TUG B;  1PD1 A;  1K8A U;  1Q81 U;  2RN8 A;  4C0D C;  1MV3 A;  1M1K U;  2L0A A;  1FMK A;  2LP5 A;  5A0G A;  3HB9 A;  3V7C A;  4R55 A;  2B9R A;  4XTV A;  2CDT A;  2RO0 A;  2D0Q B;  1E7O A;  1GBR A;  4JX4 A;  3HFO A;  4M7D C;  4M78 A;  1VYW B;  3VJP A;  3AT1 B;  4Y92 A;  1K0X A;  2KRN A;  3HTR A;  5KE2 A;  2ZPE B;  4OF1 A;  4JS5 A;  2QQ9 A;  5GAN f;  3I5R A;  5IN1 A;  3M03 A;  4M75 D;  3BDL A;  3J81 E;  2COZ A;  2BKZ B;  5FWC A;  2QTV A;  1JXM A;  3D7S B;  2K9G A;  4BCI B;  1W2B S;  5GAN d;  2YXY A;  5KYU B;  4JS4 A;  1LCK A;  2F2V A;  4PJN A;  4ROC A;  1B34 B;  3OYI A;  1JST B;  1VOM A;  2ZAE A;  4E7Z A;  3RGF B;  1N8R C;  2JM9 A;  1SRM A;  1TTH B;  3PE0 A;  5DQW A;  3OSS C;  3EG0 A;  3H0I A;  4HNT A;  3JB9 I;  1RAG B;  1GCQ C;  4EMH A;  4CFU D;  3NMZ C;  3O8V A;  1TS9 A;  1VIF A;  2WFY B;  3G6E T;  3MHX A;  4JPB W;  3RKX A;  2CZ0 B;  4HLQ A;  5CO7 A;  4Z8A A;  1ZSZ C;  3U23 A;  2OAW A;  4BCN D;  4P5N A;  4CRL B;  4R0K A;  5GAN e;  3ER0 A;  2HSP A;  1M2O A;  2C0O A;  5LJ3 j;  1JBM A;  5GAM f;  1WIE A;  3QO3 A;  1EZZ B;  4BCH B;  1Y7X A;  3M56 A;  4J6Y A;  4C0Z A;  1KG1 A;  1M3A A;  5GAM d;  3CCM A;  4AG2 C;  4BE0 A;  1M27 C;  3M5A A;  3TSZ A;  2KT8 A;  4ZTJ A;  2DJZ A;  2RNA A;  3BLQ B;  1YI2 Q;  1BU2 A;  2VUB A;  2V1R A;  3H8Z A;  2KT1 A;  1H27 B;  2P0P A;  2EKO A;  3LGL A;  2QA4 A;  1SHG A;  2FVU A;  2EYQ A;  4XTY A;  2QYZ A;  2QGS A;  1BIB A;  4VUB A;  1OI9 B;  3QYB A;  3S3M A;  3CCU A;  1K73 R;  4LDX A;  4ATO A;  2LMJ A;  2BS3 A;  5GAM e;  3DDQ B;  2LT4 A;  3I55 T;  1PC0 A;  2DD5 A;  2KYB A;  2DIL A;  4OGC A;  3JCM c;  1FKM A;  2DZC A;  4F6S B;  1RAF B;  4JZ4 A;  2X3W D;  2AKL A;  2ED0 A;  3RMQ A;  1UNH D;  5KYW B;  4PJO E;  2O4X B;  4Z6Y A;  1K9A A;  2WSF E;  3MP8 A;  1VQO A;  2PUO B;  4C0G A;  2Y4Y A;  1Z9Q A;  2QTX A;  3UAT A;  2RF0 A;  1VQP A;  1RL2 A;  4E7K A;  1YHQ T;  1Q86 U;  3DJB A;  2KRS A;  1OI1 A;  1FXX A;  4JX6 A;  3RUX A;  2DK3 A;  3CBM A;  2F2X A;  1D3U B;  2EQU A;  2RI5 A;  1GFC A;  3QUI A;  2JMC A;  5KYU A;  2EQJ A;  3RKW A;  4EC9 B;  1B34 A;  4PFP A;  1H64 1;  2HQE A;  2X4J A;  3C94 A;  3I55 Q;  2FZG B;  2M0Y A;  4OMN A;  4F14 A;  5I2M A;  2CCH B;  2KQW A;  2AHJ B;  4II5 B;  1N8R R;  2CZ7 B;  5IAY A;  4ELL A;  2ED1 A;  1H26 B;  4F7L B;  4X1V A;  1QVG S;  2AKK A;  2JXB A;  2ZPF B;  3CC4 T;  2F2C A;  1VQK A;  3TU4 K;  4BCG B;  1YHQ Q;  1RAC B;  5FGK B;  2VAS A;  4A54 A;  3L2V A;  1I5L A;  2FHD A;  3O5Z A;  4FM4 B;  4DOW A;  3QYH B;  1K1Z A;  1WHG A;  2CYZ B;  4MIM A;  1O75 A;  2P0Q A;  5C0M A;  2A36 A;  2BE7 D;  5I5Z B;  1VQ5 A;  5L23 A;  1S1N A;  3G7Z A;  2LT1 A;  2BE9 B;  3CCM Q;  2QAS A;  2OX7 A;  5IT9 E;  2DMO A;  1A0N B;  1M5Q 1;  3FLG A;  4FSS A;  1MMN A;  2K3B A;  1YN8 A;  3OS5 A;  4KH1 B;  1F5Q B;  2KNB B;  2QG9 B;  3EGU A;  2IW6 B;  2QGF B;  3VS2 A;  1QMC A;  1ENW A;  3E9F A;  2VC8 A;  2LZ6 B;  4C5H A;  3JAM E;  3CC4 Q;  2KGT A;  1Y0M A;  3CCU Q;  1U1T A;  3HL8 A;  2KXD A;  1UJ0 A;  2LX9 A;  4OB1 B;  2C5N B;  5M9O A;  4JDS A;  1BU1 A;  1H3Z A;  3L2W A;  3CPW S;  5KYW A;  2O4X A;  2L8D A;  3LLR A;  3BLR B;  4RTZ A;  2RI2 A;  1TSF A;  5HBH B;  1G3W A;  1W4S A;  1D3B B;  2GQV A;  1KJW A;  2JZ2 A;  2DX1 A;  3VRZ A;  1VQP Q;  1OPK A;  4HXJ A;  1KSW A;  3CME A;  5A0D A;  2CP2 A;  4HCK A;  3QWY A;  3FJP A;  1YJW T;  2EGE A;  3JB9 H;  1TU0 B;  3OMG A;  1BIA A;  4RKU E;  3BG5 A;  3OS2 A;  3H41 A;  2EJG A;  1G8X A;  1VYU A;  5FU6 B;  1OZ2 A;  3JCM g;  2WJ9 A;  1U1S A;  2KRM A;  4C8Q B;  4GLM A;  3BY7 A;  2DAQ A;  5DLQ E;  1QKW A;  2NLU A;  2G9X B;  3TNH B;  2WHB B;  4M78 C;  1H4L D;  4FW1 A;  3PT9 A;  3JCM Q;  5KYX B;  1X6O A;  2O01 E;  1E7P A;  2BZX A;  3M58 A;  1UNL D;  2CJM B;  4MZT A;  4QQG A;  1TXQ A;  3C12 A;  3MP6 A;  4OB3 B;  2FZK B;  4C5E A;  3VYH B;  4QQ6 A;  4XU0 A;  1VQN T;  2WIH B;  2LJ0 A;  1VQ7 T;  4V2S A;  4HVU A;  2QDY B;  3VKG A;  4RCB A;  3CC2 T;  1KD1 C;  4BCQ B;  1VQ5 Q;  2JS0 A;  2W99 A;  3FEO A;  3CCE A;  3MP1 A;  5J26 A;  3CCS T;  1IZ6 A;  2UUE B;  1PSE A;  3I56 A;  1H25 B;  1GCP A;  2AZV A;  2W2H A;  4C8Q F;  3O0G D;  3CMA A;  2VGM A;  2D8J A;  3J80 E;  4MML A;  4EMG A;  2QGG A;  2O31 A;  1VQ9 A;  4FW2 A;  4FYV B;  1H1Q B;  1AHJ B;  3CXC S;  2NUP B;  3MKD A;  4DEX A;  1AZG B;  4KUD K;  4F7J B;  4AFS C;  1KIK A;  1D3B A;  1VQN Q;  3OS1 A;  2CH4 A;  3H0H A;  1VQ7 Q;  1QMZ B;  2B8A A;  3LQ5 B;  2MF2 A;  3CC2 Q;  5HCK A;  1VYT A;  2IIM A;  1OX8 A;  4Q5W A;  2V8K A;  2EW3 A;  2P0K A;  3CCS Q;  3CME Q;  9ATC B;  4PFZ A;  1ZX6 A;  1UE9 A;  1YIJ A;  4BY6 C;  3WXM B;  3SFM A;  2E10 A;  5CIU A;  4PJO G;  5GAO r;  1G3S A;  1U8R A;  2RM4 A;  1X6G A;  4LD9 K;  2PU9 B;  2JS2 A;  3E9G A;  4FT2 A;  3N5B B;  4MZP A;  2OTL A;  1FYN A;  2HBP A;  2W0Z A;  3CCE T;  3X20 B;  2HMA A;  3OB9 A;  4C8Q D;  5FU7 B;  3TN8 B;  4IUQ A;  3OW2 P;  3FDR A;  4Z89 A;  4EOQ B;  2GCX A;  5KYX A;  2LTO A;  5KE3 A;  3K7A M;  4ESR A;  2LNH B;  1VQL A;  2DTO A;  1WQ7 A;  3P8B B;  2WSE E;  3VS7 A;  1KQS P;  2L2P A;  5GAO m;  4QVD A;  2HQX A;  1MMD A;  1WJR A;  2CUB A;  5FRO A;  4M75 G;  3OY9 A;  2C06 A;  2HEQ A;  3FJ5 A;  3G4S T;  4EON B;  1YCS B;  4JJB A;  2XIC A;  2LRQ A;  3CCR A;  1KHI A;  2BPM B;  4QW2 A;  3QJ6 A;  2L3S A;  2W9F A;  1OKW B;  5D6W A;  1UDL A;  1BI2 A;  1MHN A;  1Q81 C;  4IUR A;  3CCE Q;  1KD1 R;  4ELJ A;  3QG1 A;  3BLH B;  5GAN 4;  1YIJ T;  1HXD A;  2IVX A;  4ELZ C;  1GUX B;  2PZ1 A;  3H4C A;  3MY1 B;  3P8H A;  4RUG A;  1M30 A;  2OI3 A;  1C9B A;  3QWL A;  1KD1 U;  2K6D A;  2NUP A;  1YBY A;  2CS7 A;  1QCN A;  2ATC B;  4PJO B;  3HO8 A;  1I1J A;  4J9H A;  1AWX A;  3EHR A;  1LJO A;  4N4I A;  2EJ9 A;  4RTV A;  2B86 A;  3MJX A;  3G4S Q;  3GLX A;  4FT4 A;  2PMI B;  1SF9 A;  3QPH A;  3OYM A;  1VQM A;  1UHF A;  1PHT A;  1X27 A;  2D8H A;  1HD3 A;  2E4H A;  5CKH A;  4Z02 A;  1W2B P;  1XTD A;  5I22 A;  3GNF B;  2RQW A;  2CKK A;  2HL5 C;  4TVR A;  3VS4 A;  1YIJ Q;  3EFS A;  2CZ6 B;  2CP7 A;  4M75 B;  3CCR T;  2F5T X;  3CCQ A;  1ARK A;  2RHU A;  4XTW A;  2M51 A;  4QT7 A;  2O2O A;  2DKG A;  1NLO C;  4J8O A;  4PFO A;  3DTO A;  4E7H A;  2PUK B;  4AFZ C;  2E5K A;  1RAB B;  2K5I A;  4CFW B;  2D9T A;  2PHG A;  3LWI A;  5LJ3 h;  2IVW A;  2GTJ A;  2PK2 A;  4CFU B;  2KVQ G;  1VQL Q;  5CAI A;  2EIF A;  1I81 A;  1VQ6 T;  5D7U A;  4C8Q E;  1IXD A;  3QII A;  3JB9 D;  4JLG A;  2H3E B;  3OYE A;  3MEA A;  5LJ5 j;  1Y96 A;  1JJ2 S;  5A0L A;  1WZO A;  1WI7 A;  3QKJ A;  3A98 A;  4M75 F;  3CCR Q;  4Y28 E;  1KQS A;  1LPL A;  1PWT A;  3DL1 A;  3M54 A;  1XJW B;  2K5L A;  3OYG A;  3CCJ A;  3GOX A;  2RHI A;  2RJD A;  3KBG A;  2CP0 A;  4HVW A;  1GUX A;  5GAN 8;  1Q81 R;  1RLP C;  2AIR B;  4WCI A;  5LQF B;  3QZ5 B;  1H92 A;  1D0Z A;  5CEI B;  1RAI B;  4XTU A;  3CCQ T;  4JZ3 A;  4PJO A;  2E65 A;  1VQ6 Q;  2KSS A;  2E64 A;  1RAE B;  1Q86 C;  2QQA A;  3DB4 A;  3RBB B;  3RNJ A;  2KRO A;  5GAN 2;  3EFO B;  3ZL7 C;  2EYY A;  1YIT T;  2K7A A;  1MMA A;  2H8H A;  1IHV A;  2CSQ A;  3M0P A;  1RAA B;  1SG5 A;  4JRP A;  4LUE A;  4MDW A;  2ZZD A;  2FPD A;  2MYS A;  4CFX B;  1AZE A;  4KRT A;  2A0F B;  4NOY A;  2RHZ A;  4YOS A;  2K2V A;  3HKS A;  3I9Q A;  4M75 A;  3FRN A;  1YJ9 T;  2DBM A;  2A3L A;  4XTX A;  5ECA A;  5GJW B;  3E19 A;  3CCQ Q;  2RHY A;  2VYT A;  4F17 A;  2E6N A;  4A63 B;  4A4H A;  3B57 A;  1YI2 T;  3JCM f;  2MK5 A;  1IGU A;  5GAN j;  4EOO B;  2E5Q A;  4D8D A;  2VV5 A;  1YIT Q;  1QQJ A;  3JCM d;  1NYF A;  2MIO A;  4AKG A;  1I4K 1;  2CP3 A;  4C0F A;  3NHN A;  4NC6 A;  2ENM A;  2DXC B;  2IPO B;  4M7A F;  4M77 D;  3QJY A;  1X2Q A;  3MET A;  2JN0 A;  1YJ9 Q;  5GAO q;  1IGQ A;  4KUL A;  1QCF A;  5FU6 C;  2JOY A;  2A08 A;  1VQ8 A;  2VVK A;  4JX5 A;  3MIA B;  3E1S A;  4J9F A;  4C8Q C;  2GTO A;  3JCM e;  1YJN A;  3A8O B;  3SEM A;  3LGF A;  1QWF A;  4HA8 A;  3Q1J A;  3VS0 A;  2AT1 B;  5GAM j;  1R0C B;  4E7S A;  5HNB B;  2WPA B;  1MUZ A;  1JRI A;  2YRV A;  3HFN A;  1W6X A;  3NTH A;  1KC8 C;  1BK2 A;  2MOX A;  2EAY A;  4G6L B;  1PD0 A;  2CP6 A;  1WPY A;  3EFO A;  5AYF A;  1D1A A;  4PL6 A;  4RTT A;  1H1R B;  1C1A A;  1Q86 R;  1QP2 A;  2HSE B;  2DME A;  4EMK B;  5LMK B;  4RG8 A;  2F69 A;  1SHF A;  1WQW A;  5HVY B;  2M16 A;  2MPX C;  4M7A D;  4HT9 A;  1AWJ A;  2QF7 A;  2RQV A;  1URC B;  2DIG A;  3CBP A;  1B3Q A;  3VRY A;  4IMY B;  3DLM A;  2C5O B;  2RH2 A;  4EOP B;  1VQ8 T;  1P92 A;  2PQW A;  1SSH A;  2DL7 A;  3CCM T;  1G3N C;  4XTZ A;  4J9B A;  3OBY A;  2SEM A;  4BCF B;  4AG1 C;  1OOT A;  4M75 E;  1XNI A;  2VWF A;  1PKT A;  1TH7 A;  2XK0 A;  3A8M B;  1MMG A;  4CRI A;  1T3L A;  2EGA A;  1UGV A;  2QA4 T;  1QVF P;  4BCO B;  3TCJ A;  3DDP B;  4ZGJ B;  3LYI A;  2DXC A;  5CK9 A;  3CCU T;  3OS0 A;  2L3P A;  4HT8 A;  1H1S B;  2UZE B;  2LDM A;  3GP8 A;  3I5S A;  5GAN 5;  3E2U A;  3UA6 A;  3OMC A;  4UC4 A;  2XDB A;  4F6U B;  1VQ4 A;  1T0H A;  2F5K A;  3L2U A;  3FC3 A;  4ELY C;  3LH0 A;  1DJ7 B;  3S6W A;  3BHT B;  1VQ8 Q;  2XG8 D;  2KBT A;  3H6Z A;  1VQO T;  1Q7Y C;  5FU7 C;  2DYI A;  1VQP T;  4C8Q G;  2VB6 A;  2DXB B;  1PKD B;  4ME7 A;  2QQB A;  4RTU A;  3CXC P;  2VKN A;  1WHJ A;  3M0S A;  4J9C A;  3QDF A;  3CPF A;  3CCV A;  3MEW A;  4RTY A;  4FYW B;  2J6O A;  5CQX A;  3QHW B;  4LOC A;  2LQW A;  2QDJ A;  1MV0 B;  5L8R E;  2QA4 Q;  2XMF A;  1SRL A;  3RR6 A;  4NST B;  2UZB B;  2JW4 A;  1ZA2 B;  1U3O A;  1GBQ A;  5LL6 S;  3VS5 A;  4MFE A;  1EIF A;  2YLC A;  2NWM A;  3TNI B;  3C95 A;  3CCL A;  3T9N A;  3TRE A;  3BW1 A;  2DL3 A;  3SDZ A;  1D1B A;  3TW7 A;  1KC8 R;  4EMK A;  1V29 B;  1X6B A;  2GQI A;  2DD4 B;  1WLP B;  4OMF B;  2DRK A;  2ROL A;  4J9D A;  4LD6 A;  4B9X A;  4OMQ A;  4JRI A;  2KEA A;  4A4E A;  2QAZ A;  1VQO Q;  3VKI A;  1KC8 U;  1P5E B;  4AKH A;  2DER A;  4EOM B;  1M90 U;  1VQK T;  2X9H A;  3RES A;  3BHU B;  3R6N A;  2LVM A;  5CKE A;  4OGR B;  1FWZ A;  4AFQ C;  2RMO A;  2RHX A;  1VQ4 T;  1NM7 A;  4J83 A;  1NJI U;  4PJO C;  2GGR A;  2EKH A;  3IQL A;  4M7A E;  1VQ5 T;  2V1Q A;  3M0U A;  2NUT B;  2LW4 A;  4EPC A;  4M7D F;  2L5Q A;  8ATC B;  4PLI A;  3CEY A;  1OQK A;  2YWW A;  1K76 A;  3CD6 A;  2KI7 A;  2D0N A;  5CKD A;  4X34 A;  4Y72 B;  1UGP B;  4EIK A;  1GL5 A;  4J6X A;  1UG1 A;  1RAH B;  2FG0 A;  3NTI A;  4M6V A;  4BCJ B;  4BDY A;  2MCN A;  4GY5 A;  3SWN B;  4F6W B;  2I2L A;  1VQK Q;  4DA4 A;  4E47 A;  5LJ3 g;  4M75 C;  4CFV B;  3OBW A;  1UFF A;  4X9C A;  1VQ4 Q;  3PVL A;  3JB9 J;  4BI8 B;  1GY3 B;  2FEI A;  4AKI A;  1TG0 A;  2RJE A;  4IIO A;  4PJL A;  2IW8 B;  1WXU A;  1PRM C;  3HZJ A;  2GFU A;  1WDX A;  3OYK A;  2CSI A;  3CBO A;  3CQT A;  5GAO n;  2J06 A;  3CME T;  4A4F A;  2X4Y A;  2DM1 A; 
#chains in the Genus database with same CATH homology
 4OF1 A;  1N9S A;  3MEU A;  3BDU A;  5HK0 A;  1WJQ A;  5FLX E;  4JS5 A;  2QQ9 A;  5LJ5 g;  5GAN f;  2BUD A;  3GLX A;  4FT4 A;  4X9D A;  5IN1 A;  3JCM b;  1PSF A;  2PVO B;  4M75 D;  2X35 A;  3BDL A;  3QPH A;  3J81 E;  3OYF A;  3OYM A;  1VQM A;  3M59 A;  4WF2 A;  1W2B S;  5GAN d;  2LCC A;  3AHU A;  5CKH A;  4Z02 A;  3JB9 G;  4F7U F;  1Q7Y U;  4M7D D;  4JS4 A;  4M77 E;  4BE1 A;  1K9M C;  2KR6 A;  1XTD A;  5KCO A;  1B34 B;  3OYI A;  1NZ9 A;  2DD4 A;  2WAC A;  2K4Y A;  4FIB A;  1N8R C;  1N6A A;  2MAM A;  4J6W A;  2XU8 A;  1N8R U;  1YCY A;  1G3Y A;  3GNF B;  3OA6 A;  2CKK A;  4TVR A;  3TEE A;  3OSS C;  2RK2 A;  3EFS A;  2KMG A;  1YJW A;  4HNT A;  4C0D B;  3JB9 I;  2A7Y A;  2E6Z A;  3RIR A;  3LW5 E;  2CZ6 B;  4EMH A;  1OZ3 A;  3O8V A;  3VUZ A;  1IRE B;  4M75 B;  3CCR T;  4CI0 C;  3RER A;  1VIF A;  2M9U A;  2F5T X;  3RMS A;  3CCQ A;  3G6E T;  2RHU A;  4OVA A;  3MHX A;  4XTW A;  3RKX A;  2CZ0 B;  4HLQ A;  1HK9 A;  5CO7 A;  2DKG A;  1UGQ B;  3KUF A;  4J8O A;  1QLB A;  3QBY A;  4P5N A;  3SB2 A;  1G3T A;  4E7H A;  4M7D B;  5GAN e;  3ER0 A;  2PUK B;  3CPW A;  3S3N A;  1G5V A;  5CQY A;  3G71 A;  2K5I A;  2RB6 A;  2OAU A;  5LJ3 j;  2D9T A;  1Q82 C;  1JBM A;  5GAM f;  3L2R A;  3LWI A;  5LJ3 h;  3QO3 A;  1M1G A;  2IVW A;  4PNO A;  1Y7X A;  2KVQ G;  1WJS A;  3M56 A;  1VUB A;  3MCA B;  5CAI A;  4J6Y A;  2DIQ A;  4C0Z A;  5KCH A;  1KG1 A;  2E41 A;  2EIF A;  3VYG B;  1I81 A;  5GAN 6;  5GAM d;  1M9S A;  3CCM A;  4BE0 A;  2EWN A;  3V8K A;  2FB7 A;  1VQ6 T;  3M5A A;  4J7F A;  4C8Q E;  3RKY A;  2ZPH B;  3JCM W;  4L59 A;  3QII A;  4N4H A;  3EFR A;  3ZFJ A;  4ZN3 A;  4ZTJ A;  1KQ1 A;  3OYH A;  2DJZ A;  4C8Q A;  5GMK h;  3WVE B;  3JB9 D;  3BFM A;  2VUB A;  4JLG A;  3H8Z A;  4QVZ A;  2BS2 A;  3TW6 A;  5KH6 A;  2KK4 A;  1VQN A;  3I56 T;  2JUF A;  3OYE A;  3MEA A;  4C5I A;  5LJ5 j;  2P0P A;  1Y96 A;  2EKO A;  4XQ3 A;  3LGL A;  5A0L A;  1JJ2 S;  2LC4 A;  2X4W A;  2QFZ A;  1VQ7 A;  3CMA T;  5LJ5 h;  2G3R A;  2FVU A;  3QKJ A;  2QA4 A;  4F7U A;  4M75 F;  2EYQ A;  4XTY A;  3SWN A;  4Y28 E;  1KQS A;  2EQK A;  2FYK A;  2ZPB B;  1BIB A;  3CC2 A;  3V8J A;  4HKE A;  3DL1 A;  4VUB A;  3DLL A;  1VQ9 T;  3QYB A;  3M54 A;  3JSC A;  3S3M A;  2JVV A;  3CCU A;  4LDX A;  4ATO A;  2ZPI B;  2R57 A;  3OYG A;  2K5L A;  3CCJ A;  3GOX A;  2RHI A;  2RJD A;  3CCS A;  2CZ1 B;  3DKM A;  3KBG A;  2BS3 A;  5GAM e;  3DB3 A;  4RCC A;  2LT4 A;  2K3Y A;  3I55 T;  2DD5 A;  1Y71 A;  3JCM c;  4OGC A;  5J3B A;  1FKM A;  5GAN g;  5GAN 8;  2DZC A;  3CCV T;  4BUG A;  1WNL A;  2IG0 A;  5HY6 A;  4II1 A;  5FRM A;  3RMQ A;  2QEX A;  4PJO E;  3QZ5 B;  2O4X B;  4Z6Y A;  4NS5 A;  1UGR B;  3CC7 A;  2WSF E;  3MP8 A;  4XTU A;  3CCQ T;  1VQO A;  2PUO B;  4PJO A;  4C0G A;  2Y4Y A;  2E65 A;  2QTX A;  1VQP A;  1RL2 A;  2KSS A;  1X01 A;  3GNG A;  4MMK A;  2E64 A;  2JNG A;  4E7K A;  1I8F A;  1Q86 C;  2QQA A;  3DB4 A;  3CCL T;  1YHQ T;  1Q86 U;  4N0A A;  3OYJ A;  4BE2 A;  1OI1 A;  3FB9 A;  1FXX A;  1QVF A;  4C92 C;  4AI6 A;  3MEV A;  4JX6 A;  1NPR A;  3RUX A;  5GAN 2;  2DK3 A;  3CBM A;  2EQU A;  3A8H B;  2RI5 A;  4HCC A;  1YIT T;  5DY9 A;  2OTJ A;  3QUI A;  4LDU A;  2DXB A;  2EQJ A;  5J39 A;  3RKW A;  1B34 A;  1FX7 A;  4A4G A;  3LWH A;  4JRP A;  4RMO A;  4MDW A;  4OB0 B;  2VGN A;  2ZZD A;  4PKC C;  5KE2 A;  1H64 1;  3INZ A;  2HQE A;  4M77 G;  2OTL T;  2X4J A;  3OYC A;  4NOY A;  2MWP A;  3C94 A;  2RHZ A;  2K2V A;  4IUV A;  3HKS A;  1S72 A;  2MI6 A;  4M75 A;  3JB9 F;  3FRN A;  5GAM g;  1YJ9 T;  5I2M A;  3JCM V;  3HRS A;  4N4I A;  1QVF S;  2KQW A;  2AHJ B;  3KHI A;  5DLO A;  3V8L A;  4DQ2 A;  2CZ7 B;  2A3L A;  5IAY A;  1VQL T;  4QVC A;  4M7D E;  4XTX A;  1QVG S;  3L2Q A;  3E19 A;  2RHY A;  2ZPF B;  3CC4 T;  4M7D A;  3CXC A;  3QXE B;  3OSV A;  2VYT A;  3UDC A;  1Y07 A;  3TU4 K;  1VQK A;  4M77 C;  1K9M U;  3UT1 A;  1LOJ A;  1ZQ1 A;  2E6N A;  4A4H A;  3L2V A;  4A54 A;  1YI2 T;  1I5L A;  3JCM f;  2FHD A;  5EG2 A;  3CD6 T;  4FM4 B;  4DOW A;  3QYH B;  2M0O A;  4FU6 A;  5GMK l;  4XU1 A;  5GAN j;  2CYZ B;  4MIM A;  2DZ9 A;  1O75 A;  1LNX A;  3F70 A;  2E5Q A;  2RK1 A;  3VYG A;  2VV5 A;  3A8L B;  5GAN h;  2P0Q A;  2EFI A;  4BI3 A;  1BI0 A;  5C0M A;  3VKH A;  4L5G A;  3JCM d;  2XHC A;  4C92 B;  4C5G A;  1VQ5 A;  2DXT A;  2R5M A;  2PVG B;  3G7Z A;  5CCA A;  2LT1 A;  4AKG A;  1I4K 1;  4RG2 A;  2XI9 A;  4C0F A;  5IT9 E;  3HRU A;  2M1H A;  1M5Q 1;  3FLG A;  2HAX A;  2QQS A;  4NC6 A;  2DXC B;  4M7A F;  4EMK C;  4M77 D;  3G4S A;  1RI0 A;  3OS5 A;  3NFC A;  3QJY A;  1Q82 U;  2FL7 A;  3MET A;  2JN0 A;  3X26 B;  3QSU A;  5GAO q;  3QYE A;  2QQR A;  4N4G A;  2RJF A;  4KUL A;  1QVP A;  1O9S A;  5FU6 C;  1ZHI A;  2JOY A;  2VC8 A;  3E9F A;  3PIO A;  1VQ8 A;  4C5H A;  4M7A G;  3JAM E;  4HCB A;  5FRN A;  4BI4 A;  4JX5 A;  1NE8 A;  2GFA A;  1U1T A;  2L3R A;  3X28 B;  3E1S A;  4C8Q C;  3JCM e;  1YJN A;  3HL8 A;  3OW2 A;  4IUU A;  2DEQ A;  2LX9 A;  4OB1 B;  3A8O B;  3LGF A;  4JDS A;  5M9O A;  4HA8 A;  2RJC A;  3Q1J A;  1H3Z A;  2XDD A;  3L2W A;  1X75 C;  3CPW S;  5GAO p;  2O4X A;  5A2Q E;  2L8D A;  4M77 B;  3LLR A;  4BBR M;  4F7U E;  5GAM j;  3PFS A;  2RI2 A;  4XU2 A;  5GAM h;  2XKO C;  1QW1 A;  1G3W A;  1W4S A;  2JTM A;  1D3B B;  1VQM T;  4HNV A;  1JRI A;  4IUP A;  2GQV A;  2MWO A;  4FL6 A;  2YRV A;  3HFN A;  1K8A U;  4C92 F;  4R56 A;  4M7A C;  1NPP A;  2JZ2 A;  3NTH A;  5HK3 A;  4E7J A;  1KC8 C;  3PTA A;  3OYN A;  2EAY A;  4IUT A;  4M78 F;  3JCM J;  3CME A;  4A53 A;  4O5V A;  1WPY A;  5A0D A;  1M1F A;  3L42 A;  4PLL A;  2RA2 A;  5AYF A;  4PL6 A;  3OW2 S;  4C92 G;  5CKF A;  4E7L A;  3FJP A;  3PNW C;  3OQ5 A;  2ZGW A;  1YJW T;  3GIB A;  1QP2 A;  3JB9 H;  3L1A A;  2JTF A;  4M78 G;  4EMK B;  5GMK e;  3OMG A;  1BIA A;  4RG8 A;  3ME9 A;  5C6S A;  2L89 A;  2F69 A;  4RKU E;  2H3J A;  1KQS S;  3BG5 A;  3URG A;  3OS2 A;  1WQW A;  2E12 A;  2EJF A;  2EJG A;  2K57 A;  2M16 A;  1WGS A;  3SD4 A;  4QQD A;  5FU6 B;  4JRQ A;  4M7A D;  1OZ2 A;  4HT9 A;  4NL3 A;  3NTK A;  1M4Z A;  2QF7 A;  3UPU A;  2DVE A;  3JCM g;  3BG9 A;  3JCM X;  3G71 T;  2WJ9 A;  1U1S A;  4D6W A;  5GMK m;  2KDS A;  4C8Q B;  2DIG A;  2K5F A;  3CBP A;  1UGS B;  3BY7 A;  4M77 F;  2DAQ A;  4BB7 A;  3DLM A;  5DLQ E;  2NLU A;  2RH2 A;  4HCZ A;  4M78 C;  3ZEH A;  3JCM Q;  2P4T A;  1Y96 B;  3PT9 A;  4J7I A;  4LDV A;  3G6E A;  1VQ8 T;  4MFD A;  1P92 A;  1X6O A;  2O01 E;  2PQW A;  2OTL A;  3CCM T;  1E7P A;  2CGH A;  3M58 A;  4XTZ A;  2K3X A;  2Y90 A;  4QQG A;  3OBY A;  4MZT A;  1K8A C;  3PGG A;  1M1K C;  3M57 A;  3C12 A;  4M75 E;  1XNI A;  3MP6 A;  3HBL A;  4M7A B;  4OB3 B;  5D6Y A;  4C5E A;  2VXF A;  3VYH B;  1TH7 A;  2XK0 A;  3A8M B;  4QQ6 A;  4CRI A;  4XU0 A;  1VQN T;  3M4G A;  3GPL A;  1M8V A;  1VQ7 T;  4C92 A;  2DD5 B;  4Y91 A;  5I21 A;  4LDY A;  4V2S A;  2XD0 A;  1W2B A;  2QA4 T;  2DTH A;  2LCL A;  3PIP A;  2QDY B;  4C92 D;  3VKG A;  2XDP A;  2YHT A;  4RCB A;  3TCJ A;  5CR2 A;  2X4X A;  3CC2 T;  2ZPG B;  1KD1 C;  4ZGJ B;  1VQ6 A;  1XOV A;  4ZGE B;  3LYI A;  2DXC A;  4M78 D;  1N27 A;  5CK9 A;  3OS0 A;  5GAO l;  3CCU T;  2KY9 A;  4HT8 A;  3A8G B;  3FEO A;  3CCE A;  3MP1 A;  2LDM A;  2LQ8 A;  1IZ6 A;  5J26 A;  3GP8 A;  4ZGD B;  2RI3 A;  3CCJ T;  5CKB A;  2PVD B;  3CCS T;  5GAN 5;  4L6V 5;  3QDR B;  2R5A A;  3M9Q A;  3OMC A;  4JLI A;  1PSE A;  4UC4 A;  1GXI E;  3VV0 A;  3GF5 A;  3I56 A;  2XDB A;  1VQ4 A;  3M4Y A;  4C8Q F;  3CMA A;  2VGM A;  2F5K A;  2V8I A;  3L2U A;  2E70 A;  3J80 E;  3OYA A;  4ELY C;  3FC3 A;  3LH0 A;  1DJ7 B;  2QEX T;  4MML A;  4EMG A;  3V7S A;  2QQ8 A;  4JRK A;  3S6W A;  2R58 A;  1VQ9 A;  3CC7 T;  2XG8 D;  3H6Z A;  1VQO T;  1ZBX A;  3OYL A;  1Q7Y C;  3JCM P;  4HL4 A;  5FU7 C;  1VQP T;  1AHJ B;  2G77 A;  4C8Q G;  2DXB B;  3CXC S;  4M78 B;  4ME7 A;  2QQB A;  3S3O A;  2QXF A;  4J5Y A;  4M77 A;  4KUD K;  5LJ3 f;  2ZZD B;  2MMP A;  3I55 A;  3C4S A;  3V7R A;  4MDX A;  3CPF A;  3CCV A;  3MEW A;  3J7A F;  1VIE A;  1D3B A;  4F7U G;  4NL2 A;  3OS1 A;  5CQX A;  2KMT A;  3JCM h;  4LOC A;  2QDJ A;  4HNU A;  3HP9 A;  5L8R E;  2B8A A;  4EDU A;  5LJ3 d;  2OTJ T;  4XK8 E;  2MF2 A;  2XID A;  3QYG B;  2HD0 A;  3WVD B;  1XQH A;  4MZM A;  3OYB A;  5LL6 S;  1UB4 A;  2Y4X A;  4MFE A;  4Q5W A;  2V8K A;  1EIF A;  2YLC A;  4PJO F;  3C95 A;  1YHQ A;  3CCL A;  2P0K A;  3HSB A;  3X24 B;  1R8O B;  3T9N A;  2ZCF B;  3TRE A;  3BW1 A;  3SDZ A;  4B9W A;  4KUI A;  3TW7 A;  1KHC A;  1YIJ A;  4BBS M;  2YLB A;  5LJ5 f;  1JJ2 A;  1S72 T;  4BY6 C;  4KT0 E;  3WXM B;  4DOV A;  1V29 B;  4EMK A;  2V8J A;  2DD4 B;  4OMF B;  3OYY A;  3SFM A;  2E10 A;  3VU3 C;  5DM7 R;  4YTL A;  4LD6 A;  3SWN C;  5CIU A;  4B9X A;  1YIT A;  4PJO G;  3ASK A;  5GAO r;  1G3S A;  1U8R A;  2RM4 A;  3QHS A;  4JRI A;  4A4E A;  4ZN1 A;  5GMK i;  4LD9 K;  3M53 A;  2PU9 B;  5LJ5 d;  4OGE A;  2DXU A;  3E9G A;  3FIF A;  3A5Z B;  3N5B B;  1JB0 E;  4FT2 A;  3VKI A;  3VUB A;  1KC8 U;  4AKH A;  2QI2 A;  4MZP A;  1BKB A;  4QSH A;  1BI1 A;  3PMT A;  5GMK j;  5LJ3 e;  1M90 U;  1M90 C;  1BI3 A;  5GAN 3;  2HBP A;  4BDZ A;  1VQK T;  3CCE T;  3X20 B;  3RES A;  4E7I A;  3JRZ A;  3HHT B;  1OYX A;  3ZBD A;  3OB9 A;  4BAC A;  1N9R A;  4C8Q D;  5FU7 B;  2LVM A;  2RD1 A;  1FWZ A;  2DPP B;  4IUQ A;  5CKE A;  3KXT A;  4JJN K;  1YJ9 A;  1SSF A;  3FDR A;  2RHX A;  2LQK A;  1VQ4 T;  3P8D A;  2GCX A;  2E1H A;  3MO8 A;  1MGQ A;  2LTO A;  5KE3 A;  4J83 A;  1NJI C;  2BKD N;  1NJI U;  2HNI A;  1VQL A;  4PJO C;  3X25 B;  2DTO A;  1WQ7 A;  3R6O A;  2GF7 A;  4JUV A;  5HKC A;  5EJC A;  2BIV A;  3L2Z A;  3P8B B;  4OP0 A;  3CC4 A;  4M7A E;  1VQ5 T;  1QP3 A;  2WSE E;  4KBM B;  4LDW A;  5D6X A;  4M7A A;  2BS4 A;  3LX7 A;  5GAO m;  4QVD A;  4EPC A;  4N0A C;  2HQX A;  5LJ5 e;  3OYD A;  4M7D F;  2L5Q A;  1WJR A;  3CEY A;  4PLI A;  4M75 G;  5CVI A;  5FRO A;  3OY9 A;  2DO3 A;  1YI2 A;  2C06 A;  2VXE A;  3CD6 A;  4IKF A;  3G4S T;  5CKD A;  4X34 A;  1UGP B;  1K73 C;  3QZ9 B;  2EQM A;  2XIC A;  4XU3 A;  4BD3 A;  2LRQ A;  1K73 U;  3CCR A;  4FSX A;  4J6X A;  3HPW A;  5GAN 7;  1KHI A;  3NTI A;  4M7D G;  4ZTF A;  4M6V A;  3PMI A;  4BY6 B;  4XAX B;  4QW2 A;  3QJ6 A;  4BDY A;  3EAE A;  4F7U B;  4PJO D;  4A4K A;  5D6W A;  4GY5 A;  3SWN B;  3M55 A;  1BYM A;  1BI2 A;  1MHN A;  2I2L A;  4IUR A;  4C0D C;  4DA4 A;  1Q81 C;  1YJN T;  4GLK A;  1Q81 U;  1KQ2 A;  1M1K U;  4E47 A;  5LJ3 g;  4M75 C;  4ELJ A;  3QG1 A;  5GAN 4;  4OB2 B;  3OBW A;  1YIJ T;  4C92 E;  3HB9 A;  1HXD A;  5A0G A;  3V7C A;  4ELZ C;  4R55 A;  3HRT A;  4X9C A;  4XTV A;  2DTI A;  3JB9 J;  2RO0 A;  3H4C A;  4BI8 B;  2D0Q B;  2WSC E;  1UEB A;  2LNV A;  1QVG A;  4JX4 A;  3HFO A;  3P8H A;  4M78 E;  4M7D C;  4AKI A;  3QWL A;  4O6J A;  4M78 A;  2D6F A;  2RJE A;  1KD1 U;  3CME T;  1YBY A;  2CS7 A;  3UWN A;  3VJP A;  3HZJ A;  2GFU A;  3BG3 A;  3OYK A;  3CBO A;  4PJO B;  3HO8 A;  5GAO n;  5I2S A;  2KAF A;  4A4F A;  1LJO A;  2X4Y A;  2EJ9 A;  2ZPE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...