2AHJB

Nitrile hydratase complexed with nitric oxide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel non-heme iron center of nitrile hydratase with a claw setting of oxygen atoms.
pubmed doi rcsb
molecule tags Lyase
molecule keywords NITRILE HYDRATASE
total genus 55
structure length 211
sequence length 211
chains with identical sequence D
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 1997-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2ahjB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ahjB02
2ZCFB 2DXBA 2ZPBB 1UGRB 3LW5E 1UGQB 2ZPEB 1PSFA 2PUKB 2WSCE 3VYGB 2CZ7B 4FM4B 2PVDB 1V29B 3QYHB 2ZZDA 1PSEA 3A8LB 4ZGJB 2DD4A 2PU9B 2ZPFB 2ZZDB 1QP3A 4ZGDB 3VYGA 3WVEB 2WSFE 4XK8E 2DXCA 4L6V5 4OB1B 2PVGB 2DD5A 3VYHB 3QYGB 2DD5B 2DPPB 4RKUE 1QP2A 1GXIE 1IREB 3QZ9B 1UGPB 2CZ0B 1UGSB 2QDYB 2PUOB 2ZPGB 2O01E 3X28B 3QZ5B 2D0QB 2DXCB 4OB3B 4OB2B 3HHTB 2ZPHB 2ZPIB 3X24B 3WVDB 4ZGEB 3A8GB 1DJ7B 5L8RE 3X20B 2CYZB 2CZ1B 3X26B 1JB0E 1AHJB 4OB0B 3A8HB 3X25B 4Y28E 3QXEB 2DD4B 2DXBB 2AHJB 2CZ6B 3A8OB 2WSEE 2PVOB 4KT0E 3A8MB
chains in the Genus database with same CATH superfamily
1MMAA 2LX9A 1SRLA 3D7SB 5KYWB 2ZPBB 2QQAA 3Q1JA 2F2XA 3C0CA 4KRTA 2XG8D 3JRZA 3C95A 1TUCA 1BU2A 3PO3S 4C92C 3DDQB 2L3SA 2I2LA 4PL6A 3OS1A 3EGXA 2DVEA 4BE1A 1C0MA 4IUVA 2DMEA 2CP2A 5CKFA 2EWNA 4F70B 2G9XB 1W2BA 4EIKA 4OMLA 3EG3A 3MEUA 4A63B 2ZAEA 5LJ5f 1RLQC 2WIHB 3VKHA 4KBMB 1G2BA 5DM7R 4MIMA 4Z6YA 2V8JA 2DXCA 1H4LD 2CT4A 1OYXA 5A0LA 4HNUA 4YOOA 3OMGA 5LJ5g 2LQNA 1O9KA 1SPKA 1OU9A 3F5XB 4HCKA 2W2HA 1MMGA 1M1KR 4GLMA 3CPFA 2JN0A 4BY6C 1VQ4Q 1M3AA 5LJ5h 3QYEA 2DL4A 1B34A 2AZVA 2FO0A 3E2UA 3PNWC 3ER0A 5CQYA 2BS2A 1KD1C 3I56Q 3EFOA 4F7UA 1OIYB 4DA4A 4J9BA 3CBPA 3VS4A 4HXJA 3OBWA 1KIKA 1KQSS 2FRYA 3HHTB 1XTDA 1NG2A 1FKMA 1OL1B 3WVDB 2GFUA 2RD1A 3A8GB 1R0BG 4M7AE 4OR5B 4CFVB 5KYXA 2LP5A 3H0HA 4M7DC 5DQWA 5CO7A 4E7HA 5CCAA 1VQPQ 3H0IA 1KXUA 4BCKB 2PK9B 2F69A 1YJWQ 2RK2A 1G83A 2MWPA 1M1GA 2QYZA 4RUGA 3CCJA 3CCLQ 1M2VA 2DXBA 4Z02A 4XTYA 3FC3A 3PT9A 4JDSA 4EOSB 4BACA 4PFZA 3CXCA 2GGRA 5D6WA 2PUKB 2QF7A 1BIBA 4B9WA 4BE2A 3M59A 2OAWA 3V8LA 3MP6A 3CPWP 1RL2A 5L23A 4EMKA 1D1AA 4NSTB 3NFCA 4X9CA 2H8HA 1UECA 2LCLA 1A0NB 2SRCA 2YUOA 1QMZB 4EOLB 2WSFE 1VYTA 3LGFA 3M55A 4C92F 2QTVA 2NYSA 1OKWB 4PJNA 5CQXA 3JCMJ 1YNZA 3VS2A 1RAFB 2V26A 1WXBA 2M0YA 1WX6A 2PJQA 1VQ8T 3QWYA 3CCST 3EHRA 2UZLB 3JCMe 1PD0A 4FX3B 3HL8A 3CMEA 3QDFA 2MK5A 2YLBA 4CFMB 4EOKB 2AIRB 3CXCS 4BCOB 2G6FX 5DLQE 1LVKA 2E6NA 5GANe 4P5NA 5LJ5e 1UGSB 4EOIB 4M7DD 1VQMQ 3MI9B 2PUOB 4BCHB 2RQVA 1M5Q1 1S72T 5KCOA 4BDYA 2C0OA 3QZ5B 1EFNA 1P5EB 1H641 4M7AF 1VYUA 2YLCA 1YJ9T 3UA6A 2BZYA 3M0QA 4BY7X 2DO3A 1UJ0A 3L2UA 3VV0A 1U8RA 2XKOC 3SDZA 3LYIA 3VUBA 3H9NA 4FU6A 2Y4XA 4Z89A 1ABQA 1AHJB 2XICA 2DF6A 1MV0B 3MIAB 1E9HB 3EFSA 4HCCA 1AD5A 4HNVA 1AISB 4G6LB 2UZDB 3LW5E 4CXAB 3JCMb 1KQSP 5FRMA 2V8IA 2J6FA 4RODA 5LJ3d 2DILA 2EGEA 3RERA 4C8QC 1PHTA 2E65A 2FRWA 4F04B 5GAMg 4JS4A 3FB9A 4HVUA 3VUZA 1PSEA 4MFEA 1R77A 1WXTA 3TW7A 4KH1B 2DX1A 2R7GA 2DJZA 1ZSZA 2CS7A 2KXDA 2XHCA 5GAOp 2QI2A 3GPLA 1VQ9T 2FPDA 2KQWA 4C92D 4Y92A 1M4ZA 1BIAA 2HQEA 3BDUA 1VQ6Q 5IDPB 2DL3A 1VQ5Q 2CP5A 4X9DA 2C0TA 5KYNA 4JUVA 1Q86C 1BCOA 3BLHB 1QP2A 1VQKQ 3SEMA 3CCLT 2RJCA 4ROEA 4CRLB 1PC0A 2FPEA 2RMOA 1OGUB 5DQVA 4M77E 4M77G 4M7DG 2CREA 3BG9A 3ZFJA 3JCMg 5GMKh 4OP0A 1Q82C 1QVGS 2K6DA 3CCMT 4FW1A 4BCQD 2HL3A 2LT1A 3CC7A 2AT1B 2L0AA 5L8RE 2CYZB 1UNGD 1XJWB 2OJ2A 2R57A 2IVXA 4PLIA 2K2MA 4MDXA 3OYLA 4XTWA 4BI8B 3G7ZA 3RDVA 3CBMA 4QVCA 4ELLA 3M54A 1PCXA 2W9ZA 1Q86U 4LDVA 3NDQA 2RA2A 1OOTA 2FZGB 3ZBDA 4NC6A 3CCMA 4JRIA 1SHGA 4A4HA 3QHWB 4EORB 3CCSQ 2PVDB 4LDXA 5GMKe 3UATA 2K5FA 1K9MU 3EHQA 2P0QA 1QVGA 5BNJB 3G6EA 3SB2A 1VQMA 2AKKA 3MPUB 5HK0A 1D0ZA 1Z9QA 4PJMA 4K11A 3MCAB 1IO6A 3PMTA 2EAYA 2OTJT 1H24B 4DBHA 1NYGA 3FEOA 4L59A 4DOWA 1VQLA 2JTMA 2W10A 1K76A 4JRPA 2XI9A 2DAQA 4M75F 2RI2A 1JXMA 1K8AR 3QJYA 1M8VA 2O9SA 1VQ9A 2EJFA 1H1QB 1OI9B 1QW1A 5KYWA 1T3LA 2IG0A 2QEXQ 2CP0A 5KYUA 3H0FA 3HO8A 2UUEB 3OYBA 1VQNT 3HPWA 3RMSA 2M02A 1UB4A 3O5ZA 2UZEB 4CC2A 2G77A 2OTJA 2YUQA 3JB9I 2D0QB 1BK2A 2EYZA 1WDXA 2KEAA 3HFNA 5HK3A 1E7PA 1K9AA 1O75A 2ZPHB 2J6OA 3X24B 5FW9A 1M90R 4A4GA 1O9KB 3OYIA 2IW8B 2LC4A 2LMJA 4AMCA 3OW2A 2CZ1B 3DOGB 2KMTA 4QVDA 3EG2A 5FU6C 3INZA 1WXUA 4OB0B 3M0SA 1Y0MA 1M2VB 4C5GA 3MY1B 1H1SB 2HEQA 2F5TX 4DBFA 4C0FA 3HSBA 4CFUB 4J9HA 4C8QG 2ESWA 3L42A 1IRXA 5IHIA 4MZTA 3RIRA 1YHQA 2JVVA 3EG0A 1VQ8Q 1FX7A 3H4CA 4J9GA 2LQWA 4HCBA 5CKEA 5LMKB 1KC8R 4M77B 4O6JA 2KR6A 5ECAA 1KD1R 4GBQA 2DL8A 1OX9A 4ESRA 4LUEA 3EOCB 2JW4A 1QVFP 2KY9A 1RAEB 2PZ1A 5GJWB 1VQ7T 4ATOA 2DEUA 1W6XA 3C4SA 3M0RA 1VQ8A 5I22A 4LDYA 3JCMW 2KGTA 3QHSA 3V8JA 4AFQC 1N4MA 3L1AA 3UDCA 1EZZB 2KDSA 4PK4A 4XTVA 1PM3A 2FHDA 5A2QE 3VYGA 1MNEA 3CBOA 2M16A 2KXCA 2RJEA 2KYMA 3RUXA 3I55T 3OQ5A 3OSSC 4Y91A 2RM4A 2VUBA 2KBTA 5L2WB 2F2VA 4XU2A 2KROA 4F7UB 1C1AA 4CI0C 1P92A 2O2OA 3IQLA 3TSWA 4XU1A 1LCKA 1ZA1B 3C94A 4WTOB 3JB9D 3JCMV 1N8RC 4J9IA 2LCSA 1HXDA 3QZ9B 1YJNA 4R55A 5GMKm 4PJOD 2C4GB 2PHGA 2HNIA 5HBJB 2MPXC 2CSQA 3SD4A 4XAXB 1IB8A 4M78C 3DLLA 2GTJA 5GAN8 4IMYB 1M1FA 4EC8B 2DYBA 1PKSA 2OTLQ 3POMA 1U5SA 2DVJA 4PJOA 1QVGP 3BHVB 4OMNA 1QCOA 2YUPA 5LJ3e 1VQ9Q 4QSHA 2HDAA 4OVAA 3TW6A 1GCQA 3M57A 3T9NA 1JOWA 4BCIB 4IURA 2HSPA 5DY9A 4AI6A 4J83A 1TUGB 4FT4A 4BI3A 2BZ8A 2E3HA 5LJ3h 1IZ6A 2B8AA 4N4IA 3NGPA 4C0DC 2YXYA 3JV3A 3OYEA 1H92A 2C06A 1H28B 2X3XD 3R6NA 4BD3A 1K73R 2HD0A 4EDUA 2LT4A 1QLYA 1TU0B 4JS5A 3META 3RESA 4EMGA 2VB6A 3ME9A 4KULA 1YJNQ 2LTOA 3CCMQ 1WJRA 1GY3B 3QG1A 1TSFA 1TG0A 4HKEA 2DKGA 2AKLA 2EYYA 4R0KA 2RK1A 1ZLMA 2X4JA 2KVQG 1YJ9Q 3EG9A 3RNJA 3FIFA 3HB9A 2DFUA 1NEBA 1VQOA 5GAOl 3EJ1B 2YWWA 2BS3A 5HQ0B 3HKSA 4NOYA 3QO3A 3SWNB 3CC4T 2M1HA 2A08A 3JB9F 2QFZA 4F6SB 5HBHB 5FU7B 4HNTA 4EPCA 4BB7A 4M75E 1GXIE 1KHCA 4OMPA 4LNPA 4YOSA 3JAME 5LJ5j 1U1TA 1Q82U 4HT9A 4A4FA 2X51A 5I2SA 4IUTA 2DTHA 5KYUB 2BE9B 3I55A 1O9SA 4M77F 1Q7YR 4HT8A 1KK7A 2I53A 4J9FA 5FU6B 1H1PB 2A3LA 1URCB 2V8KA 3NHNA 2W96A 1ZA2B 2HQHA 1YJNT 4RTUA 1MHNA 3LGLA 3X26B 1JB0E 2JUFA 7AT1B 4CC7A 1OKVB 4F7JB 2KSSA 1ABOA 3EGUA 2RHYA 1QKXA 1KQ2A 1OULA 4CRIA 2JNGA 1NJIC 3QSUA 1W4SA 3SWNA 2AHJB 3M0TA 4LN2A 1AZGB 4LOCA 2F2WA 5KYYA 1M90C 1HD3A 1FMVA 3MJXA 4C0DB 3MKDA 4LUDA 3CC2Q 1WHJA 2HAXA 5FWCA 2XD0A 3QWLA 1K8AC 3M9QA 4BBRM 4M75G 4M7DB 1D09B 2CZ7B 4FM4B 1C9BA 1B7TA 1VQ5T 4M4ZA 4KH0B 4DQ2A 4RCCA 2L8DA 2QTXA 4E7KA 3M4YA 4X34A 5KYYB 1OL2B 2JT4A 1GBRA 2HQXA 2PU9B 2RI5A 2P84A 3VS3A 2K5IA 1VQ7Q 2E6ZA 3VRZA 3CQTA 1JRIA 1YN8A 3FRNA 5GAMf 3C12A 4O5VA 1RI0A 1QKWA 1HJDA 3V7CA 2Y4YA 2EPDA 2OI3A 1W98B 1EIFA 1S72A 1G3WA 4ME7A 2C5NB 2Z0WA 3EG1A 4E7SA 1VOMA 5FU7C 1OPLA 2W9FA 1C6VX 3OA6A 3FLGA 3KHIA 2BPMB 2CCIB 2HKNA 4M77D 4M7AD 4N4GA 3OYHA 3A5ZB 2MF2A 5M9OA 2F1LA 1X69A 4M78A 2P4TA 3M56A 4L5GA 4FYXB 2LW4A 4OB3B 3PIOA 3QJ6A 4C92A 4F6WB 2DETA 1FINB 1Y96B 4PJJA 2O31A 1WHGA 1OPKA 1G5VA 3DJBA 3GP8A 3A8HB 3CC2A 3X25B 1JXOA 1JJ2A 1K0XA 1RAAB 3HFOA 2FVUA 2YDLA 5CAIA 3M58A 5LJ3f 1KD1U 1TD6A 4NS5A 1NM7A 2WHBB 2LDMA 3A8MB 1BYMA 2ZCFB 4QQ6A 2IIMA 2JTEA 4AT1B 3OYYA 2HSEB 1VQLT 1W2BS 2FG0A 5J26A 2AK5A 2J7IA 4M78B 6AT1B 2KRSA 4IUPA 1H3ZA 2ZPEB 4C92B 3E9FA 1T0JA 2IW6B 3ZL7C 3GNGA 2L3RA 3VS5A 4TVRA 3RR6A 2QEXT 4E47A 3EH2A 1K9MR 2O9VA 4BXXX 2QA4T 3BDLA 4GLKA 3CEYA 1ZSGA 5D6XA 2E64A 1F1BB 3CCRT 2CP3A 8ATCB 3OYGA 4EOOB 2PTKA 4Q5WA 4DBQA 1YHQT 2RHUA 1ZX6A 4LE9A 1K73C 1NLPC 1UEBA 3CCLA 4ZGDB 1AWOA 3WVEB 1I0CA 4AG1C 4M77A 2GQIA 5GAN4 3JB9G 4C8QB 2HZYA 3KXTA 4A4EA 2RQWA 1Q81U 3S3MA 4N0AA 1VQ6A 2B86A 2DK3A 2A28A 4M78E 2GTOA 3M4GA 2ECZA 2E1HA 3QHRB 1J3TA 2QA4A 5J39A 4J7IA 2QGSA 4PLLA 3SHWA 2KI7A 1XOVA 1YI2T 4J9DA 1ZBXA 5C0MA 1KC8C 1YJWT 1NEGA 2QK0A 2K5LA 5GAN5 2ZPGB 1Y7XA 4JJNK 3DB3A 3S6WA 1AWWA 1OZ2A 2XDBA 4C8QF 2LRQA 4EMHA 2JM9A 5J3BA 3SFMA 2QDLA 3R6OA 2R5MA 4XU0A 4C5IA 1OZ3A 1VINA 3CCVT 2VASA 2L89A 4KRDB 1WPYA 2EQUA 2L2PA 2EJ9A 2OAUA 1H3HA 2R58A 4Y28E 1B07A 3NTHA 2RH2A 2XDPA 4RG2A 1YCSB 4Z88A 5I5ZB 4FSSA 3TSZA 2WFYB 1VQLQ 4KRCB 2DYIA 1WGSA 2F5KA 1NPRA 1D3UB 2H3EB 1WFWA 3PE0A 1KC8U 4J6YA 2JS0A 2C5VB 4NL2A 2D8HA 1X01A 2F2CA 2QGFB 4N4HA 1R8OB 2XIDA 2DNUA 2WEVB 1ACMB 5GAOr 1N9SA 1UFFA 3K7AM 5ACBA 1SHFA 2MOXA 4B6MA 2ZZDA 3SWNC 4M7AC 1JU5C 4M77C 1BI0A 5A0GA 4CFWB 2CDTA 4AKGA 3LX7A 1Q81C 1SF9A 2KK4A 4HVVA 2J06A 1T3SA 2I0NA 4M75D 3CPWA 3L2WA 1PKDB 5CKDA 3REAB 1YWPA 3LH0A 1S72Q 2K7AA 5GANj 1K73U 1GUXA 2KE9A 1RI9A 1VQNA 1IHVA 2BZXA 1MUZA 1GCQC 2LQKA 1WYXA 4DBRA 4QW2A 4PNOA 4F7UE 1UGVA 1YI2Q 2PK2A 1ZUUA 1KHIA 2QQ9A 2IW9B 3ASKA 2M9UA 4M7AB 1ENWA 1NBEB 1WQWA 5FWBA 4RG8A 3CD6A 3LWIA 2K3BA 1TTHB 4LXCA 4YC3B 4PKCC 2FB7A 4RCBA 2HBWA 1Z9ZA 4YTLA 4OGCA 4OB2B 1BU1A 3FJ5A 1U06A 1KSWA 2NUPA 1DJ7B 2COWA 1ZSZB 1JJ2P 5GAN2 4KUIA 2JMAA 3FJPA 1VOLA 2DM1A 3CCVQ 3OS5A 2K79A 4RTWA 1R0CB 1VQ5A 4MDWA 1S1NA 4MMLA 2DL5A 3VS0A 1N8RU 3CMAT 2EYQA 2VXFA 3G71Q 1M3CA 4D8DA 1TH7A 1VQOQ 3TNWB 1QVFA 4E7ZA 3CCVA 4F7UG 2EVRA 1I81A 2I40B 2EQJA 3MP8A 4FT2A 5GAMe 4C0GA 2WSCE 1UG1A 4XTZA 3L2RA 4CFXB 1VQPT 4QKUA 3JB9J 3BLRB 1N9RA 1V29B 2ATCB 4DEYA 3OMCA 2NWMA 3GOXA 4EOQB 3A8LB 3O0GD 3TQ7P 4FW2A 2IVWA 3TREA 2DXUA 2EJGA 2JTFA 4OMMA 3TEEA 4PFOA 3CPWS 5LJ5d 2K3YA 4A54A 2ZPFB 1AWXA 1V76A 2EGAA 3TU4K 3TVTA 4HL4A 1GFCA 4BUGA 4RTYA 3KFVA 4OB1B 1YBYA 5FGKB 5D7UA 1D1CA 2VKNA 4IIMA 4RMOA 1VA7A 3BHUB 4FIBA 2HKQB 4JZ3A 5KH6A 2DD5B 1QVFS 3QDRB 3S3OA 1B3QA 1IREB 3LH5A 2EW3A 1LNXA 1Q95G 4EC9B 1G3YA 3G1JA 4J6WA 2GBQA 1E6GA 2VGNA 3X28B 3CC2T 3H41A 1X43A 4M75A 4FYWB 1Y57A 1KQSA 1TWBA 2A7YA 3JSCA 3MHXA 1NYFA 3LQ5B 4PJOG 2A37A 1N8RR 2LJ0A 4BY1X 5GAMd 2RI3A 1AOJA 3OW2S 4NL3A 3OYKA 1LOJA 2K57A 2DBMA 3GIBA 1SEMA 2DEQA 1JJ2S 3JCMc 5HVYB 2ED1A 2KYBA 2KAFA 4KGXB 4BCNB 3CC7T 5ICPB 4ELYC 1OI1A 3CCRA 4M7AG 3OYJA 3WXMB 1Y96A 2YUNA 2R5AA 3EFOB 3VYGB 4D6WA 2JS2A 4EMKB 1SSHA 1UE9A 1WJSA 1MMNA 1RACB 1H26B 1VQ6T 4PJOF 1RADB 3BLQB 3JCMf 2PNIA 1AVZC 2QQ8A 4OMFB 2EQIA 3CCQA 3EGXB 2KRMA 3TNIB 2BUDA 5A0DA 3JB9H 2ZZDB 3OYMA 1W70A 2HL5C 3I35A 5GANf 3CMET 2X35A 1SG5A 5EJCA 2E10A 1GFDA 3HP9A 5LJ3j 3AHUA 1UTIA 1D1BA 3M0UA 1YJWA 1YHQQ 3VRYA 2HMAA 4J6XA 2CCHB 2CJMB 3OSVA 4E7LA 2DJQA 1ARKA 2LZ6B 3HRSA 4F6UB 1OV3A 1ZHIA 2HCKA 4RTVA 4M78G 3J80E 4XQ3A 2E4HA 4C92E 2ROTA 1JSTB 2DRKA 4C92G 3M03A 2KRNA 4ANJA 5HKCA 4RTXA 3GNFB 4JJCA 4MZPA 4QQGA 3J7AF 2O01E 1VIFA 1LPLA 1FMWA 3BW1A 2QASA 3OY9A 3NTKA 3CD6Q 4DOVA 1CKAA 1HSQA 3HRTA 4C8QE 1ZUYA 2LNVA 1T0HA 3G4ST 4Z8AA 1VQ4A 1M27C 2V1QA 3EIDB 3RKXA 5HY6A 5CEIB 1K0SA 1TUDA 1H1RB 3BG3A 1PRMC 4MZMA 3CCEA 1QWFA 3TN8B 1CKBA 2JGZB 1KFZA 1VIEA 2DD4B 2J6KA 1U1SA 4JJDA 1JEGA 1QVPA 3V8KA 3MP1A 1Q86R 2MMPA 3FDRA 3HZJA 1AEYA 2CP6A 2PMIB 3URGA 3RKYA 1NJIU 1QWEA 4QT7A 2NUZA 5LQFB 4QQDA 2EQKA 2KNBB 3G71T 1KQ1A 2YRCA 1TS9A 1WIEA 3GBQA 4E6RA 2XDDA 2SEMA 4ELJA 3MEVA 2RN8A 2MAMA 4FCYA 2A36A 2DD4A 3JCMQ 2BS4A 4LDWA 4IUQA 3BY7A 4JLGA 4FL6A 5IT9E 4LD9K 2COZA 2LJ3A 1WHLA 2YSQA 4BCMB 2RJDA 3CMEQ 1SKUB 2ABLA 3O8VA 3OB9A 5IAYA 3VS6A 2VYTA 5CR2A 1WHMA 1BKBA 3PGGA 3EH1A 2PVGB 1GRIA 3VU3C 1W2BP 1VQ7A 4C8QA 2DERA 4OMQA 1TOVA 1UNLD 2JZ2A 2LQ8A 3M53A 2QAZA 4CC4B 1UNHD 4WF2A 4RKUE 1VYWB 2RF0A 1ZUKA 2CGHA 2VGMA 1WNLA 2L3PA 2RB6A 5GAOn 2QQSA 1WA7A 2FZKB 1ZSZC 5FROA 3VJPA 2W99A 3AT1B 1SRMA 2V1RA 3EFRA 4CFUD 1M90U 3REBB 1PD1A 1K4US 1JQQA 4ZTFA 5I11A 2BIVA 1WHKA 2WJ9A 1N27A 2X9HA 1K9MC 2EIFA 3L2ZA 4II5B 4JLIA 1IGQA 4AFSC 5IDNB 1M8MA 3CCJT 5AT1B 2DRMA 2EQMA 2A0FB 3BHTB 1Y07A 3P8HA 1QCNA 3DB4A 4F7UF 4BCMD 1BI2A 1GUXB 2OTLT 4PFPA 2RJFA 3OW2P 5CKBA 1JO8A 2JOYA 4OMOA 1X2KA 2KR3A 1OEBA 2RQUA 4F7LB 2PVOB 4LDUA 1UDLA 3MO8A 4HVWA 3QKJA 3ZEHA 2RHXA 3JCMX 3OYNA 1VQMT 5LL6S 2QDJA 4E7JA 1AD6A 2D8JA 1F5QB 3UPUA 5IHYA 2DZCA 4XTXA 3MY5B 5D6YA 4EOMB 3CMAQ 3OYFA 2XMFA 2DIGA 3PFSA 4AKHA 4EOJB 3RKWA 1M9SA 3CXCP 2VXEA 2L3QA 5I2MA 2O4XB 2WMAB 2QQRA 3RBBB 1SSFA 4WCIA 1D0YA 2MYSA 4ZGJB 2BTTA 3I55Q 9ATCB 1BB9A 1PG5B 3KBGA 1N5ZA 3UT1A 1WHHA 1ZP2A 3I56A 3CD6T 2RPNA 3A98A 1QP3A 2K9GA 5EG2A 2GNCA 2Y90A 1RUWA 2GCXA 1XNIA 4TTHA 5GMKj 4XK8E 3CCRQ 2WMBB 4L6V5 5GAMj 1GBQA 2YRVA 4F14A 4BCQB 4V2SA 2YRDA 3MEAA 1RAHB 1CSKA 1KG1A 3P8DA 5AYFA 4C5HA 1NE8A 2ENMA 4JRQA 5GAOm 1E7OA 4F7SB 2DPPB 2RNAA 1OQKA 1X75C 3CCQQ 1I07A 1YJ9A 4IKFA 1FXXA 4HCZA 1UJYA 2E5QA 4J9CA 4JRKA 3OS0A 2DTIA 2OTJQ 2FYKA 2D1XA 4M7AA 3GF5A 3V7SA 4BCFB 1VQOT 2NUTA 2DBKA 4M7DF 4C8QD 3DTOA 4IIOA 1QMCA 5GAMh 2OX7A 1MMDA 2M0OA 1D3BA 4OGEA 3QIIA 2JM8A 3JCMd 1GH6B 1RABB 1BI1A 1W1FA 3OS2A 3EGDB 2E5KA 1RAIB 3E19A 2CP7A 2RO0A 2K2VA 4OF1A 3F70A 4HA8A 4M78F 4KGZB 5IHKA 5LJ3g 2KMGA 3DDPB 4EONB 2DXBB 2QQBA 2FPFA 4B9XA 5KE2A 2CZ6B 3A8OB 5KYXB 3LWHA 2BKDN 3HRUA 1X6GA 3RMQA 4BCGB 1NZ9A 1YIJT 2HBPA 1QQJA 4RTZA 1UGRB 3CCUT 1YITT 2EKOA 4ZNXA 3G6EQ 3QBYA 3EGDA 2D0NA 2LVMA 3NPFA 1PSFA 3G4SA 2OTLA 2WIPB 2VVKA 4LD6A 3PVLA 1QLBA 2MIOA 5IN1A 4GY5A 1JSUB 4J8OA 4YOZA 4M6VA 4N0AC 4E2FB 2E41A 3QYHB 2GQVA 5HBEB 3PIPA 4JX5A 3CC4Q 2GF7A 1TXQA 2W0ZA 4ZN3A 4BE0A 1M1KU 2JJ9A 5IXFA 4ROCA 1AT1B 2EFIA 1B34B 5GANd 1WLPB 1NPPA 2D9TA 4E7IA 3CCUA 1YITA 2BKZB 2B9RA 3PTAA 4R56A 1YFNA 2X4WA 1WI7A 5GAN6 3G71A 1RLPC 2EGCA 2NLUA 1MNDA 4J7FA 3CCEQ 4AKIA 2IN3A 2C6TB 2XU8A 3M0PA 3VYHB 3JCMh 1IXDA 2C5OB 2XK0A 4PJOE 4BCPB 4KGVB 2LNHB 3GLXA 3CC7Q 4M75B 5HNBB 1FMKA 1N6AA 3N5BB 1YCYA 1UGPB 2CZ0B 2K4YA 5GAOq 5CK9A 4I3ZB 4AFUC 1WJQA 3THKA 4X1VA 3UA7A 1G3TA 2O88A 1I8FA 1G3NC 1QCFA 2DXCB 3MEWA 2CH4W 5IHNA 3TCJA 1I4K1 2FZCB 1VQKA 1Q7YU 1KJWA 2RQTA 2L5QA 3DKMA 2ROLA 4Y72B 3E9GA 5GANh 5CKHA 1XQHA 1YWOA 1YIJA 2VWFA 4JX4A 3QXEB 4ZTJA 1YI2A 2RHIA 2DTOA 2CUBA 3QWXX 1HK9A 2CUDA 1X6OA 2WSEE 2COYA 2MWOA 3CCUQ 1YITQ 1I5LA 4AFZC 3QPHA 3UF4A 2D6FA 2QG9B 3EAEA 1X27A 1VQ4T 1UGQB 2DA9A 3S3NA 2X4XA 3RGFB 3G6ET 2QXFA 3I5SA 5EFQB 5KE3A 4M75C 4F17A 2GFAA 4BCJB 4FSXA 2DE0X 1K1ZA 2DLPA 4BDZA 4KUDK 2J05A 5FLXE 4F7NB 3CC4A 2CKKA 2M51A 3I9QA 2YT6A 2DL7A 2E70A 3H8ZA 5HCKA 3BG5A 2BE7D 1PWTA 1M1KC 3QUIA 2P4RA 1OIUB 1NJIR 4PJOB 3G4SQ 4A4KA 4J9EA 2DMOA 2KT1A 3VKIA 4ELZC 2CT3A 2LCCA 1VQNQ 4CFNB 3UWNA 1E6HA 4PJLA 3V7RA 5GANg 4A53A 4II1A 1BI3A 3CCET 3H6ZA 1BCMA 2KT8A 3QYGB 2C0IA 1M30A 2MI6A 4FYVB 3M5AA 3OYAA 2P0PA 2V22B 1MGQA 1OU8A 1MV3A 2DZ9A 2C5XB 2EKHA 4FYYB 2VV5A 3LLRA 2WXVB 2PQWA 1OX8A 4D8KA 2NUPB 3ULRB 1H27B 3BFMA 1AZEA 4OGRB 3A1PA 2MCNA 4ZGEB 5CVIA 3DLMA 1BBZA 4CC3A 1WZOA 3CCSA 5CIUA 2NUTB 1WQ7A 3OYCA 1G8XA 5I21A 3U23A 1H25B 1D0XA 1D3BB 2CSIA 1FWZA 2JXBA 2QA4Q 2X4YA 3P8BB 1ZQ1A 2QGGA 4DEXA 4JX6A 4UC4A 3QYBA 4BCND 1JBMA 3G33B 4EMKC 1GL5A 4KT0E 2WPAB 1VQKT 2E12A 5GMKl 5CYIB 3HBLA 1VYVA 1PNJA 3I56T 1X2QA 8AT1B 1V1CA 3L2VA 4JPBW 2UZBB 3VS1A 1LJOA 2EUFA 2LJ1A 1IHWA 3E1SA 3L2QA 3CCQT 1YP5A 2O4XA 4IUUA 1YIJQ 1H8KA 4ORZA 3NTIA 1M2OA 4BY6B 4ZN1A 2EYWA 4MFDA 4JJBA 3I5RA 3KUFA 5FRNA 1Q7YC 1Q82R 1G3SA 2P0KA 4BBSM 1Y71A 4XU3A 2IPOB 1I5OB 2X3WD 1I1JA 5GJVB 4HLQA 1VUBA 1UHFA 4RTTA 2YHTA 4M78D 5C6SA 1X6BA 3CMAA 2EYXA 4PJOC 2H3JA 4JZ4A 5IH2A 1U3OA 3CCJQ 1XO2A 5EC7A 4UN0A 1FVVB 5GMKi 1TFBA 1FYNA 2RHZA 5IXBA 1K8AU 1VQPA 2DD5A 2FEIA 3GTMS 5KCHA 4MMKA 3JCMP 3VS7A 4XTUA 1JKWA 1M3BA 1UUEA 4VUBA 2E3IA 2VC8A 2X1NB 1GCPA 1ZBJA 3OBYA 3TNHB 3OYDA 4EOPB 1AWJA 2CH4A 5DLOA 2QDYB 3EG9B 4M7DE 1HYOA 1EX4A 2FL7A 2G3RA 2DIQA 5GAN7 4QVZA 3HTRA 1PKTA 2ED0A 2RQRA 2DXTA 2ZGWA 4BI4A 3PMIA 4F16A 2ZPIB 1PRLC 3VKGA 3J81E 5IF1B 2LX7A 4M7DA 4C5EA 2K3XA 1IGUA 4AG2C 3X20B 3PVQA 1UHCA 2EBPA 3B57A 1Q81R 3BE3A 3DL1A 2JMCA 4J5YA 2WACA 1NLOC 5GAN3 2AZSA 2QEXA 1RAGB 3NMZC 4C0ZA
chains in the Genus database with same CATH topology
2LX9A 3ZEHA 3MO8A 3JCMX 3QKJA 3OYNA 2RHXA 1VQMT 3L42A 1WGSA 2ZPBB 5LL6S 4MZTA 2QQAA 3RIRA 2QDJA 3Q1JA 1YHQA 2F5KA 1NPRA 2JVVA 4E7JA 1FX7A 2XG8D 3JRZA 3H4CA 3C95A 1KC8U 3UPUA 4J6YA 2DZCA 4NL2A 5CKEA 4XTXA 1X01A 5D6YA 4HCBA 4C92C 4M77B 4N4HA 2KR6A 1R8OB 2XIDA 4O6JA 3OYFA 2DIGA 3PFSA 4AKHA 3RKWA 1M9SA 5GAOr 2I2LA 1N9SA 2VXEA 5I2MA 4PL6A 2O4XB 2QQRA 2ZZDA 1SSFA 3SWNC 2KY9A 4M7AC 4M77C 3OS1A 1BI0A 5A0GA 2DVEA 4BE1A 4AKGA 4ZGJB 3LX7A 4IUVA 5CKFA 2EWNA 1Q81C 2KK4A 1W2BA 1VQ7T 4ATOA 3KBGA 4M75D 3C4SA 3UT1A 3MEUA 3CPWA 3L2WA 3I56A 1VQ8A 3CD6T 4LDYA 5CKDA 3JCMW 3QHSA 4HT9A 3V8JA 5LJ5f 1QP3A 3L1AA 3UDCA 3LH0A 2KDSA 5EG2A 4XTVA 2Y90A 2FHDA 5GANj 5A2QE 1K73U 3VYGA 3VKHA 1XNIA 2GCXA 4KBMB 5GMKj 4XK8E 5DM7R 4MIMA 4Z6YA 2V8JA 3CBOA 2M16A 1VQNA 2RJEA 2DXCA 4L6V5 5GAMj 2LQKA 3RUXA 1OYXA 5A0LA 3I55T 2YRVA 4HNUA 4QW2A 3OMGA 3OQ5A 5LJ5g 4V2SA 3MEAA 3OSSC 2RM4A 4PNOA 2VUBA 4Y91A 4F7UE 4XU2A 1KG1A 3P8DA 5AYFA 4C5HA 1NE8A 4F7UB 4JRQA 4CI0C 1P92A 5GAOm 4XU1A 1KHIA 2DPPB 1X75C 2QQ9A 1YJ9A 3CPFA 2JN0A 1FXXA 3ASKA 3C94A 3JCMV 4BY6C 2M9UA 5LJ5h 3JB9D 4HCZA 1N8RC 4M7AB 3QYEA 1B34A 3PNWC 1HXDA 5CQYA 2E5QA 3ER0A 3QZ9B 1YJNA 4R55A 4JRKA 5GMKm 2BS2A 1WQWA 2HNIA 3OS0A 1KD1C 4PJOD 4RG8A 3SD4A 4F7UA 3CD6A 2DTIA 3LWIA 4DA4A 2FYKA 4XAXB 4M7AA 4M78C 3GF5A 4PKCC 3V7SA 1VQOT 3CBPA 2FB7A 5GAN8 3DLLA 4M7DF 4C8QD 1M1FA 4RCBA 4YTLA 3OBWA 4OGCA 1KQSS 4OB2B 3HHTB 5GAMh 1XTDA 2M0OA 1FKMA 3WVDB 1D3BA 4OGEA 3QIIA 4PJOA 2GFUA 2RD1A 3A8GB 1DJ7B 3JCMd 4M7AE 1BI1A 3OS2A 5GAN2 4KUIA 3FJPA 3E19A 4M7DC 2RO0A 2K2VA 5LJ3e 4OF1A 3F70A 5CO7A 4QSHA 4E7HA 5CCAA 4OVAA 4HA8A 4M78F 3TW6A 5LJ3g 2KMGA 3OS5A 3M57A 3T9NA 2F69A 2DXBB 2RK2A 4IURA 2MWPA 1M1GA 2QQBA 4B9XA 5KE2A 2CZ6B 3A8OB 4MDWA 4AI6A 5DY9A 3LWHA 3CCJA 1VQ5A 4J83A 4MMLA 2BKDN 4FT4A 4BI3A 2DXBA 1IZ6A 2B8AA 3HRUA 4N4IA 4Z02A 5LJ3h 2EYQA 3RMQA 2VXFA 1NZ9A 1YIJT 2HBPA 4XTYA 1UGRB 4C0DC 3CCUT 1TH7A 1YITT 3OYEA 1QVFA 2EKOA 3FC3A 3PT9A 4JDSA 3CCVA 4F7UG 2C06A 1I81A 2EQJA 3QBYA 4BACA 3MP8A 2LVMA 4FT2A 1PSFA 4BD3A 5D6WA 4C0GA 5GAMe 2PUKB 4LD6A 3CXCA 2OTLA 2HD0A 2WSCE 4EDUA 4XTZA 2LT4A 3L2RA 2QF7A 4JS5A 1VQPT 3META 1BIBA 4B9WA 1QLBA 4BE2A 5IN1A 3RESA 3M59A 4GY5A 3V8LA 4EMGA 1N9RA 4J8OA 1V29B 3MP6A 3JB9J 4M6VA 4N0AC 3ME9A 2E41A 3QYHB 3OMCA 2GQVA 3GOXA 4KULA 3PIPA 4JX5A 3A8LB 1RL2A 2GF7A 4EMKA 4ZN3A 2LTOA 2IVWA 3TREA 4BE0A 2DXUA 1WJRA 2EJGA 2JTFA 3NFCA 1M1KU 3TEEA 4X9CA 3QG1A 3CPWS 2LCLA 2EFIA 2K3YA 1B34B 4A54A 4HKEA 5LJ5d 5GANd 2ZPFB 3CMAT 1NPPA 2DKGA 3TU4K 2D9TA 4E7IA 3CCUA 1YITA 2RK1A 2X4JA 2KVQG 3PTAA 3FIFA 4HL4A 4R56A 3HB9A 2WSFE 1VQOA 4BUGA 3LGFA 2X4WA 5GAOl 5GAN6 3M55A 3G71A 4C92F 2NLUA 4OB1B 2BS3A 1YBYA 5CQXA 3HKSA 4NOYA 3JCMJ 3QO3A 4J7FA 3SWNB 4RMOA 4AKIA 3CC4T 2M1HA 2XU8A 3JB9F 1VQ8T 3CCST 2QFZA 3VYHB 3JCMh 4FIBA 5FU7B 4HNTA 2XK0A 4EPCA 2DD5B 3HL8A 5KH6A 3JCMe 1QVFS 4BB7A 3QDRB 4M75E 3CMEA 3S3OA 3GLXA 1IREB 1KHCA 2YLBA 4M75B 1GXIE 1LNXA 3CXCS 1G3YA 3JAME 5DLQE 4J6WA 1U1TA 1N6AA 2E6NA 1YCYA 3N5BB 1UGPB 4P5NA 4A4FA 5GANe 2CZ0B 4IUTA 1UGSB 2DTHA 2K4YA 5I2SA 5LJ5e 5CK9A 2VGNA 2PUOB 5GAOq 4M7DD 3X28B 1M5Q1 1WJQA 5KCOA 4BDYA 1S72T 3CC2T 3I55A 3QZ5B 1O9SA 1H641 4M77F 4M75A 1G3TA 2YLCA 4HT8A 4M7AF 1I8FA 1YJ9T 1KQSA 2DXCB 5FU6B 2A3LA 3MEWA 2A7YA 2V8KA 3JSCA 3TCJA 3MHXA 1I4K1 1VQKA 1Q7YU 1YJNT 2DO3A 2L5QA 4PJOG 3DKMA 3L2UA 3VV0A 1U8RA 2XKOC 1MHNA 3E9GA 3SDZA 3LGLA 5GANh 3LYIA 5CKHA 4FU6A 3X26B 1JB0E 1XQHA 3VUBA 2JUFA 2Y4XA 1YIJA 5GAMd 2RI3A 1AHJB 2XICA 2KSSA 3OW2S 4NL3A 4JX4A 3OYKA 2RHYA 1KQ2A 1LOJA 2K57A 4CRIA 2JNGA 1NJIC 3QXEB 4ZTJA 1W4SA 1YI2A 3QSUA 3SWNA 2AHJB 2DEQA 2RHIA 3GIBA 2DTOA 3EFSA 3G4SA 1JJ2S 4HCCA 1HK9A 1X6OA 2WSEE 4HNVA 3JCMc 2MWOA 2KAFA 1I5LA 4LOCA 3CC7T 3QPHA 1M90C 4ELYC 2D6FA 1OI1A 3CCRA 3LW5E 3JCMb 4C0DB 5FRMA 4M7AG 3EAEA 3OYJA 2V8IA 1VQ4T 3WXMB 1UGQB 3S3NA 2HAXA 2X4XA 1Y96A 5LJ3d 2XD0A 3G6ET 3QWLA 2QXFA 1K8AC 3M9QA 2R5AA 4BBRM 4M75G 3VYGB 5KE3A 4D6WA 2CZ7B 4FM4B 4EMKB 4M75C 3RERA 4C8QC 2GFAA 1VQ5T 1WJSA 4FSXA 2E65A 4BDZA 4KUDK 5FLXE 1VQ6T 4DQ2A 5GAMg 4PJOF 3FB9A 4RCCA 2L8DA 2QTXA 3VUZA 1PSEA 4JS4A 4E7KA 3CC4A 3M4YA 4X34A 4MFEA 3JCMf 2CKKA 2QQ8A 4OMFB 3TW7A 2E70A 3H8ZA 3BG5A 2HQXA 2DJZA 2PU9B 3CCQA 2CS7A 2BUDA 2XHCA 5GAOp 2QI2A 3QUIA 5A0DA 1M1KC 3JB9H 2ZZDB 3GPLA 3OYMA 1VQ9T 2KQWA 4PJOB 5GANf 2RI5A 3CMET 2X35A 4A4KA 2K5IA 5EJCA 2E6ZA 2E10A 4C92D 4M7DB 3VKIA 3HP9A 4ELZC 1JRIA 5LJ3j 1M4ZA 3AHUA 1BIAA 2LCCA 3FRNA 5GAMf 1YJWA 3C12A 4O5VA 1RI0A 3V7CA 2Y4YA 3UWNA 4J6XA 3OSVA 3V7RA 2HQEA 3BDUA 4E7LA 1EIFA 3HRSA 1S72A 1ZHIA 1G3WA 4ME7A 4M78G 5GANg 4A53A 4II1A 4X9DA 1BI3A 3CCET 3H6ZA 3J80E 4XQ3A 4C92E 4JUVA 1Q86C 3QYGB 5FU7C 4C92G 2MI6A 1QP2A 3M5AA 3OYAA 2P0PA 3OA6A 3CCLT 3FLGA 2RJCA 5HKCA 1MGQA 3KHIA 3GNFB 2DZ9A 4MZPA 4M77D 4M7AD 2VV5A 4N4GA 4QQGA 3J7AF 4M77E 3LLRA 2O01E 3OYHA 1VIFA 3A5ZB 4M77G 4M7DG 2MF2A 2PQWA 5M9OA 3BW1A 3BG9A 3ZFJA 3JCMg 5GMKh 3NTKA 4OP0A 3OY9A 1Q82C 1QVGS 4DOVA 4M78A 2P4TA 3M56A 4L5GA 3HRTA 4C8QE 4OB3B 3CCMT 2LNVA 3PIOA 3BFMA 3QJ6A 3G4ST 1VQ4A 4C92A 4ZGEB 2LT1A 3DLMA 5CVIA 3CC7A 1Y96B 3RKXA 5HY6A 5L8RE 3CCSA 5CIUA 1N8RU 2CYZB 1WQ7A 3OYCA 1G5VA 3BG3A 4MZMA 5I21A 3CCEA 3GP8A 3A8HB 3CC2A 3X25B 2R57A 1JJ2A 1D3BB 3HFOA 1FWZA 4PLIA 1VIEA 2FVUA 5CAIA 2DD4B 2X4YA 3P8BB 4MDXA 1ZQ1A 1U1SA 3M58A 5LJ3f 3OYLA 1QVPA 3V8KA 4JX6A 4UC4A 1KD1U 3QYBA 1JBMA 3MP1A 4XTWA 4BI8B 4EMKC 4NS5A 3G7ZA 2MMPA 4KT0E 2LDMA 3FDRA 3A8MB 3HZJA 1BYMA 2ZCFB 1VQKT 2E12A 4QQ6A 5GMKl 3HBLA 3URGA 3CBMA 3RKYA 4QVCA 3OYYA 3M54A 3I56T 3L2VA 1W2BS 1Q86U 1VQLT 5J26A 1LJOA 4M78B 3E1SA 4LDVA 1NJIU 3L2QA 2RA2A 3ZBDA 4QQDA 4NC6A 3CCQT 2EQKA 4JRIA 2O4XA 4IUPA 3CCMA 4IUUA 2ZPEB 3G71T 1H3ZA 4C92B 3E9FA 1KQ1A 4A4HA 3NTIA 3GNGA 2L3RA 2PVDB 4BY6B 4ZN1A 4LDXA 5GMKe 2XDDA 4TVRA 2QEXT 4E47A 4MFDA 4ELJA 3KUFA 3MEVA 5FRNA 1Q7YC 2QA4T 2MAMA 1G3SA 2P0KA 4BBSM 1Y71A 2K5FA 3BDLA 4XU3A 4GLKA 1K9MU 2P0QA 3CEYA 1QVGA 5D6XA 2E64A 4HLQA 3CCRT 2DD4A 3JCMQ 1VUBA 2BS4A 3G6EA 4LDWA 3SB2A 2YHTA 3OYGA 4IUQA 1VQMA 5LJ5j 3BY7A 4JLGA 4FL6A 4M78D 4Q5WA 5HK0A 5IT9E 1YHQT 2RHUA 5C6SA 1Q82U 4IKFA 3MCAB 3CMAA 1K73C 3PMTA 2EAYA 1UEBA 4LD9K 4PJOC 3JB9G 2OTJT 2H3JA 4DOWA 1VQLA 3FEOA 4L59A 2RJDA 4ZGDB 3CCLA 3WVEB 2JTMA 4JRPA 2XI9A 2DAQA 3O8VA 2RI2A 3OB9A 4M75F 4M77A 5IAYA 4C8QB 2VYTA 5GMKi 5GAN4 3KXTA 4A4EA 2RHZA 1Q81U 3QJYA 5CR2A 1BKBA 3S3MA 1M8VA 3PGGA 4N0AA 1K8AU 2PVGB 1VQ6A 2DK3A 2DD5A 4M78E 3VU3C 1VQPA 1VQ7A 4C8QA 1VQ9A 2EJFA 1QW1A 3M4GA 2E1HA 5KCHA 2IG0A 4MMKA 3JCMP 3HO8A 2QA4A 2JZ2A 2LQ8A 3M53A 5J39A 4J7IA 3OYBA 4PLLA 4XTUA 4WF2A 4RKUE 4VUBA 1XOVA 2VC8A 1YI2T 1VQNT 3HPWA 2CGHA 3RMSA 3OBYA 1ZBXA 2VGMA 1WNLA 2RB6A 5GAOn 3OYDA 2QQSA 5C0MA 1YJWT 1KC8C 5DLOA 2QDYB 2K5LA 5GAN5 2ZPGB 1UB4A 5FROA 4M7DE 3VJPA 1Y7XA 2FL7A 2G3RA 4JJNK 2G77A 3EFRA 2DIQA 2OTJA 5GAN7 4QVZA 1M90U 3JB9I 2D0QB 4ZTFA 3DB3A 3S6WA 3HFNA 4PJOE 2BIVA 2DXTA 2ZGWA 1E7PA 1O75A 4BI4A 5HK3A 2WJ9A 3PMIA 2ZPHB 2ZPIB 1N27A 1OZ2A 1K9MC 2EIFA 3L2ZA 2XDBA 3X24B 3VKGA 3J81E 4JLIA 4C8QF 4A4GA 3OYIA 4M7DA 4C5EA 2K3XA 2LC4A 2LRQA 4EMHA 3CCJT 3X20B 5J3BA 3SFMA 3R6OA 3OW2A 2CZ1B 2EQMA 2R5MA 4XU0A 2KMTA 4C5IA 4QVDA 1Y07A 1OZ3A 3P8HA 5FU6C 3DB4A 3INZA 3DL1A 4F7UF 3CCVT 2L89A 1BI2A 4OB0B 1WPYA 2EQUA 2EJ9A 2OAUA 4C5GA 4J5YA 2OTLT 2R58A 2RJFA 2WACA 4Y28E 5CKBA 2JOYA 3NTHA 2RH2A 2F5TX 2XDPA 4RG2A 4C0FA 5GAN3 2QEXA 3HSBA 4LDUA 2PVOB 4C8QG 4C0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZCF B;  2DXB A;  2ZPB B;  1UGR B;  3LW5 E;  1UGQ B;  2ZPE B;  1PSF A;  2PUK B;  2WSC E;  3VYG B;  2CZ7 B;  4FM4 B;  2PVD B;  1V29 B;  3QYH B;  2ZZD A;  1PSE A;  3A8L B;  4ZGJ B;  2DD4 A;  2PU9 B;  2ZPF B;  2ZZD B;  1QP3 A;  4ZGD B;  3VYG A;  3WVE B;  2WSF E;  4XK8 E;  2DXC A;  4L6V 5;  4OB1 B;  2PVG B;  2DD5 A;  3VYH B;  3QYG B;  2DD5 B;  2DPP B;  4RKU E;  1QP2 A;  1GXI E;  1IRE B;  3QZ9 B;  1UGP B;  2CZ0 B;  1UGS B;  2QDY B;  2PUO B;  2ZPG B;  2O01 E;  3X28 B;  3QZ5 B;  2D0Q B;  2DXC B;  4OB3 B;  4OB2 B;  3HHT B;  2ZPH B;  2ZPI B;  3X24 B;  3WVD B;  4ZGE B;  3A8G B;  1DJ7 B;  5L8R E;  3X20 B;  2CYZ B;  2CZ1 B;  3X26 B;  1JB0 E;  1AHJ B;  4OB0 B;  3A8H B;  3X25 B;  4Y28 E;  3QXE B;  2DD4 B;  2DXB B;  2AHJ B;  2CZ6 B;  3A8O B;  2WSE E;  2PVO B;  4KT0 E;  3A8M B; 
#chains in the Genus database with same CATH topology
 1MMA A;  2LX9 A;  1SRL A;  3D7S B;  5KYW B;  2ZPB B;  2QQA A;  3Q1J A;  2F2X A;  3C0C A;  4KRT A;  2XG8 D;  3JRZ A;  3C95 A;  1TUC A;  1BU2 A;  3PO3 S;  4C92 C;  3DDQ B;  2L3S A;  2I2L A;  4PL6 A;  3OS1 A;  3EGX A;  2DVE A;  4BE1 A;  1C0M A;  4IUV A;  2DME A;  2CP2 A;  5CKF A;  2EWN A;  4F70 B;  2G9X B;  1W2B A;  4EIK A;  4OML A;  3EG3 A;  3MEU A;  4A63 B;  2ZAE A;  5LJ5 f;  1RLQ C;  2WIH B;  3VKH A;  4KBM B;  1G2B A;  5DM7 R;  4MIM A;  4Z6Y A;  2V8J A;  2DXC A;  1H4L D;  2CT4 A;  1OYX A;  5A0L A;  4HNU A;  4YOO A;  3OMG A;  5LJ5 g;  2LQN A;  1O9K A;  1SPK A;  1OU9 A;  3F5X B;  4HCK A;  2W2H A;  1MMG A;  1M1K R;  4GLM A;  3CPF A;  2JN0 A;  4BY6 C;  1VQ4 Q;  1M3A A;  5LJ5 h;  3QYE A;  2DL4 A;  1B34 A;  2AZV A;  2FO0 A;  3E2U A;  3PNW C;  3ER0 A;  5CQY A;  2BS2 A;  1KD1 C;  3I56 Q;  3EFO A;  4F7U A;  1OIY B;  4DA4 A;  4J9B A;  3CBP A;  3VS4 A;  4HXJ A;  3OBW A;  1KIK A;  1KQS S;  2FRY A;  3HHT B;  1XTD A;  1NG2 A;  1FKM A;  1OL1 B;  3WVD B;  2GFU A;  2RD1 A;  3A8G B;  1R0B G;  4M7A E;  4OR5 B;  4CFV B;  5KYX A;  2LP5 A;  3H0H A;  4M7D C;  5DQW A;  5CO7 A;  4E7H A;  5CCA A;  1VQP Q;  3H0I A;  1KXU A;  4BCK B;  2PK9 B;  2F69 A;  1YJW Q;  2RK2 A;  1G83 A;  2MWP A;  1M1G A;  2QYZ A;  4RUG A;  3CCJ A;  3CCL Q;  1M2V A;  2DXB A;  4Z02 A;  4XTY A;  3FC3 A;  3PT9 A;  4JDS A;  4EOS B;  4BAC A;  4PFZ A;  3CXC A;  2GGR A;  5D6W A;  2PUK B;  2QF7 A;  1BIB A;  4B9W A;  4BE2 A;  3M59 A;  2OAW A;  3V8L A;  3MP6 A;  3CPW P;  1RL2 A;  5L23 A;  4EMK A;  1D1A A;  4NST B;  3NFC A;  4X9C A;  2H8H A;  1UEC A;  2LCL A;  1A0N B;  2SRC A;  2YUO A;  1QMZ B;  4EOL B;  2WSF E;  1VYT A;  3LGF A;  3M55 A;  4C92 F;  2QTV A;  2NYS A;  1OKW B;  4PJN A;  5CQX A;  3JCM J;  1YNZ A;  3VS2 A;  1RAF B;  2V26 A;  1WXB A;  2M0Y A;  1WX6 A;  2PJQ A;  1VQ8 T;  3QWY A;  3CCS T;  3EHR A;  2UZL B;  3JCM e;  1PD0 A;  4FX3 B;  3HL8 A;  3CME A;  3QDF A;  2MK5 A;  2YLB A;  4CFM B;  4EOK B;  2AIR B;  3CXC S;  4BCO B;  2G6F X;  5DLQ E;  1LVK A;  2E6N A;  5GAN e;  4P5N A;  5LJ5 e;  1UGS B;  4EOI B;  4M7D D;  1VQM Q;  3MI9 B;  2PUO B;  4BCH B;  2RQV A;  1M5Q 1;  1S72 T;  5KCO A;  4BDY A;  2C0O A;  3QZ5 B;  1EFN A;  1P5E B;  1H64 1;  4M7A F;  1VYU A;  2YLC A;  1YJ9 T;  3UA6 A;  2BZY A;  3M0Q A;  4BY7 X;  2DO3 A;  1UJ0 A;  3L2U A;  3VV0 A;  1U8R A;  2XKO C;  3SDZ A;  3LYI A;  3VUB A;  3H9N A;  4FU6 A;  2Y4X A;  4Z89 A;  1ABQ A;  1AHJ B;  2XIC A;  2DF6 A;  1MV0 B;  3MIA B;  1E9H B;  3EFS A;  4HCC A;  1AD5 A;  4HNV A;  1AIS B;  4G6L B;  2UZD B;  3LW5 E;  4CXA B;  3JCM b;  1KQS P;  5FRM A;  2V8I A;  2J6F A;  4ROD A;  5LJ3 d;  2DIL A;  2EGE A;  3RER A;  4C8Q C;  1PHT A;  2E65 A;  2FRW A;  4F04 B;  5GAM g;  4JS4 A;  3FB9 A;  4HVU A;  3VUZ A;  1PSE A;  4MFE A;  1R77 A;  1WXT A;  3TW7 A;  4KH1 B;  2DX1 A;  2R7G A;  2DJZ A;  1ZSZ A;  2CS7 A;  2KXD A;  2XHC A;  5GAO p;  2QI2 A;  3GPL A;  1VQ9 T;  2FPD A;  2KQW A;  4C92 D;  4Y92 A;  1M4Z A;  1BIA A;  2HQE A;  3BDU A;  1VQ6 Q;  5IDP B;  2DL3 A;  1VQ5 Q;  2CP5 A;  4X9D A;  2C0T A;  5KYN A;  4JUV A;  1Q86 C;  1BCO A;  3BLH B;  1QP2 A;  1VQK Q;  3SEM A;  3CCL T;  2RJC A;  4ROE A;  4CRL B;  1PC0 A;  2FPE A;  2RMO A;  1OGU B;  5DQV A;  4M77 E;  4M77 G;  4M7D G;  2CRE A;  3BG9 A;  3ZFJ A;  3JCM g;  5GMK h;  4OP0 A;  1Q82 C;  1QVG S;  2K6D A;  3CCM T;  4FW1 A;  4BCQ D;  2HL3 A;  2LT1 A;  3CC7 A;  2AT1 B;  2L0A A;  5L8R E;  2CYZ B;  1UNG D;  1XJW B;  2OJ2 A;  2R57 A;  2IVX A;  4PLI A;  2K2M A;  4MDX A;  3OYL A;  4XTW A;  4BI8 B;  3G7Z A;  3RDV A;  3CBM A;  4QVC A;  4ELL A;  3M54 A;  1PCX A;  2W9Z A;  1Q86 U;  4LDV A;  3NDQ A;  2RA2 A;  1OOT A;  2FZG B;  3ZBD A;  4NC6 A;  3CCM A;  4JRI A;  1SHG A;  4A4H A;  3QHW B;  4EOR B;  3CCS Q;  2PVD B;  4LDX A;  5GMK e;  3UAT A;  2K5F A;  1K9M U;  3EHQ A;  2P0Q A;  1QVG A;  5BNJ B;  3G6E A;  3SB2 A;  1VQM A;  2AKK A;  3MPU B;  5HK0 A;  1D0Z A;  1Z9Q A;  4PJM A;  4K11 A;  3MCA B;  1IO6 A;  3PMT A;  2EAY A;  2OTJ T;  1H24 B;  4DBH A;  1NYG A;  3FEO A;  4L59 A;  4DOW A;  1VQL A;  2JTM A;  2W10 A;  1K76 A;  4JRP A;  2XI9 A;  2DAQ A;  4M75 F;  2RI2 A;  1JXM A;  1K8A R;  3QJY A;  1M8V A;  2O9S A;  1VQ9 A;  2EJF A;  1H1Q B;  1OI9 B;  1QW1 A;  5KYW A;  1T3L A;  2IG0 A;  2QEX Q;  2CP0 A;  5KYU A;  3H0F A;  3HO8 A;  2UUE B;  3OYB A;  1VQN T;  3HPW A;  3RMS A;  2M02 A;  1UB4 A;  3O5Z A;  2UZE B;  4CC2 A;  2G77 A;  2OTJ A;  2YUQ A;  3JB9 I;  2D0Q B;  1BK2 A;  2EYZ A;  1WDX A;  2KEA A;  3HFN A;  5HK3 A;  1E7P A;  1K9A A;  1O75 A;  2ZPH B;  2J6O A;  3X24 B;  5FW9 A;  1M90 R;  4A4G A;  1O9K B;  3OYI A;  2IW8 B;  2LC4 A;  2LMJ A;  4AMC A;  3OW2 A;  2CZ1 B;  3DOG B;  2KMT A;  4QVD A;  3EG2 A;  5FU6 C;  3INZ A;  1WXU A;  4OB0 B;  3M0S A;  1Y0M A;  1M2V B;  4C5G A;  3MY1 B;  1H1S B;  2HEQ A;  2F5T X;  4DBF A;  4C0F A;  3HSB A;  4CFU B;  4J9H A;  4C8Q G;  2ESW A;  3L42 A;  1IRX A;  5IHI A;  4MZT A;  3RIR A;  1YHQ A;  2JVV A;  3EG0 A;  1VQ8 Q;  1FX7 A;  3H4C A;  4J9G A;  2LQW A;  4HCB A;  5CKE A;  5LMK B;  1KC8 R;  4M77 B;  4O6J A;  2KR6 A;  5ECA A;  1KD1 R;  4GBQ A;  2DL8 A;  1OX9 A;  4ESR A;  4LUE A;  3EOC B;  2JW4 A;  1QVF P;  2KY9 A;  1RAE B;  2PZ1 A;  5GJW B;  1VQ7 T;  4ATO A;  2DEU A;  1W6X A;  3C4S A;  3M0R A;  1VQ8 A;  5I22 A;  4LDY A;  3JCM W;  2KGT A;  3QHS A;  3V8J A;  4AFQ C;  1N4M A;  3L1A A;  3UDC A;  1EZZ B;  2KDS A;  4PK4 A;  4XTV A;  1PM3 A;  2FHD A;  5A2Q E;  3VYG A;  1MNE A;  3CBO A;  2M16 A;  2KXC A;  2RJE A;  2KYM A;  3RUX A;  3I55 T;  3OQ5 A;  3OSS C;  4Y91 A;  2RM4 A;  2VUB A;  2KBT A;  5L2W B;  2F2V A;  4XU2 A;  2KRO A;  4F7U B;  1C1A A;  4CI0 C;  1P92 A;  2O2O A;  3IQL A;  3TSW A;  4XU1 A;  1LCK A;  1ZA1 B;  3C94 A;  4WTO B;  3JB9 D;  3JCM V;  1N8R C;  4J9I A;  2LCS A;  1HXD A;  3QZ9 B;  1YJN A;  4R55 A;  5GMK m;  4PJO D;  2C4G B;  2PHG A;  2HNI A;  5HBJ B;  2MPX C;  2CSQ A;  3SD4 A;  4XAX B;  1IB8 A;  4M78 C;  3DLL A;  2GTJ A;  5GAN 8;  4IMY B;  1M1F A;  4EC8 B;  2DYB A;  1PKS A;  2OTL Q;  3POM A;  1U5S A;  2DVJ A;  4PJO A;  1QVG P;  3BHV B;  4OMN A;  1QCO A;  2YUP A;  5LJ3 e;  1VQ9 Q;  4QSH A;  2HDA A;  4OVA A;  3TW6 A;  1GCQ A;  3M57 A;  3T9N A;  1JOW A;  4BCI B;  4IUR A;  2HSP A;  5DY9 A;  4AI6 A;  4J83 A;  1TUG B;  4FT4 A;  4BI3 A;  2BZ8 A;  2E3H A;  5LJ3 h;  1IZ6 A;  2B8A A;  4N4I A;  3NGP A;  4C0D C;  2YXY A;  3JV3 A;  3OYE A;  1H92 A;  2C06 A;  1H28 B;  2X3X D;  3R6N A;  4BD3 A;  1K73 R;  2HD0 A;  4EDU A;  2LT4 A;  1QLY A;  1TU0 B;  4JS5 A;  3MET A;  3RES A;  4EMG A;  2VB6 A;  3ME9 A;  4KUL A;  1YJN Q;  2LTO A;  3CCM Q;  1WJR A;  1GY3 B;  3QG1 A;  1TSF A;  1TG0 A;  4HKE A;  2DKG A;  2AKL A;  2EYY A;  4R0K A;  2RK1 A;  1ZLM A;  2X4J A;  2KVQ G;  1YJ9 Q;  3EG9 A;  3RNJ A;  3FIF A;  3HB9 A;  2DFU A;  1NEB A;  1VQO A;  5GAO l;  3EJ1 B;  2YWW A;  2BS3 A;  5HQ0 B;  3HKS A;  4NOY A;  3QO3 A;  3SWN B;  3CC4 T;  2M1H A;  2A08 A;  3JB9 F;  2QFZ A;  4F6S B;  5HBH B;  5FU7 B;  4HNT A;  4EPC A;  4BB7 A;  4M75 E;  1GXI E;  1KHC A;  4OMP A;  4LNP A;  4YOS A;  3JAM E;  5LJ5 j;  1U1T A;  1Q82 U;  4HT9 A;  4A4F A;  2X51 A;  5I2S A;  4IUT A;  2DTH A;  5KYU B;  2BE9 B;  3I55 A;  1O9S A;  4M77 F;  1Q7Y R;  4HT8 A;  1KK7 A;  2I53 A;  4J9F A;  5FU6 B;  1H1P B;  2A3L A;  1URC B;  2V8K A;  3NHN A;  2W96 A;  1ZA2 B;  2HQH A;  1YJN T;  4RTU A;  1MHN A;  3LGL A;  3X26 B;  1JB0 E;  2JUF A;  7AT1 B;  4CC7 A;  1OKV B;  4F7J B;  2KSS A;  1ABO A;  3EGU A;  2RHY A;  1QKX A;  1KQ2 A;  1OUL A;  4CRI A;  2JNG A;  1NJI C;  3QSU A;  1W4S A;  3SWN A;  2AHJ B;  3M0T A;  4LN2 A;  1AZG B;  4LOC A;  2F2W A;  5KYY A;  1M90 C;  1HD3 A;  1FMV A;  3MJX A;  4C0D B;  3MKD A;  4LUD A;  3CC2 Q;  1WHJ A;  2HAX A;  5FWC A;  2XD0 A;  3QWL A;  1K8A C;  3M9Q A;  4BBR M;  4M75 G;  4M7D B;  1D09 B;  2CZ7 B;  4FM4 B;  1C9B A;  1B7T A;  1VQ5 T;  4M4Z A;  4KH0 B;  4DQ2 A;  4RCC A;  2L8D A;  2QTX A;  4E7K A;  3M4Y A;  4X34 A;  5KYY B;  1OL2 B;  2JT4 A;  1GBR A;  2HQX A;  2PU9 B;  2RI5 A;  2P84 A;  3VS3 A;  2K5I A;  1VQ7 Q;  2E6Z A;  3VRZ A;  3CQT A;  1JRI A;  1YN8 A;  3FRN A;  5GAM f;  3C12 A;  4O5V A;  1RI0 A;  1QKW A;  1HJD A;  3V7C A;  2Y4Y A;  2EPD A;  2OI3 A;  1W98 B;  1EIF A;  1S72 A;  1G3W A;  4ME7 A;  2C5N B;  2Z0W A;  3EG1 A;  4E7S A;  1VOM A;  5FU7 C;  1OPL A;  2W9F A;  1C6V X;  3OA6 A;  3FLG A;  3KHI A;  2BPM B;  2CCI B;  2HKN A;  4M77 D;  4M7A D;  4N4G A;  3OYH A;  3A5Z B;  2MF2 A;  5M9O A;  2F1L A;  1X69 A;  4M78 A;  2P4T A;  3M56 A;  4L5G A;  4FYX B;  2LW4 A;  4OB3 B;  3PIO A;  3QJ6 A;  4C92 A;  4F6W B;  2DET A;  1FIN B;  1Y96 B;  4PJJ A;  2O31 A;  1WHG A;  1OPK A;  1G5V A;  3DJB A;  3GP8 A;  3A8H B;  3CC2 A;  3X25 B;  1JXO A;  1JJ2 A;  1K0X A;  1RAA B;  3HFO A;  2FVU A;  2YDL A;  5CAI A;  3M58 A;  5LJ3 f;  1KD1 U;  1TD6 A;  4NS5 A;  1NM7 A;  2WHB B;  2LDM A;  3A8M B;  1BYM A;  2ZCF B;  4QQ6 A;  2IIM A;  2JTE A;  4AT1 B;  3OYY A;  2HSE B;  1VQL T;  1W2B S;  2FG0 A;  5J26 A;  2AK5 A;  2J7I A;  4M78 B;  6AT1 B;  2KRS A;  4IUP A;  1H3Z A;  2ZPE B;  4C92 B;  3E9F A;  1T0J A;  2IW6 B;  3ZL7 C;  3GNG A;  2L3R A;  3VS5 A;  4TVR A;  3RR6 A;  2QEX T;  4E47 A;  3EH2 A;  1K9M R;  2O9V A;  4BXX X;  2QA4 T;  3BDL A;  4GLK A;  3CEY A;  1ZSG A;  5D6X A;  2E64 A;  1F1B B;  3CCR T;  2CP3 A;  8ATC B;  3OYG A;  4EOO B;  2PTK A;  4Q5W A;  4DBQ A;  1YHQ T;  2RHU A;  1ZX6 A;  4LE9 A;  1K73 C;  1NLP C;  1UEB A;  3CCL A;  4ZGD B;  1AWO A;  3WVE B;  1I0C A;  4AG1 C;  4M77 A;  2GQI A;  5GAN 4;  3JB9 G;  4C8Q B;  2HZY A;  3KXT A;  4A4E A;  2RQW A;  1Q81 U;  3S3M A;  4N0A A;  1VQ6 A;  2B86 A;  2DK3 A;  2A28 A;  4M78 E;  2GTO A;  3M4G A;  2ECZ A;  2E1H A;  3QHR B;  1J3T A;  2QA4 A;  5J39 A;  4J7I A;  2QGS A;  4PLL A;  3SHW A;  2KI7 A;  1XOV A;  1YI2 T;  4J9D A;  1ZBX A;  5C0M A;  1KC8 C;  1YJW T;  1NEG A;  2QK0 A;  2K5L A;  5GAN 5;  2ZPG B;  1Y7X A;  4JJN K;  3DB3 A;  3S6W A;  1AWW A;  1OZ2 A;  2XDB A;  4C8Q F;  2LRQ A;  4EMH A;  2JM9 A;  5J3B A;  3SFM A;  2QDL A;  3R6O A;  2R5M A;  4XU0 A;  4C5I A;  1OZ3 A;  1VIN A;  3CCV T;  2VAS A;  2L89 A;  4KRD B;  1WPY A;  2EQU A;  2L2P A;  2EJ9 A;  2OAU A;  1H3H A;  2R58 A;  4Y28 E;  1B07 A;  3NTH A;  2RH2 A;  2XDP A;  4RG2 A;  1YCS B;  4Z88 A;  5I5Z B;  4FSS A;  3TSZ A;  2WFY B;  1VQL Q;  4KRC B;  2DYI A;  1WGS A;  2F5K A;  1NPR A;  1D3U B;  2H3E B;  1WFW A;  3PE0 A;  1KC8 U;  4J6Y A;  2JS0 A;  2C5V B;  4NL2 A;  2D8H A;  1X01 A;  2F2C A;  2QGF B;  4N4H A;  1R8O B;  2XID A;  2DNU A;  2WEV B;  1ACM B;  5GAO r;  1N9S A;  1UFF A;  3K7A M;  5ACB A;  1SHF A;  2MOX A;  4B6M A;  2ZZD A;  3SWN C;  4M7A C;  1JU5 C;  4M77 C;  1BI0 A;  5A0G A;  4CFW B;  2CDT A;  4AKG A;  3LX7 A;  1Q81 C;  1SF9 A;  2KK4 A;  4HVV A;  2J06 A;  1T3S A;  2I0N A;  4M75 D;  3CPW A;  3L2W A;  1PKD B;  5CKD A;  3REA B;  1YWP A;  3LH0 A;  1S72 Q;  2K7A A;  5GAN j;  1K73 U;  1GUX A;  2KE9 A;  1RI9 A;  1VQN A;  1IHV A;  2BZX A;  1MUZ A;  1GCQ C;  2LQK A;  1WYX A;  4DBR A;  4QW2 A;  4PNO A;  4F7U E;  1UGV A;  1YI2 Q;  2PK2 A;  1ZUU A;  1KHI A;  2QQ9 A;  2IW9 B;  3ASK A;  2M9U A;  4M7A B;  1ENW A;  1NBE B;  1WQW A;  5FWB A;  4RG8 A;  3CD6 A;  3LWI A;  2K3B A;  1TTH B;  4LXC A;  4YC3 B;  4PKC C;  2FB7 A;  4RCB A;  2HBW A;  1Z9Z A;  4YTL A;  4OGC A;  4OB2 B;  1BU1 A;  3FJ5 A;  1U06 A;  1KSW A;  2NUP A;  1DJ7 B;  2COW A;  1ZSZ B;  1JJ2 P;  5GAN 2;  4KUI A;  2JMA A;  3FJP A;  1VOL A;  2DM1 A;  3CCV Q;  3OS5 A;  2K79 A;  4RTW A;  1R0C B;  1VQ5 A;  4MDW A;  1S1N A;  4MML A;  2DL5 A;  3VS0 A;  1N8R U;  3CMA T;  2EYQ A;  2VXF A;  3G71 Q;  1M3C A;  4D8D A;  1TH7 A;  1VQO Q;  3TNW B;  1QVF A;  4E7Z A;  3CCV A;  4F7U G;  2EVR A;  1I81 A;  2I40 B;  2EQJ A;  3MP8 A;  4FT2 A;  5GAM e;  4C0G A;  2WSC E;  1UG1 A;  4XTZ A;  3L2R A;  4CFX B;  1VQP T;  4QKU A;  3JB9 J;  3BLR B;  1N9R A;  1V29 B;  2ATC B;  4DEY A;  3OMC A;  2NWM A;  3GOX A;  4EOQ B;  3A8L B;  3O0G D;  3TQ7 P;  4FW2 A;  2IVW A;  3TRE A;  2DXU A;  2EJG A;  2JTF A;  4OMM A;  3TEE A;  4PFO A;  3CPW S;  5LJ5 d;  2K3Y A;  4A54 A;  2ZPF B;  1AWX A;  1V76 A;  2EGA A;  3TU4 K;  3TVT A;  4HL4 A;  1GFC A;  4BUG A;  4RTY A;  3KFV A;  4OB1 B;  1YBY A;  5FGK B;  5D7U A;  1D1C A;  2VKN A;  4IIM A;  4RMO A;  1VA7 A;  3BHU B;  4FIB A;  2HKQ B;  4JZ3 A;  5KH6 A;  2DD5 B;  1QVF S;  3QDR B;  3S3O A;  1B3Q A;  1IRE B;  3LH5 A;  2EW3 A;  1LNX A;  1Q95 G;  4EC9 B;  1G3Y A;  3G1J A;  4J6W A;  2GBQ A;  1E6G A;  2VGN A;  3X28 B;  3CC2 T;  3H41 A;  1X43 A;  4M75 A;  4FYW B;  1Y57 A;  1KQS A;  1TWB A;  2A7Y A;  3JSC A;  3MHX A;  1NYF A;  3LQ5 B;  4PJO G;  2A37 A;  1N8R R;  2LJ0 A;  4BY1 X;  5GAM d;  2RI3 A;  1AOJ A;  3OW2 S;  4NL3 A;  3OYK A;  1LOJ A;  2K57 A;  2DBM A;  3GIB A;  1SEM A;  2DEQ A;  1JJ2 S;  3JCM c;  5HVY B;  2ED1 A;  2KYB A;  2KAF A;  4KGX B;  4BCN B;  3CC7 T;  5ICP B;  4ELY C;  1OI1 A;  3CCR A;  4M7A G;  3OYJ A;  3WXM B;  1Y96 A;  2YUN A;  2R5A A;  3EFO B;  3VYG B;  4D6W A;  2JS2 A;  4EMK B;  1SSH A;  1UE9 A;  1WJS A;  1MMN A;  1RAC B;  1H26 B;  1VQ6 T;  4PJO F;  1RAD B;  3BLQ B;  3JCM f;  2PNI A;  1AVZ C;  2QQ8 A;  4OMF B;  2EQI A;  3CCQ A;  3EGX B;  2KRM A;  3TNI B;  2BUD A;  5A0D A;  3JB9 H;  2ZZD B;  3OYM A;  1W70 A;  2HL5 C;  3I35 A;  5GAN f;  3CME T;  2X35 A;  1SG5 A;  5EJC A;  2E10 A;  1GFD A;  3HP9 A;  5LJ3 j;  3AHU A;  1UTI A;  1D1B A;  3M0U A;  1YJW A;  1YHQ Q;  3VRY A;  2HMA A;  4J6X A;  2CCH B;  2CJM B;  3OSV A;  4E7L A;  2DJQ A;  1ARK A;  2LZ6 B;  3HRS A;  4F6U B;  1OV3 A;  1ZHI A;  2HCK A;  4RTV A;  4M78 G;  3J80 E;  4XQ3 A;  2E4H A;  4C92 E;  2ROT A;  1JST B;  2DRK A;  4C92 G;  3M03 A;  2KRN A;  4ANJ A;  5HKC A;  4RTX A;  3GNF B;  4JJC A;  4MZP A;  4QQG A;  3J7A F;  2O01 E;  1VIF A;  1LPL A;  1FMW A;  3BW1 A;  2QAS A;  3OY9 A;  3NTK A;  3CD6 Q;  4DOV A;  1CKA A;  1HSQ A;  3HRT A;  4C8Q E;  1ZUY A;  2LNV A;  1T0H A;  3G4S T;  4Z8A A;  1VQ4 A;  1M27 C;  2V1Q A;  3EID B;  3RKX A;  5HY6 A;  5CEI B;  1K0S A;  1TUD A;  1H1R B;  3BG3 A;  1PRM C;  4MZM A;  3CCE A;  1QWF A;  3TN8 B;  1CKB A;  2JGZ B;  1KFZ A;  1VIE A;  2DD4 B;  2J6K A;  1U1S A;  4JJD A;  1JEG A;  1QVP A;  3V8K A;  3MP1 A;  1Q86 R;  2MMP A;  3FDR A;  3HZJ A;  1AEY A;  2CP6 A;  2PMI B;  3URG A;  3RKY A;  1NJI U;  1QWE A;  4QT7 A;  2NUZ A;  5LQF B;  4QQD A;  2EQK A;  2KNB B;  3G71 T;  1KQ1 A;  2YRC A;  1TS9 A;  1WIE A;  3GBQ A;  4E6R A;  2XDD A;  2SEM A;  4ELJ A;  3MEV A;  2RN8 A;  2MAM A;  4FCY A;  2A36 A;  2DD4 A;  3JCM Q;  2BS4 A;  4LDW A;  4IUQ A;  3BY7 A;  4JLG A;  4FL6 A;  5IT9 E;  4LD9 K;  2COZ A;  2LJ3 A;  1WHL A;  2YSQ A;  4BCM B;  2RJD A;  3CME Q;  1SKU B;  2ABL A;  3O8V A;  3OB9 A;  5IAY A;  3VS6 A;  2VYT A;  5CR2 A;  1WHM A;  1BKB A;  3PGG A;  3EH1 A;  2PVG B;  1GRI A;  3VU3 C;  1W2B P;  1VQ7 A;  4C8Q A;  2DER A;  4OMQ A;  1TOV A;  1UNL D;  2JZ2 A;  2LQ8 A;  3M53 A;  2QAZ A;  4CC4 B;  1UNH D;  4WF2 A;  4RKU E;  1VYW B;  2RF0 A;  1ZUK A;  2CGH A;  2VGM A;  1WNL A;  2L3P A;  2RB6 A;  5GAO n;  2QQS A;  1WA7 A;  2FZK B;  1ZSZ C;  5FRO A;  3VJP A;  2W99 A;  3AT1 B;  1SRM A;  2V1R A;  3EFR A;  4CFU D;  1M90 U;  3REB B;  1PD1 A;  1K4U S;  1JQQ A;  4ZTF A;  5I11 A;  2BIV A;  1WHK A;  2WJ9 A;  1N27 A;  2X9H A;  1K9M C;  2EIF A;  3L2Z A;  4II5 B;  4JLI A;  1IGQ A;  4AFS C;  5IDN B;  1M8M A;  3CCJ T;  5AT1 B;  2DRM A;  2EQM A;  2A0F B;  3BHT B;  1Y07 A;  3P8H A;  1QCN A;  3DB4 A;  4F7U F;  4BCM D;  1BI2 A;  1GUX B;  2OTL T;  4PFP A;  2RJF A;  3OW2 P;  5CKB A;  1JO8 A;  2JOY A;  4OMO A;  1X2K A;  2KR3 A;  1OEB A;  2RQU A;  4F7L B;  2PVO B;  4LDU A;  1UDL A;  3MO8 A;  4HVW A;  3QKJ A;  3ZEH A;  2RHX A;  3JCM X;  3OYN A;  1VQM T;  5LL6 S;  2QDJ A;  4E7J A;  1AD6 A;  2D8J A;  1F5Q B;  3UPU A;  5IHY A;  2DZC A;  4XTX A;  3MY5 B;  5D6Y A;  4EOM B;  3CMA Q;  3OYF A;  2XMF A;  2DIG A;  3PFS A;  4AKH A;  4EOJ B;  3RKW A;  1M9S A;  3CXC P;  2VXE A;  2L3Q A;  5I2M A;  2O4X B;  2WMA B;  2QQR A;  3RBB B;  1SSF A;  4WCI A;  1D0Y A;  2MYS A;  4ZGJ B;  2BTT A;  3I55 Q;  9ATC B;  1BB9 A;  1PG5 B;  3KBG A;  1N5Z A;  3UT1 A;  1WHH A;  1ZP2 A;  3I56 A;  3CD6 T;  2RPN A;  3A98 A;  1QP3 A;  2K9G A;  5EG2 A;  2GNC A;  2Y90 A;  1RUW A;  2GCX A;  1XNI A;  4TTH A;  5GMK j;  4XK8 E;  3CCR Q;  2WMB B;  4L6V 5;  5GAM j;  1GBQ A;  2YRV A;  4F14 A;  4BCQ B;  4V2S A;  2YRD A;  3MEA A;  1RAH B;  1CSK A;  1KG1 A;  3P8D A;  5AYF A;  4C5H A;  1NE8 A;  2ENM A;  4JRQ A;  5GAO m;  1E7O A;  4F7S B;  2DPP B;  2RNA A;  1OQK A;  1X75 C;  3CCQ Q;  1I07 A;  1YJ9 A;  4IKF A;  1FXX A;  4HCZ A;  1UJY A;  2E5Q A;  4J9C A;  4JRK A;  3OS0 A;  2DTI A;  2OTJ Q;  2FYK A;  2D1X A;  4M7A A;  3GF5 A;  3V7S A;  4BCF B;  1VQO T;  2NUT A;  2DBK A;  4M7D F;  4C8Q D;  3DTO A;  4IIO A;  1QMC A;  5GAM h;  2OX7 A;  1MMD A;  2M0O A;  1D3B A;  4OGE A;  3QII A;  2JM8 A;  3JCM d;  1GH6 B;  1RAB B;  1BI1 A;  1W1F A;  3OS2 A;  3EGD B;  2E5K A;  1RAI B;  3E19 A;  2CP7 A;  2RO0 A;  2K2V A;  4OF1 A;  3F70 A;  4HA8 A;  4M78 F;  4KGZ B;  5IHK A;  5LJ3 g;  2KMG A;  3DDP B;  4EON B;  2DXB B;  2QQB A;  2FPF A;  4B9X A;  5KE2 A;  2CZ6 B;  3A8O B;  5KYX B;  3LWH A;  2BKD N;  3HRU A;  1X6G A;  3RMQ A;  4BCG B;  1NZ9 A;  1YIJ T;  2HBP A;  1QQJ A;  4RTZ A;  1UGR B;  3CCU T;  1YIT T;  2EKO A;  4ZNX A;  3G6E Q;  3QBY A;  3EGD A;  2D0N A;  2LVM A;  3NPF A;  1PSF A;  3G4S A;  2OTL A;  2WIP B;  2VVK A;  4LD6 A;  3PVL A;  1QLB A;  2MIO A;  5IN1 A;  4GY5 A;  1JSU B;  4J8O A;  4YOZ A;  4M6V A;  4N0A C;  4E2F B;  2E41 A;  3QYH B;  2GQV A;  5HBE B;  3PIP A;  4JX5 A;  3CC4 Q;  2GF7 A;  1TXQ A;  2W0Z A;  4ZN3 A;  4BE0 A;  1M1K U;  2JJ9 A;  5IXF A;  4ROC A;  1AT1 B;  2EFI A;  1B34 B;  5GAN d;  1WLP B;  1NPP A;  2D9T A;  4E7I A;  3CCU A;  1YIT A;  2BKZ B;  2B9R A;  3PTA A;  4R56 A;  1YFN A;  2X4W A;  1WI7 A;  5GAN 6;  3G71 A;  1RLP C;  2EGC A;  2NLU A;  1MND A;  4J7F A;  3CCE Q;  4AKI A;  2IN3 A;  2C6T B;  2XU8 A;  3M0P A;  3VYH B;  3JCM h;  1IXD A;  2C5O B;  2XK0 A;  4PJO E;  4BCP B;  4KGV B;  2LNH B;  3GLX A;  3CC7 Q;  4M75 B;  5HNB B;  1FMK A;  1N6A A;  3N5B B;  1YCY A;  1UGP B;  2CZ0 B;  2K4Y A;  5GAO q;  5CK9 A;  4I3Z B;  4AFU C;  1WJQ A;  3THK A;  4X1V A;  3UA7 A;  1G3T A;  2O88 A;  1I8F A;  1G3N C;  1QCF A;  2DXC B;  3MEW A;  2CH4 W;  5IHN A;  3TCJ A;  1I4K 1;  2FZC B;  1VQK A;  1Q7Y U;  1KJW A;  2RQT A;  2L5Q A;  3DKM A;  2ROL A;  4Y72 B;  3E9G A;  5GAN h;  5CKH A;  1XQH A;  1YWO A;  1YIJ A;  2VWF A;  4JX4 A;  3QXE B;  4ZTJ A;  1YI2 A;  2RHI A;  2DTO A;  2CUB A;  3QWX X;  1HK9 A;  2CUD A;  1X6O A;  2WSE E;  2COY A;  2MWO A;  3CCU Q;  1YIT Q;  1I5L A;  4AFZ C;  3QPH A;  3UF4 A;  2D6F A;  2QG9 B;  3EAE A;  1X27 A;  1VQ4 T;  1UGQ B;  2DA9 A;  3S3N A;  2X4X A;  3RGF B;  3G6E T;  2QXF A;  3I5S A;  5EFQ B;  5KE3 A;  4M75 C;  4F17 A;  2GFA A;  4BCJ B;  4FSX A;  2DE0 X;  1K1Z A;  2DLP A;  4BDZ A;  4KUD K;  2J05 A;  5FLX E;  4F7N B;  3CC4 A;  2CKK A;  2M51 A;  3I9Q A;  2YT6 A;  2DL7 A;  2E70 A;  3H8Z A;  5HCK A;  3BG5 A;  2BE7 D;  1PWT A;  1M1K C;  3QUI A;  2P4R A;  1OIU B;  1NJI R;  4PJO B;  3G4S Q;  4A4K A;  4J9E A;  2DMO A;  2KT1 A;  3VKI A;  4ELZ C;  2CT3 A;  2LCC A;  1VQN Q;  4CFN B;  3UWN A;  1E6H A;  4PJL A;  3V7R A;  5GAN g;  4A53 A;  4II1 A;  1BI3 A;  3CCE T;  3H6Z A;  1BCM A;  2KT8 A;  3QYG B;  2C0I A;  1M30 A;  2MI6 A;  4FYV B;  3M5A A;  3OYA A;  2P0P A;  2V22 B;  1MGQ A;  1OU8 A;  1MV3 A;  2DZ9 A;  2C5X B;  2EKH A;  4FYY B;  2VV5 A;  3LLR A;  2WXV B;  2PQW A;  1OX8 A;  4D8K A;  2NUP B;  3ULR B;  1H27 B;  3BFM A;  1AZE A;  4OGR B;  3A1P A;  2MCN A;  4ZGE B;  5CVI A;  3DLM A;  1BBZ A;  4CC3 A;  1WZO A;  3CCS A;  5CIU A;  2NUT B;  1WQ7 A;  3OYC A;  1G8X A;  5I21 A;  3U23 A;  1H25 B;  1D0X A;  1D3B B;  2CSI A;  1FWZ A;  2JXB A;  2QA4 Q;  2X4Y A;  3P8B B;  1ZQ1 A;  2QGG A;  4DEX A;  4JX6 A;  4UC4 A;  3QYB A;  4BCN D;  1JBM A;  3G33 B;  4EMK C;  1GL5 A;  4KT0 E;  2WPA B;  1VQK T;  2E12 A;  5GMK l;  5CYI B;  3HBL A;  1VYV A;  1PNJ A;  3I56 T;  1X2Q A;  8AT1 B;  1V1C A;  3L2V A;  4JPB W;  2UZB B;  3VS1 A;  1LJO A;  2EUF A;  2LJ1 A;  1IHW A;  3E1S A;  3L2Q A;  3CCQ T;  1YP5 A;  2O4X A;  4IUU A;  1YIJ Q;  1H8K A;  4ORZ A;  3NTI A;  1M2O A;  4BY6 B;  4ZN1 A;  2EYW A;  4MFD A;  4JJB A;  3I5R A;  3KUF A;  5FRN A;  1Q7Y C;  1Q82 R;  1G3S A;  2P0K A;  4BBS M;  1Y71 A;  4XU3 A;  2IPO B;  1I5O B;  2X3W D;  1I1J A;  5GJV B;  4HLQ A;  1VUB A;  1UHF A;  4RTT A;  2YHT A;  4M78 D;  5C6S A;  1X6B A;  3CMA A;  2EYX A;  4PJO C;  2H3J A;  4JZ4 A;  5IH2 A;  1U3O A;  3CCJ Q;  1XO2 A;  5EC7 A;  4UN0 A;  1FVV B;  5GMK i;  1TFB A;  1FYN A;  2RHZ A;  5IXB A;  1K8A U;  1VQP A;  2DD5 A;  2FEI A;  3GTM S;  5KCH A;  4MMK A;  3JCM P;  3VS7 A;  4XTU A;  1JKW A;  1M3B A;  1UUE A;  4VUB A;  2E3I A;  2VC8 A;  2X1N B;  1GCP A;  1ZBJ A;  3OBY A;  3TNH B;  3OYD A;  4EOP B;  1AWJ A;  2CH4 A;  5DLO A;  2QDY B;  3EG9 B;  4M7D E;  1HYO A;  1EX4 A;  2FL7 A;  2G3R A;  2DIQ A;  5GAN 7;  4QVZ A;  3HTR A;  1PKT A;  2ED0 A;  2RQR A;  2DXT A;  2ZGW A;  4BI4 A;  3PMI A;  4F16 A;  2ZPI B;  1PRL C;  3VKG A;  3J81 E;  5IF1 B;  2LX7 A;  4M7D A;  4C5E A;  2K3X A;  1IGU A;  4AG2 C;  3X20 B;  3PVQ A;  1UHC A;  2EBP A;  3B57 A;  1Q81 R;  3BE3 A;  3DL1 A;  2JMC A;  4J5Y A;  2WAC A;  1NLO C;  5GAN 3;  2AZS A;  2QEX A;  1RAG B;  3NMZ C;  4C0Z A; 
#chains in the Genus database with same CATH homology
 2LX9 A;  3ZEH A;  3MO8 A;  3JCM X;  3QKJ A;  3OYN A;  2RHX A;  1VQM T;  3L42 A;  1WGS A;  2ZPB B;  5LL6 S;  4MZT A;  2QQA A;  3RIR A;  2QDJ A;  3Q1J A;  1YHQ A;  2F5K A;  1NPR A;  2JVV A;  4E7J A;  1FX7 A;  2XG8 D;  3JRZ A;  3H4C A;  3C95 A;  1KC8 U;  3UPU A;  4J6Y A;  2DZC A;  4NL2 A;  5CKE A;  4XTX A;  1X01 A;  5D6Y A;  4HCB A;  4C92 C;  4M77 B;  4N4H A;  2KR6 A;  1R8O B;  2XID A;  4O6J A;  3OYF A;  2DIG A;  3PFS A;  4AKH A;  3RKW A;  1M9S A;  5GAO r;  2I2L A;  1N9S A;  2VXE A;  5I2M A;  4PL6 A;  2O4X B;  2QQR A;  2ZZD A;  1SSF A;  3SWN C;  2KY9 A;  4M7A C;  4M77 C;  3OS1 A;  1BI0 A;  5A0G A;  2DVE A;  4BE1 A;  4AKG A;  4ZGJ B;  3LX7 A;  4IUV A;  5CKF A;  2EWN A;  1Q81 C;  2KK4 A;  1W2B A;  1VQ7 T;  4ATO A;  3KBG A;  4M75 D;  3C4S A;  3UT1 A;  3MEU A;  3CPW A;  3L2W A;  3I56 A;  1VQ8 A;  3CD6 T;  4LDY A;  5CKD A;  3JCM W;  3QHS A;  4HT9 A;  3V8J A;  5LJ5 f;  1QP3 A;  3L1A A;  3UDC A;  3LH0 A;  2KDS A;  5EG2 A;  4XTV A;  2Y90 A;  2FHD A;  5GAN j;  5A2Q E;  1K73 U;  3VYG A;  3VKH A;  1XNI A;  2GCX A;  4KBM B;  5GMK j;  4XK8 E;  5DM7 R;  4MIM A;  4Z6Y A;  2V8J A;  3CBO A;  2M16 A;  1VQN A;  2RJE A;  2DXC A;  4L6V 5;  5GAM j;  2LQK A;  3RUX A;  1OYX A;  5A0L A;  3I55 T;  2YRV A;  4HNU A;  4QW2 A;  3OMG A;  3OQ5 A;  5LJ5 g;  4V2S A;  3MEA A;  3OSS C;  2RM4 A;  4PNO A;  2VUB A;  4Y91 A;  4F7U E;  4XU2 A;  1KG1 A;  3P8D A;  5AYF A;  4C5H A;  1NE8 A;  4F7U B;  4JRQ A;  4CI0 C;  1P92 A;  5GAO m;  4XU1 A;  1KHI A;  2DPP B;  1X75 C;  2QQ9 A;  1YJ9 A;  3CPF A;  2JN0 A;  1FXX A;  3ASK A;  3C94 A;  3JCM V;  4BY6 C;  2M9U A;  5LJ5 h;  3JB9 D;  4HCZ A;  1N8R C;  4M7A B;  3QYE A;  1B34 A;  3PNW C;  1HXD A;  5CQY A;  2E5Q A;  3ER0 A;  3QZ9 B;  1YJN A;  4R55 A;  4JRK A;  5GMK m;  2BS2 A;  1WQW A;  2HNI A;  3OS0 A;  1KD1 C;  4PJO D;  4RG8 A;  3SD4 A;  4F7U A;  3CD6 A;  2DTI A;  3LWI A;  4DA4 A;  2FYK A;  4XAX B;  4M7A A;  4M78 C;  3GF5 A;  4PKC C;  3V7S A;  1VQO T;  3CBP A;  2FB7 A;  5GAN 8;  3DLL A;  4M7D F;  4C8Q D;  1M1F A;  4RCB A;  4YTL A;  3OBW A;  4OGC A;  1KQS S;  4OB2 B;  3HHT B;  5GAM h;  1XTD A;  2M0O A;  1FKM A;  3WVD B;  1D3B A;  4OGE A;  3QII A;  4PJO A;  2GFU A;  2RD1 A;  3A8G B;  1DJ7 B;  3JCM d;  4M7A E;  1BI1 A;  3OS2 A;  5GAN 2;  4KUI A;  3FJP A;  3E19 A;  4M7D C;  2RO0 A;  2K2V A;  5LJ3 e;  4OF1 A;  3F70 A;  5CO7 A;  4QSH A;  4E7H A;  5CCA A;  4OVA A;  4HA8 A;  4M78 F;  3TW6 A;  5LJ3 g;  2KMG A;  3OS5 A;  3M57 A;  3T9N A;  2F69 A;  2DXB B;  2RK2 A;  4IUR A;  2MWP A;  1M1G A;  2QQB A;  4B9X A;  5KE2 A;  2CZ6 B;  3A8O B;  4MDW A;  4AI6 A;  5DY9 A;  3LWH A;  3CCJ A;  1VQ5 A;  4J83 A;  4MML A;  2BKD N;  4FT4 A;  4BI3 A;  2DXB A;  1IZ6 A;  2B8A A;  3HRU A;  4N4I A;  4Z02 A;  5LJ3 h;  2EYQ A;  3RMQ A;  2VXF A;  1NZ9 A;  1YIJ T;  2HBP A;  4XTY A;  1UGR B;  4C0D C;  3CCU T;  1TH7 A;  1YIT T;  3OYE A;  1QVF A;  2EKO A;  3FC3 A;  3PT9 A;  4JDS A;  3CCV A;  4F7U G;  2C06 A;  1I81 A;  2EQJ A;  3QBY A;  4BAC A;  3MP8 A;  2LVM A;  4FT2 A;  1PSF A;  4BD3 A;  5D6W A;  4C0G A;  5GAM e;  2PUK B;  4LD6 A;  3CXC A;  2OTL A;  2HD0 A;  2WSC E;  4EDU A;  4XTZ A;  2LT4 A;  3L2R A;  2QF7 A;  4JS5 A;  1VQP T;  3MET A;  1BIB A;  4B9W A;  1QLB A;  4BE2 A;  5IN1 A;  3RES A;  3M59 A;  4GY5 A;  3V8L A;  4EMG A;  1N9R A;  4J8O A;  1V29 B;  3MP6 A;  3JB9 J;  4M6V A;  4N0A C;  3ME9 A;  2E41 A;  3QYH B;  3OMC A;  2GQV A;  3GOX A;  4KUL A;  3PIP A;  4JX5 A;  3A8L B;  1RL2 A;  2GF7 A;  4EMK A;  4ZN3 A;  2LTO A;  2IVW A;  3TRE A;  4BE0 A;  2DXU A;  1WJR A;  2EJG A;  2JTF A;  3NFC A;  1M1K U;  3TEE A;  4X9C A;  3QG1 A;  3CPW S;  2LCL A;  2EFI A;  2K3Y A;  1B34 B;  4A54 A;  4HKE A;  5LJ5 d;  5GAN d;  2ZPF B;  3CMA T;  1NPP A;  2DKG A;  3TU4 K;  2D9T A;  4E7I A;  3CCU A;  1YIT A;  2RK1 A;  2X4J A;  2KVQ G;  3PTA A;  3FIF A;  4HL4 A;  4R56 A;  3HB9 A;  2WSF E;  1VQO A;  4BUG A;  3LGF A;  2X4W A;  5GAO l;  5GAN 6;  3M55 A;  3G71 A;  4C92 F;  2NLU A;  4OB1 B;  2BS3 A;  1YBY A;  5CQX A;  3HKS A;  4NOY A;  3JCM J;  3QO3 A;  4J7F A;  3SWN B;  4RMO A;  4AKI A;  3CC4 T;  2M1H A;  2XU8 A;  3JB9 F;  1VQ8 T;  3CCS T;  2QFZ A;  3VYH B;  3JCM h;  4FIB A;  5FU7 B;  4HNT A;  2XK0 A;  4EPC A;  2DD5 B;  3HL8 A;  5KH6 A;  3JCM e;  1QVF S;  4BB7 A;  3QDR B;  4M75 E;  3CME A;  3S3O A;  3GLX A;  1IRE B;  1KHC A;  2YLB A;  4M75 B;  1GXI E;  1LNX A;  3CXC S;  1G3Y A;  3JAM E;  5DLQ E;  4J6W A;  1U1T A;  1N6A A;  2E6N A;  1YCY A;  3N5B B;  1UGP B;  4P5N A;  4A4F A;  5GAN e;  2CZ0 B;  4IUT A;  1UGS B;  2DTH A;  2K4Y A;  5I2S A;  5LJ5 e;  5CK9 A;  2VGN A;  2PUO B;  5GAO q;  4M7D D;  3X28 B;  1M5Q 1;  1WJQ A;  5KCO A;  4BDY A;  1S72 T;  3CC2 T;  3I55 A;  3QZ5 B;  1O9S A;  1H64 1;  4M77 F;  4M75 A;  1G3T A;  2YLC A;  4HT8 A;  4M7A F;  1I8F A;  1YJ9 T;  1KQS A;  2DXC B;  5FU6 B;  2A3L A;  3MEW A;  2A7Y A;  2V8K A;  3JSC A;  3TCJ A;  3MHX A;  1I4K 1;  1VQK A;  1Q7Y U;  1YJN T;  2DO3 A;  2L5Q A;  4PJO G;  3DKM A;  3L2U A;  3VV0 A;  1U8R A;  2XKO C;  1MHN A;  3E9G A;  3SDZ A;  3LGL A;  5GAN h;  3LYI A;  5CKH A;  4FU6 A;  3X26 B;  1JB0 E;  1XQH A;  3VUB A;  2JUF A;  2Y4X A;  1YIJ A;  5GAM d;  2RI3 A;  1AHJ B;  2XIC A;  2KSS A;  3OW2 S;  4NL3 A;  4JX4 A;  3OYK A;  2RHY A;  1KQ2 A;  1LOJ A;  2K57 A;  4CRI A;  2JNG A;  1NJI C;  3QXE B;  4ZTJ A;  1W4S A;  1YI2 A;  3QSU A;  3SWN A;  2AHJ B;  2DEQ A;  2RHI A;  3GIB A;  2DTO A;  3EFS A;  3G4S A;  1JJ2 S;  4HCC A;  1HK9 A;  1X6O A;  2WSE E;  4HNV A;  3JCM c;  2MWO A;  2KAF A;  1I5L A;  4LOC A;  3CC7 T;  3QPH A;  1M90 C;  4ELY C;  2D6F A;  1OI1 A;  3CCR A;  3LW5 E;  3JCM b;  4C0D B;  5FRM A;  4M7A G;  3EAE A;  3OYJ A;  2V8I A;  1VQ4 T;  3WXM B;  1UGQ B;  3S3N A;  2HAX A;  2X4X A;  1Y96 A;  5LJ3 d;  2XD0 A;  3G6E T;  3QWL A;  2QXF A;  1K8A C;  3M9Q A;  2R5A A;  4BBR M;  4M75 G;  3VYG B;  5KE3 A;  4D6W A;  2CZ7 B;  4FM4 B;  4EMK B;  4M75 C;  3RER A;  4C8Q C;  2GFA A;  1VQ5 T;  1WJS A;  4FSX A;  2E65 A;  4BDZ A;  4KUD K;  5FLX E;  1VQ6 T;  4DQ2 A;  5GAM g;  4PJO F;  3FB9 A;  4RCC A;  2L8D A;  2QTX A;  3VUZ A;  1PSE A;  4JS4 A;  4E7K A;  3CC4 A;  3M4Y A;  4X34 A;  4MFE A;  3JCM f;  2CKK A;  2QQ8 A;  4OMF B;  3TW7 A;  2E70 A;  3H8Z A;  3BG5 A;  2HQX A;  2DJZ A;  2PU9 B;  3CCQ A;  2CS7 A;  2BUD A;  2XHC A;  5GAO p;  2QI2 A;  3QUI A;  5A0D A;  1M1K C;  3JB9 H;  2ZZD B;  3GPL A;  3OYM A;  1VQ9 T;  2KQW A;  4PJO B;  5GAN f;  2RI5 A;  3CME T;  2X35 A;  4A4K A;  2K5I A;  5EJC A;  2E6Z A;  2E10 A;  4C92 D;  4M7D B;  3VKI A;  3HP9 A;  4ELZ C;  1JRI A;  5LJ3 j;  1M4Z A;  3AHU A;  1BIA A;  2LCC A;  3FRN A;  5GAM f;  1YJW A;  3C12 A;  4O5V A;  1RI0 A;  3V7C A;  2Y4Y A;  3UWN A;  4J6X A;  3OSV A;  3V7R A;  2HQE A;  3BDU A;  4E7L A;  1EIF A;  3HRS A;  1S72 A;  1ZHI A;  1G3W A;  4ME7 A;  4M78 G;  5GAN g;  4A53 A;  4II1 A;  4X9D A;  1BI3 A;  3CCE T;  3H6Z A;  3J80 E;  4XQ3 A;  4C92 E;  4JUV A;  1Q86 C;  3QYG B;  5FU7 C;  4C92 G;  2MI6 A;  1QP2 A;  3M5A A;  3OYA A;  2P0P A;  3OA6 A;  3CCL T;  3FLG A;  2RJC A;  5HKC A;  1MGQ A;  3KHI A;  3GNF B;  2DZ9 A;  4MZP A;  4M77 D;  4M7A D;  2VV5 A;  4N4G A;  4QQG A;  3J7A F;  4M77 E;  3LLR A;  2O01 E;  3OYH A;  1VIF A;  3A5Z B;  4M77 G;  4M7D G;  2MF2 A;  2PQW A;  5M9O A;  3BW1 A;  3BG9 A;  3ZFJ A;  3JCM g;  5GMK h;  3NTK A;  4OP0 A;  3OY9 A;  1Q82 C;  1QVG S;  4DOV A;  4M78 A;  2P4T A;  3M56 A;  4L5G A;  3HRT A;  4C8Q E;  4OB3 B;  3CCM T;  2LNV A;  3PIO A;  3BFM A;  3QJ6 A;  3G4S T;  1VQ4 A;  4C92 A;  4ZGE B;  2LT1 A;  3DLM A;  5CVI A;  3CC7 A;  1Y96 B;  3RKX A;  5HY6 A;  5L8R E;  3CCS A;  5CIU A;  1N8R U;  2CYZ B;  1WQ7 A;  3OYC A;  1G5V A;  3BG3 A;  4MZM A;  5I21 A;  3CCE A;  3GP8 A;  3A8H B;  3CC2 A;  3X25 B;  2R57 A;  1JJ2 A;  1D3B B;  3HFO A;  1FWZ A;  4PLI A;  1VIE A;  2FVU A;  5CAI A;  2DD4 B;  2X4Y A;  3P8B B;  4MDX A;  1ZQ1 A;  1U1S A;  3M58 A;  5LJ3 f;  3OYL A;  1QVP A;  3V8K A;  4JX6 A;  4UC4 A;  1KD1 U;  3QYB A;  1JBM A;  3MP1 A;  4XTW A;  4BI8 B;  4EMK C;  4NS5 A;  3G7Z A;  2MMP A;  4KT0 E;  2LDM A;  3FDR A;  3A8M B;  3HZJ A;  1BYM A;  2ZCF B;  1VQK T;  2E12 A;  4QQ6 A;  5GMK l;  3HBL A;  3URG A;  3CBM A;  3RKY A;  4QVC A;  3OYY A;  3M54 A;  3I56 T;  3L2V A;  1W2B S;  1Q86 U;  1VQL T;  5J26 A;  1LJO A;  4M78 B;  3E1S A;  4LDV A;  1NJI U;  3L2Q A;  2RA2 A;  3ZBD A;  4QQD A;  4NC6 A;  3CCQ T;  2EQK A;  4JRI A;  2O4X A;  4IUP A;  3CCM A;  4IUU A;  2ZPE B;  3G71 T;  1H3Z A;  4C92 B;  3E9F A;  1KQ1 A;  4A4H A;  3NTI A;  3GNG A;  2L3R A;  2PVD B;  4BY6 B;  4ZN1 A;  4LDX A;  5GMK e;  2XDD A;  4TVR A;  2QEX T;  4E47 A;  4MFD A;  4ELJ A;  3KUF A;  3MEV A;  5FRN A;  1Q7Y C;  2QA4 T;  2MAM A;  1G3S A;  2P0K A;  4BBS M;  1Y71 A;  2K5F A;  3BDL A;  4XU3 A;  4GLK A;  1K9M U;  2P0Q A;  3CEY A;  1QVG A;  5D6X A;  2E64 A;  4HLQ A;  3CCR T;  2DD4 A;  3JCM Q;  1VUB A;  2BS4 A;  3G6E A;  4LDW A;  3SB2 A;  2YHT A;  3OYG A;  4IUQ A;  1VQM A;  5LJ5 j;  3BY7 A;  4JLG A;  4FL6 A;  4M78 D;  4Q5W A;  5HK0 A;  5IT9 E;  1YHQ T;  2RHU A;  5C6S A;  1Q82 U;  4IKF A;  3MCA B;  3CMA A;  1K73 C;  3PMT A;  2EAY A;  1UEB A;  4LD9 K;  4PJO C;  3JB9 G;  2OTJ T;  2H3J A;  4DOW A;  1VQL A;  3FEO A;  4L59 A;  2RJD A;  4ZGD B;  3CCL A;  3WVE B;  2JTM A;  4JRP A;  2XI9 A;  2DAQ A;  3O8V A;  2RI2 A;  3OB9 A;  4M75 F;  4M77 A;  5IAY A;  4C8Q B;  2VYT A;  5GMK i;  5GAN 4;  3KXT A;  4A4E A;  2RHZ A;  1Q81 U;  3QJY A;  5CR2 A;  1BKB A;  3S3M A;  1M8V A;  3PGG A;  4N0A A;  1K8A U;  2PVG B;  1VQ6 A;  2DK3 A;  2DD5 A;  4M78 E;  3VU3 C;  1VQP A;  1VQ7 A;  4C8Q A;  1VQ9 A;  2EJF A;  1QW1 A;  3M4G A;  2E1H A;  5KCH A;  2IG0 A;  4MMK A;  3JCM P;  3HO8 A;  2QA4 A;  2JZ2 A;  2LQ8 A;  3M53 A;  5J39 A;  4J7I A;  3OYB A;  4PLL A;  4XTU A;  4WF2 A;  4RKU E;  4VUB A;  1XOV A;  2VC8 A;  1YI2 T;  1VQN T;  3HPW A;  2CGH A;  3RMS A;  3OBY A;  1ZBX A;  2VGM A;  1WNL A;  2RB6 A;  5GAO n;  3OYD A;  2QQS A;  5C0M A;  1YJW T;  1KC8 C;  5DLO A;  2QDY B;  2K5L A;  5GAN 5;  2ZPG B;  1UB4 A;  5FRO A;  4M7D E;  3VJP A;  1Y7X A;  2FL7 A;  2G3R A;  4JJN K;  2G77 A;  3EFR A;  2DIQ A;  2OTJ A;  5GAN 7;  4QVZ A;  1M90 U;  3JB9 I;  2D0Q B;  4ZTF A;  3DB3 A;  3S6W A;  3HFN A;  4PJO E;  2BIV A;  2DXT A;  2ZGW A;  1E7P A;  1O75 A;  4BI4 A;  5HK3 A;  2WJ9 A;  3PMI A;  2ZPH B;  2ZPI B;  1N27 A;  1OZ2 A;  1K9M C;  2EIF A;  3L2Z A;  2XDB A;  3X24 B;  3VKG A;  3J81 E;  4JLI A;  4C8Q F;  4A4G A;  3OYI A;  4M7D A;  4C5E A;  2K3X A;  2LC4 A;  2LRQ A;  4EMH A;  3CCJ T;  3X20 B;  5J3B A;  3SFM A;  3R6O A;  3OW2 A;  2CZ1 B;  2EQM A;  2R5M A;  4XU0 A;  2KMT A;  4C5I A;  4QVD A;  1Y07 A;  1OZ3 A;  3P8H A;  5FU6 C;  3DB4 A;  3INZ A;  3DL1 A;  4F7U F;  3CCV T;  2L89 A;  1BI2 A;  4OB0 B;  1WPY A;  2EQU A;  2EJ9 A;  2OAU A;  4C5G A;  4J5Y A;  2OTL T;  2R58 A;  2RJF A;  2WAC A;  4Y28 E;  5CKB A;  2JOY A;  3NTH A;  2RH2 A;  2F5T X;  2XDP A;  4RG2 A;  4C0F A;  5GAN 3;  2QEX A;  3HSB A;  4LDU A;  2PVO B;  4C8Q G;  4C0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...