2AHLB

Crystal structure of the hydroxylamine-induced deoxy-form of the copper-bound streptomyces castaneoglobisporus tyrosinase in complex with a caddie protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
71
Chain Sequence
b'AAPESFDEVYKGRRIQGRPAGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINASE
publication title Crystallographic Evidence That the Dinuclear Copper Center of Tyrosinase Is Flexible during Catalysis
pubmed doi rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 16
structure length 71
sequence length 82
ec nomenclature
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 2ahlB01
3AWSB 2ZMXB 2ZWDB 3AWUB 3AWXB 1WX5B 2JV8A 3AWVB 3AWTB 3AX0B 2AHKB 2ZWGB 2ZWFB 3AWZB 2ZMZB 1WXCB 2AHLB 1WX2B 3AWYB 2ZWEB 2ZMYB 3AWWB 1WX4B
chains in the Genus database with same CATH superfamily
4NBHA 3AWSB 4NBAA 4NBFA 2ZMXB 2ZWDB 3AWUB 3AWXB 1WX5B 2JV8A 3AWVB 3AWTB 3AX0B 4NBBA 3VMIA 2DE6A 4NB9A 4NBCA 1WW9A 1Z01A 1Z03A 1Z02A 2AHKB 2DE5A 3GCFA 2ZWGB 2ZWFB 3VMHA 4NB8A 3AWZB 3VMGA 2ZMZB 3GKQA 4NBEA 1WXCB 2AHLB 1WX2B 3AWYB 2ZWEB 2DE7A 4NBGA 4NBDA 2ZMYB 3AWWB 1WX4B
chains in the Genus database with same CATH topology
3AWSB 2ZMXB 2ZWDB 3AWUB 3AWXB 1WX5B 2JV8A 3AWVB 3AWTB 3AX0B 2AHKB 2ZWGB 2ZWFB 3AWZB 2ZMZB 1WXCB 2AHLB 1WX2B 3AWYB 2ZWEB 2ZMYB 3AWWB 1WX4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AWS B;  2ZMX B;  2ZWD B;  3AWU B;  3AWX B;  1WX5 B;  2JV8 A;  3AWV B;  3AWT B;  3AX0 B;  2AHK B;  2ZWG B;  2ZWF B;  3AWZ B;  2ZMZ B;  1WXC B;  2AHL B;  1WX2 B;  3AWY B;  2ZWE B;  2ZMY B;  3AWW B;  1WX4 B; 
#chains in the Genus database with same CATH topology
 4NBH A;  3AWS B;  4NBA A;  4NBF A;  2ZMX B;  2ZWD B;  3AWU B;  3AWX B;  1WX5 B;  2JV8 A;  3AWV B;  3AWT B;  3AX0 B;  4NBB A;  3VMI A;  2DE6 A;  4NB9 A;  4NBC A;  1WW9 A;  1Z01 A;  1Z03 A;  1Z02 A;  2AHK B;  2DE5 A;  3GCF A;  2ZWG B;  2ZWF B;  3VMH A;  4NB8 A;  3AWZ B;  3VMG A;  2ZMZ B;  3GKQ A;  4NBE A;  1WXC B;  2AHL B;  1WX2 B;  3AWY B;  2ZWE B;  2DE7 A;  4NBG A;  4NBD A;  2ZMY B;  3AWW B;  1WX4 B; 
#chains in the Genus database with same CATH homology
 3AWS B;  2ZMX B;  2ZWD B;  3AWU B;  3AWX B;  1WX5 B;  2JV8 A;  3AWV B;  3AWT B;  3AX0 B;  2AHK B;  2ZWG B;  2ZWF B;  3AWZ B;  2ZMZ B;  1WXC B;  2AHL B;  1WX2 B;  3AWY B;  2ZWE B;  2ZMY B;  3AWW B;  1WX4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...