2AHLB

Crystal structure of the hydroxylamine-induced deoxy-form of the copper-bound streptomyces castaneoglobisporus tyrosinase in complex with a caddie protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
71
Chain Sequence
AAPESFDEVYKGRRIQGRPAGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINASE
publication title Crystallographic Evidence That the Dinuclear Copper Center of Tyrosinase Is Flexible during Catalysis
pubmed doi rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 16
structure length 71
sequence length 82
ec nomenclature
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 2ahlB01
3AWZB 2JV8A 3AX0B 3AWUB 2AHLB 3AWVB 2ZMZB 2ZMXB 2ZWDB 3AWXB 2AHKB 2ZWGB 1WX4B 1WX2B 1WXCB 2ZWFB 2ZWEB 3AWTB 2ZMYB 3AWSB 1WX5B 3AWWB 3AWYB
chains in the Genus database with same CATH superfamily
4NBCA 3AWZB 2DE7A 2JV8A 3AX0B 2DE5A 3AWUB 4NBBA 4NBEA 3GCFA 2AHLB 3AWVB 2ZMZB 2ZMXB 2ZWDB 1Z03A 3AWXB 3GKQA 4NBDA 2AHKB 3VMHA 1WW9A 2ZWGB 3VMIA 3VMGA 4NBHA 1WX4B 1WX2B 2DE6A 1WXCB 2ZWFB 2ZWEB 4NBFA 4NB8A 4NBGA 4NB9A 3AWTB 2ZMYB 1Z02A 4NBAA 3AWSB 1WX5B 1Z01A 3AWWB 3AWYB
chains in the Genus database with same CATH topology
3AWZB 2JV8A 3AX0B 3AWUB 2AHLB 3AWVB 2ZMZB 2ZMXB 2ZWDB 3AWXB 2AHKB 2ZWGB 1WX4B 1WX2B 1WXCB 2ZWFB 2ZWEB 3AWTB 2ZMYB 3AWSB 1WX5B 3AWWB 3AWYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AWZ B;  2JV8 A;  3AX0 B;  3AWU B;  2AHL B;  3AWV B;  2ZMZ B;  2ZMX B;  2ZWD B;  3AWX B;  2AHK B;  2ZWG B;  1WX4 B;  1WX2 B;  1WXC B;  2ZWF B;  2ZWE B;  3AWT B;  2ZMY B;  3AWS B;  1WX5 B;  3AWW B;  3AWY B; 
#chains in the Genus database with same CATH topology
 4NBC A;  3AWZ B;  2DE7 A;  2JV8 A;  3AX0 B;  2DE5 A;  3AWU B;  4NBB A;  4NBE A;  3GCF A;  2AHL B;  3AWV B;  2ZMZ B;  2ZMX B;  2ZWD B;  1Z03 A;  3AWX B;  3GKQ A;  4NBD A;  2AHK B;  3VMH A;  1WW9 A;  2ZWG B;  3VMI A;  3VMG A;  4NBH A;  1WX4 B;  1WX2 B;  2DE6 A;  1WXC B;  2ZWF B;  2ZWE B;  4NBF A;  4NB8 A;  4NBG A;  4NB9 A;  3AWT B;  2ZMY B;  1Z02 A;  4NBA A;  3AWS B;  1WX5 B;  1Z01 A;  3AWW B;  3AWY B; 
#chains in the Genus database with same CATH homology
 3AWZ B;  2JV8 A;  3AX0 B;  3AWU B;  2AHL B;  3AWV B;  2ZMZ B;  2ZMX B;  2ZWD B;  3AWX B;  2AHK B;  2ZWG B;  1WX4 B;  1WX2 B;  1WXC B;  2ZWF B;  2ZWE B;  3AWT B;  2ZMY B;  3AWS B;  1WX5 B;  3AWW B;  3AWY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...