2AHME

Crystal structure of sars-cov super complex of non-structural proteins: the hexadecamer
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
155
structure length
155
Chain Sequence
LKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab, light chain
publication title Insights into SARS-CoV transcription and replication from the structure of the nsp7-nsp8 hexadecamer
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein, replication
total genus 39
structure length 155
sequence length 155
chains with identical sequence F, G, H
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF08717 nsp8 nsp8 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.290 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2ahmE02
2AHME 3UB0A
chains in the Genus database with same CATH superfamily
3RU4E 1S82A 4I31A 3VB5A 3M3SA 1YPKH 3GYMA 4IN1A 1TNIA 4YZUA 1HGTH 2ZDLA 3BV9B 4GVUA 2UUKB 1G2LA 3RXHA 2KX4A 2BTCE 3SHAH 1GBTA 3SUFA 2O8LA 3OY6U 1ZOMA 1GJDB 3BTME 2GZ8A 3RLYH 1H8ED 2AEIH 2D8WA 2PLXA 1P9SA 2H9EH 1EP5A 1O2NA 1FNIA 1HIAB 3EE7A 2R3UA 5EXMA 4B71A 3RXCA 3N7OA 2FX6A 2XCNA 3TK9A 1IHSH 1VKYA 4ZKRU 1ZSJA 3GY2A 3WWFA 2HLDD 1VR1H 2W3IA 3GCOA 1T8MA 1A7SA 3A85A 4ABJA 3A86A 3GISB 1LVBA 1A61H 4UDWH 1W0YH 1O3HA 3D49H 1YPMH 1VJ9U 2DUCA 1C1RA 1EKBB 1OOKB 1D3QB 2G51A 1V2ST 4I8KA 2ZQ1A 1NS3A 3T26A 3P8NA 3P70B 1HXFH 3V13A 5FCKA 4PROA 1XKAC 3LGWA 1NRPH 1BQYA 2XBWA 3VB6A 4J1YA 4INLA 1UVOA 2J2UA 1C5UA 3OEHD 1YPGH 1P2IA 1L4ZA 4NA8A 8ESTE 1SGYE 4H6SB 4RKJB 2ZC9H 4AG1A 1VGCB 1CHGA 1TPAE 2OC1A 3A7XA 3Q3XA 1GVKB 3MH5A 1GHXH 1NT1A 4WMFA 2GMTC 2HVXA 2R0LA 5EJLA 1E79D 1O3JA 3KN2A 4MNVA 1LVMA 3VG8A 5IK2D 2ZU3A 1GI5A 4X6MA 8KME2 2XC4A 1C1SA 2J98A 1NZQH 1C9TA 2XRCA 3MNSA 1DSUA 3V0XA 2R2WU 2GGVB 3TLOA 3SI3H 1K28D 1GG6C 2FOBA 3T29A 3PTNA 3E91A 1DPOA 2R9PA 1EQ9A 2F4LA 3EA8A 2QF3A 4AFQA 1AB9C 2G5NA 3R0FA 1JIMA 1O36A 2BD5A 2P3UB 4Q4LA 5FXLA 1H9HE 4ZH8A 3FZDA 2Y7ZA 1EP6A 1G32B 1ZRKA 4IN2A 2GT8A 5AVDA 1GHAG 4OM9A 1BUIA 1W14U 3OAAD 6ESTA 1W0ZU 4Y10E 5A8YA 5EGMA 3H7OA 1A5IA 1IQLA 2OQ5A 3F6UH 4Y8ZA 1P3EA 1DWDH 3RXQA 3TIUA 4THNH 1ETTH 1HB0B 2ZDVH 2R2MB 5IYTA 2XWAA 3SV6A 1QTFA 5SGAE 2HNTE 2FX4A 2ZHWH 3PB1E 1W12U 2HOBA 4YO9A 5FHTA 5JBTA 1K1MA 1Y5UT 3F3BA 4FOUC 1BTXA 1RD3B 1SG8B 2IPHA 2XNDD 4K2YA 3ZVEA 1QR3E 1KTSB 3URDA 3NCLA 1UVUH 2ZFTA 4GAWA 1KIGH 1OS8A 3NK8A 1LPKB 1O2IA 3M35A 1Z8GA 4DJZB 3M5LA 1QB6A 2CJIA 3S9CA 3T5FH 4ZHAA 5B6OA 1FAXA 2XOKD 5L30H 1SBWA 4ESTE 1UCYE 1TRMA 3UWIA 4ZKNU 1V2JT 1CO7E 1VITH 3ZZ4A 4NSYA 3RXAA 4IW4E 4ASHA 5T6FA 5EIYA 2QAAA 2QA9E 1M9UA 3VB4A 4E7NA 5F8ZA 4XOJA 4P02A 1KXDA 4HGCA 3O8RA 1O30A 3DSPA 4XD7D 1MZDA 1FX0B 1AE5A 4UFGH 1ZGIA 3FANA 3TPIZ 1P57B 3BTTE 3P6ZB 1CHOG 3A7VA 2BDIA 1EZSC 1C5NH 3TK5A 1AIXH 1KLJH 2PFEA 4NG9H 2UUFB 1HJAB 4YXWD 2BY9X 1ORFA 1XUHA 3H09A 4ZHMU 2A5KA 2EQNA 5CE1A 1ELBA 2D26C 1TYNA 5FPTA 1A0LA 1GI4A 1ABIH 1YM0A 1IAUA 3B9FH 1P8VC 2RCEA 3SNDA 3AW0A 2BD8A 1GI1A 3W95A 3UR9A 3KYFA 5FPSA 1HAZB 5DGJA 5PTPA 1UTPA 3PV4A 1GMHF 1PYTC 5FL7D 2UWLA 1COWD 3QZQA 4WWYA 2ZECA 5A0CA 3SBKA 2ZDAH 2FEQH 1TA2A 3UWJH 1P03A 3F0PA 1L1JA 1MTWA 3BTHE 4P00A 4D9RA 2G00A 4M9FA 1WDIA 2ZDMA 2YNBA 1YKTA 3PM3A 1C2HA 1T8NA 4ISNA 1AKSA 3PWCA 1GJCB 2PSXA 4U30A 2FO9A 2J4IA 3M36A 4JYTA 1E36B 3Q76A 1ZPBA 5GCHG 1GHZA 2G5VA 1C2KA 4KELA 2R3YA 1MCTA 2Z94A 2G4TA 4MTBA 1TPOA 2P94A 1GL1A 4X2WA 3RU4T 1WOFA 4B6FA 2ZGHA 4BOHA 2WZQA 1GI2A 4AG2A 4JZ1A 1E38B 2ULLA 6CHAC 1ESBA 3KGPA 2IPQX 3QX5H 3TJOA 2STAE 1DY9A 2B9LA 3U8OH 2L6OA 1Q3XA 5EW2H 2K8IA 3ZVGA 2CN0H 4XSKU 3BEUA 2C8WB 3IITA 1GGDC 1F0TA 3KQEA 4Y0ZE 1FJSA 1NC6A 4X6PA 2AHME 1OHHD 1O5BB 2B7DH 1NU9A 4X1QU 1EPTB 2GV7A 2V35A 4F49A 2XWBI 3P92A 2F9UA 1G3CA 3SU1A 1DX5M 2WHXA 1Z8RA 3RXFA 5C3NA 3RXEA 2P93A 1ETSH 3GS9A 1THRH 2EI7A 2THFB 2YOLA 2ZZUH 3KL6A 3P95A 1EZQA 1O2TA 4NIXA 2AMQA 4UFDH 1DT2A 2Z9KA 1C1UH 1C5VA 2J95A 2YMSC 1SQOA 3TITA 1GBFA 3MU1A 1MBQA 1WTHD 1SR5C 1UO6A 4JZEH 3SJ9A 2KZ4A 3I78A 4DIHH 5E0JA 2FTMA 1IQHA 1WV7H 1TNKA 1EZXC 1FMGA 1XUFA 3E0NB 1W8BH 1VZQH 1ACBE 1LVOA 4CRFA 1MUEB 3MU8A 2JJ2D 1HJ9A 1O0DH 1GHAF 2VIOA 3LIWA 3NZIA 2O8WA 1VJAU 3M5NA 3MNXA 4HFPB 4ZXYH 2Y82A 2F9OA 4I33A 1O2ZA 3RXTA 1AGJA 3RXJA 2OD3B 1C2JA 1P09A 2CHAC 3QK1A 3RP2A 1NFYA 2JDID 3RC4A 2ZQ2A 1PQAA 3OX7U 3M7QA 1YYY1 4Z0KA 3ZYEA 1BTYA 3QWCH 3MH6A 4ZKSU 2ZCHP 2XBYA 1F0SA 2GCTC 1O31A 3E16B 3GCHB 1FZZA 1XX9A 2PGBB 3RXGA 4AGKA 4NWKA 3LPRA 1MTSA 3FAOA 2IOTA 4JZDH 3VGCC 1SLXB 3T25A 4AB8A 1BBRE 3ZZ8A 1O2HA 1O3EA 3PRDA 3WY8A 1O3CA 1TABE 2D1JA 3QZRA 5DP6A 1XXDA 1S0RA 3KQCA 4HTCH 4NIYA 5DG6A 1OXGA 4IS5A 2BLWA 3DHKH 2SGQE 1AHTH 1FONA 1ZTKA 2G52A 1A5GH 3SNCA 1ZPCA 1WSSH 1UTMA 3A8CA 1FY4A 3OYPA 4CRAA 1TBRH 2Y6TA 1TGCA 5AF9H 1QJ6B 3UUZA 1T7CA 1LKAA 1UW7A 3QGJA 1B0FA 2BQWB 1IQFA 2FOAA 3ZVDA 3BG4C 2PR3A 1UJ1A 1TALA 1HPGA 4E05H 3SZNA 1HAOH 1QRZA 4A6LA 1E1QD 1V2PT 2RG3A 3A88A 1TX6A 1RIWC 3M5MA 3SQEE 5AHGH 1QBVH 1Z7KA 1ZZZA 2BLOA 3O8BA 1ZRBA 3RXBA 3SORA 2P59A 5FPYA 1TPSA 3WW7A 2IN2A 2BXUH 1MQ5A 2ZF0H 4NCYA 3GCTG 1V6DA 1JIRA 3RM2H 3LC3A 2ZFRH 4WY3A 1C5ZB 3EGKH 1P2JA 3HKJB 3ODFA 3ATWA 3TJNA 1BRBE 1LO6A 5EODA 1KY9A 1K1LA 3M3VA 1K2I1 2Z9GA 2CMYA 5J4QA 3PMBB 4X2YA 3F2FA 2A31A 5C5NA 2SGPE 4X8UH 3RXSA 2A2XH 1GBEA 3A7ZA 1O5FH 3DA9B 1UK2A 1SQRA 2BLVA 3PMJA 5A0AE 2W3KA 3ZZBA 5CDFE 4LOYH 4MG3A 1J15A 2ZCKP 2VNTA 3RXOA 1X7AC 1O3PB 3C1KA 1BZXE 1XXFA 1V3XA 7GCHF 2UWPA 4YTAA 5HKKD 2WPHS 4MNXA 1O3KA 5GCHF 3UFAA 4D7GA 4CRCA 2QIQA 1SHHB 1GBLA 4XBDA 1YCPK 4B73A 4MPXA 1QCPA 3SNAA 1TQ7B 1ZJDA 4FUCA 1ZTLA 3FN8A 2Z6BD 4H6TA 2VB0A 4Q7YA 1KXEA 3VB7A 1TX7A 4NSVA 1OP8A 5CHAB 1XUKA 1V2NT 4FUEA 2NU4E 4Z1MD 1GMCG 4ACAA 1XUJA 1CBWC 2TGPZ 1KXFA 4E7RG 1PQ7A 5C1UA 2WYGA 1WCZA 2UUYA 1J17T 4VGCB 4B2BA 1ARBA 1OP2A 1BJUA 3U8TH 2A2QH 1YY3A 2XBVA 5CHBA 1BIOA 1AI8H 1PQ8A 1THSH 1QQUA 3D65E 1C5MD 1HAGE 3S9BA 2V3OH 2ZHEH 2A7CA 3MNBA 3RM0H 1G2MA 2H1UA 2A4OA 3QO6A 2VIWA 3OSYA 2VJ1A 3LKWA 2VH0A 2WPMS 5C1XA 1OSSA 4Q80A 4Y76A 4XRNA 4FU7A 1C5PA 4ABIA 2F83A 2P95A 3GCNA 5JDUB 2HGTH 1D6WA 4JK5A 2WPDD 4SGBE 4ISOA 1QBNA 1TBQH 1A1RA 2C93B 3LGTA 4AN7A 3RMMH 1DFPA 1FY1A 2AFQB 2B8OH 3EA7A 1SB1H 1T4VH 2TIOA 3VXFH 3RXRA 3EE0B 2JH5D 3HGNA 1HAVB 1UVSH 1AFQC 4INHA 2KAIA 1HCGA 1QBOA 2O8UA 1PPHE 4ABEA 3M3TA 3F2HA 4FUGA 3OEED 1Y3WA 1O2MA 4TYDA 2Y5GA 4CHAC 1XVOA 1DDJA 1GI9B 3H7TA 4X0WU 1PPFE 1W0KD 4YLQH 2OP9A 1G36A 1SGFA 4H42U 4Y0YE 3SZEA 2QXHA 1LPGB 1DWEH 4Q63A 2BVSH 1ZYOA 1YCPH 5GDSH 2AIPA 4O3TA 1HXEH 1GBAA 1CU1A 1RXPA 1CT4E 2CK3D 2R0KA 2TBSA 2FOFA 5JB8S 1CT2E 1QZ8A 4OS2A 1NN6A 1IQMA 1N1LA 1W2KH 3SGAE 6LPRA 2ZGBH 1Z1JA 2KCPA 3RXMA 1Y59T 5C20A 1O2VA 1QY6A 3ZYDA 3EDXB 3S7KB 1PPBH 1HIAA 4JYVH 2W6JD 4I8LA 2Z3CA 4NFFA 1CSOE 3FFGA 2XBXA 1SFQB 5KEDA 1S84A 1FN8A 8LPRA 3A80A 1SGTA 1GHYH 1TMBH 2PP6A 1S81A 4KP0A 4B74A 1SPJA 2HALA 4TPYA 1H8DH 2HRVA 4FXGH 1BMAA 3ATKA 2VU8E 1MTNB 3TNSA 1SLVB 1WBGB 5I46H 1P10A 1UHBB 1V2KT 3A82A 4Y7BA 3EAJA 1CGHA 2O8TA 4K69A 1HAHH 4D9QA 1DVAH 3UAIC 1FLEE 1AD8H 1L1NA 2QYIA 2JKHA 1CA0B 1VCWA 1BTPA 1Y3UA 2FTLE 5A0BA 5DK1A 2PKAB 5T1VA 1UVTH 2ODPA 2RDEA 1Y8TA 1FXYA 1GDQA 3TH2H 3ZIAD 5ESBA 3PV2A 1HBTH 1UTLM 4LXBH 5DP4A 4AFSA 1BTZA 3U1JB 1KDQB 2ZGJA 1A4WH 1F2SE 2BQ6B 1Z6EA 1AFEH 1HNEE 1C5QA 3T27A 3V12A 1NPMA 1QJ7B 3TU7H 3GY4A 1VCPA 2VWLA 1SGCA 2Q1JA 4K1SA 1IQKA 2H2ZA 2KFWA 1SGPE 2FS8A 1YPEH 1ZMLA 1F92A 1JRTA 1VITG 4O03A 1SFIA 3BIUH 3LC5A 3RDZA 3N99A 1SLWB 1ELVA 2ZGCA 3EQ0H 2AMPA 4R8TB 2ZDNA 3LGUA 2LPRA 1WQVH 4ZHLU 2D2DA 5DP3A 3BTKE 1ELTA 2ZTZA 1F0UA 4OGYA 3STJA 4X8SH 4NFEA 1NM6A 1HJAC 1QL7A 3RXUA 1C1PA 3TJUA 2GZ7A 1GBJA 3IG6B 4IGDA 4FUBA 4K8YA 1P11E 3W1EA 2SFAA 2FMJA 2A4RA 2TRMA 4AB9A 1THPB 1GMCF 2C4FH 1BMLA 3A7WA 4Y71A 2F91A 5CMXH 1GHBG 2PGQB 1QRXA 2HLCA 2BX3A 2KCOA 4K3JA 4NGAH 4JCNA 1TAWA 1D6RA 1YLDA 1TOMH 2QCYA 4KKDA 3FVFB 1V2QT 3S9AA 2AYWA 3MU5A 1TRNA 1T31A 1GBCA 1L1GA 3VB3A 2HNTC 3SV9A 2K0QA 1O3LA 2W26A 1QQ4A 1OWEA 1V2LT 3OE7D 2QE7D 3PV5A 5C5OA 3PLKA 5E0HA 1P2MA 5ABWA 3M7TA 2A5AA 2KM0A 2LP6A 2ZFFH 2RDLA 3UNSA 2FYRA 4B75A 1YLNA 3SQHE 1ZHMA 2J34A 3BTDE 5BPEA 5LH8A 3M37A 4ZROA 3SOSA 2J94A 3E90B 2Y81A 3EYDA 2ZG0H 3BF6H 2C90B 1J9CH 1AVWA 4YT7H 3N7EA 2BDYA 2BYAX 3RXDA 1EJAA 3Q00A 4Y8XA 1F5KU 4D7FA 1TWXB 2FM2A 1JBUH 1TNHA 2NU1E 4GHQA 1GHVH 1RFNA 2J92A 4ISIH 4BANB 3S0NA 1H1BA 5A09A 3GICB 3PMHB 2BLQA 1ZMJA 1EPTC 3RXIA 1PPCE 3BTFE 1ANBA 1SGDE 2OINA 3HK6B 3SUEA 1XUGA 1O3NA 2OQUA 1FN6A 3ZZDA 1W3CA 1C1TA 4O9VA 1NFUA 1FY3A 1P9UA 1Y5AT 1EATA 1FV9A 2GCHG 3LDXH 3S69A 4TT3D 1E35B 1TFXA 1ANEA 3PO1B 1UMAH 3Q3YA 1LHGH 1TE0A 1ABJH 4NZQA 3TH3H 4X8VH 1G3EA 1SVPA 1O5AB 2AGEX 2ZIQH 2GMTB 2JETB 1SI5H 3MO6A 4R0IA 1P12E 4XBCA 2CGAA 5K0HA 1AMHA 1FIZA 4SGAE 1MTVA 3V7TA 3UTUH 2VH6A 1K22H 3ESTA 2VWOA 1O2YA 1GMDG 3ODDA 4ABGA 1NTPA 1TIOA 2F9NA 3LGYA 1QHRB 5FAHA 1BTUA 2PUXB 1ELEE 1ZHPA 1GG6B 1XMNB 2XCFA 4X2XA 2I6SA 1P04A 2G4UA 5FCRA 1LPZB 5HXFA 2SNWA 1S6FA 4K5ZA 2ZFPH 3MU0A 1O2JA 4KTSA 1AB9B 4GHTA 4XDEA 1OWDA 3PTBA 1XVMA 4NWLA 4ZUHA 1S83A 5DKMA 3FZZA 2OK5A 3MYWA 3A81A 3UREA 4OGXA 4INKA 1EPTA 1IQIA 2VINA 3SV7A 3UNRA 4Y7AA 1ZLRA 1RTKA 2OC7A 5C94A 1OWHA 3SN8A 4DCDA 1J16A 2BXTH 5JB9S 4Y8YA 2PKSB 1DWCH 1VITF 2H5CA 5GWZA 3MU4A 3M5OA 3SYJA 1B0EA 2BD4A 2ZPSA 1O39A 3U1IB 4K1TA 1RGQA 5EOKA 5EJZA 2JH6D 4HI3A 2AS9A 1MMJN 3LJOA 1K0HA 2Y80A 1MQ6A 3H5CB 2M5TA 2BDAA 2GD4B 4ZXXH 3UOUA 1O2QA 1DM4B 3PRBA 3RXKA 3ZZ5A 2P8OC 8GCHG 3E3TA 1N6YA 1C5LH 1KLIH 2J9NA 2VVVA 1OWJA 3VXEH 3UNQA 1HLTH 2G8TA 1BA8B 1BHXB 1KXBA 1LHCH 1GHBF 1SGEE 2BM2A 2WV9A 2FI5E 4ISHH 4I8JA 4AX9H 1FY5A 1S85A 3ZVAA 2TGTA 1D3PB 2EI8A 3ZVCA 4LZ4B 1GJBB 2PTCE 1QRWA 4F48B 2PTNA 4DURA 1AZ8A 3UY9A 1G3DA 1GDNA 2WUBA 1UTOA 2RA0A 4CR9A 2FOCA 1N6XA 1K9OE 2WPJS 1ZHRA 1NU7B 4BNRA 3ATMA 1C9PA 1DOJA 3VPKA 3MO9A 3FOAA 3UQVA 2QC2A 1QA0A 3OTJE 4Y79A 9LPRA 5HM2A 1O5EH 2XC0A 2FYQA 3OTPA 4GPGA 3GY7A 1ZPZA 3P8GA 1EB1H 2BMGB 3LJJA 1HJ8A 1Z8JB 4B2CA 1LHFH 6GCHG 2ZNKH 2F3CE 3UPEA 1C5TA 1BJVA 5CHAC 1O2GH 3RUOA 1A5HA 1TOCB 5DP8A 1O5GH 1YPHE 1LDTT 2Q6FA 2J38A 4XBBA 1G30B 2NU2E 3A84A 5JPMH 1TGNA 4UD9H 3CENA 2EY4C 2WINI 4K60A 1GCTB 2OLGA 3TJVA 2ODYB 1GBHA 2ZA5A 3FP7E 1EB2A 4WF8A 4ABAA 2SGEE 2A4QA 2CF8H 4MPVA 5HYOA 3I77A 3SGQE 4GUXA 4ABFA 3FP8E 3QLPH 3ZV9A 2AGIX 1J8AA 3KIDU 5ESTE 2Z9IA 1SGIB 4YLUA 5TJXA 1GI3A 4BAMB 3LT3A 1BRAA 1GI6A 3A7TA 2NU3E 1CHOF 3BN9A 4TWYA 5J4SA 2ZO3H 1CE5A 2J97A 2ZDKA 2QV1A 1BITA 5HIYA 1K1IA 1LHDH 3RXPA 4UFEH 4CH8B 5IDKA 1C5WB 1P2QA 4TWWA 1JWTA 1C4Y2 3MMGA 5EJ1A 3MNCA 1O3IA 1AZZA 1TBZH 2PUQH 3PWBA 1UCYK 1AWHB 1MAYA 2XYAA 3HGPA 3U98H 2G81E 2Z9LA 1WTGH 2TGDA 1N8OB 1MD7A 1IOEA 2A7HA 2STBE 5E2OA 3E0PB 2C8XB 1GMDF 1GJ5H 3HPTB 3F2GA 5GNDA 3C27B 1GJAB 3DCLA 1AWFH 3KF2A 2K1QA 2C8ZB 2BDBA 3GY5A 2ZWLH 3PMAB 2YMSB 1PPEE 1HAYB 4ASUD 1FI8A 2OC0A 1C5XB 1W10U 3S7HB 1QURH 2F9BH 3UQOA 4MPUA 1GJ9B 1DUAA 2FP7B 2P16A 1SKYE 5F03A 2ZHQH 1O5DH 1D4PB 1A3BH 4WMEA 5F8TA 3STIA 5JBBS 1C2IA 2BD2A 4DIIH 1QIXB 1O2LA 2AIQA 1AU8A 3DSOA 4MDSA 4NA9H 3GDUA 3NWUA 2VIDA 1DLKB 4LZ1H 2H6MA 4A1VA 1TMUH 2Z9JA 2GZ9A 1WUNH 5FX6A 3JZ1B 1LMWB 5DSFA 3M61U 3MQKC 1MTNC 2SGFE 3URCA 1TNLA 1OPHB 1SOTA 1C2DA 2A4GA 3LH1A 4YOGA 1O3BA 1O5CB 1NRNH 1CA0C 4BTTB 4MLFB 1P2OA 1T8LA 1CA8B 2WV4A 4F55A 1TGBA 1GBBA 1H9LB 2A0QB 8GCHF 5HGGA 1SHYA 1AUTC 1DWBH 1UVPA 1OWIA 2ZI2H 5LPFA 1DS2E 1HAVA 4JMYA 1GJ6A 2W7UA 4TSFD 4JK6A 1NRQH 3RC5A 1MKXK 1UK3A 2FWWA 2WPLS 1FPCH 3F9HA 2H9HA 1Y5BT 4A5TS 2EI6A 5T6GA 1Z71A 3BIVH 5EPYA 1QGFA 1HAPH 4B6EA 3DFLA 3PYHA 4B1TA 4GSOA 2Y5HA 3BG4B 2TPIZ 4DY7B 2UUJB 1IQGA 1UCYH 1O3AA 3HKIB 1OX1A 5GJ4B 3T28A 3U8RH 1QB9A 2CXVA 1RIWB 1VGCC 4O97A 4AYYB 4UEHH 1LHEH 3F9EA 1O3OA 5GPIB 3KQDA 4IMZA 1WU1A 3K9XB 1L4DA 2OUAA 4Y11E 1D3DB 2V7QD 4NZLA 4AYVB 1KTTB 4Z6AH 3U9AH 1AVGH 4JYUH 2SGDE 4WH6A 1BTWA 2ZU1A 4X6OA 1WYKA 1MAXA 4CR5A 6GCHF 4M7GA 2FI4E 3T62A 2BQ7B 3B8JA 3SNBA 1XM1A 1O2SA 3QUMP 5EG4A 5GIBA 2PV9B 3OFND 1HYLA 1BOQA 1BRUP 1L2EA 1UHBA 3LOXA 2A7JA 1O3FA 3U28C 2GDEH 4FU9A 4FVDA 1P01A 2V3MA 2PKAA 4GCHG 4ZKOU 1O3MA 1HRTH 2OCVB 1UTQA 3KYGA 3A8BA 1EJNA 1T32A 2HNTF 4NIWA 3LGVA 1SLUB 1QL9A 4HG6A 3RMOH 2EEKA 2QF0A 1MTUA 1ZR0A 1KDQA 1C5OH 2BOHB 2ZFQH 1AUJA 1NO9H 1Y3XA 1VCQA 4XE4A 2BY7X 1G37A 3Q3KA 2V3HH 1Y3VA 3MTYA 1BBRK 1ETRH 2WPIS 1ZSLA 1MKXH 1ZGVA 3CS7A 4CREA 4D76A 1CBWB 4QT8C 3K6ZA 4WH8A 2BB4A 4BAQB 3GCTF 3SUDA 1GMHG 1FDPA 3M7UA 4X8TH 4CBOA 1MU6B 1NRRH 1G9IE 3IWMA 5EXLA 4ACBA 4ISLA 1PPZA 2FLRH 2FOEA 5HMAA 4DOQA 1DY8A 1V2VT 5DJ7A 3DD2H 4AORA 9ESTA 5HM9A 2B0FA 5L6NH 4BAOB 4FUHA 3F1SB 1CGIE 5LPEA 5EQRA 3F9GA 3G01A 2O9QA 2ZPRA 4UE7H 1QB1A 5T3HA 3E8LA 1RTLA 1BHXF 4H4FA 5A8XA 1OYQA 4MPWA 1SQAA 3AK5A 3TK6A 5K7RA 3L6PA 1C2EA 2GX4A 1TX8A 2HVYB 2VGCB 2ANWA 4JZIA 1QL8A 5C67A 4CH2B 3NRLA 3ZV8A 3ZZ3A 1ELGA 2ZKSA 2ZTYA 3A8AA 2QF5A 5C1YA 1WAYB 2F9PA 4DGJA 1EX3A 1P02A 3F0OA 3PO1C 3QTVH 1S0QA 5G4BA 1AFQB 1GWAA 1JXPA 1F5RA 2FDAA 3V3MA 1FUJA 1GBKA 2RA3A 5FX5A 2QN5T 1NBMD 4WJG2 4CHAB 1E34B 2JETC 1NROH 1SGNE 3MO3A 4BXWA 1JOUB 1CQQA 1O2XA 1HFDA 4AFZA 5DP5A 3TVJB 1MABB 2C3SA 5FBIA 2QXJA 2VWNA 2KR7A 1BB0B 1SMFE 3AVZA 2XC5A 1GVZA 1SGQE 3W94A 1HDTH 2QY0B 3SJIA 2GTBA 1O34A 4BXSA 1P0SH 4FU8A 1EFRD 1EUFA 2XXLA 2V0BA 5C0TA 5GXPA 1PYTD 3SO3A 1BBRH 3K2UA 1EJMA 3MFJA 1DLEA 1UTKA 1C1QA 4AC9A 1NRSH 1OKXA 4DT7B 5EPNA 3B23B 1PPGE 3SU3A 2J98B 4UONA 5F8XA 1E0FD 1GBDA 1HAXB 2BDGA 2FESH 3A8DA 1C1WH 2FOHA 1YLCA 1GVLA 1P3CA 4O3UA 2Q6DA 3ATIA 2P3FH 2A5IA 3BTGE 4B76A 5A8ZA 1SGFG 1NESE 3TGKE 2FOGA 1WQSA 1S5SA 1ID5H 4FUDA 4X1NU 4GLYA 2PKSC 1P2NA 2WUCA 4A92A 1V2MT 2NU0E 1LTOA 3L3TA 1W13U 3A83A 5F53A 3RMLH 2SNVA 1GPZA 2GKVE 3HATH 4FUFA 3SI4H 1NFWA 1RTFB 1DICA 1L0ZA 1QJ1B 1C4U2 1A0HB 1P05A 1QFKH 1TA6A 2W7SA 4UFFH 3D23A 3BTWE 1A2CH 2BX4A 1QNJA 4WXIA 5EU8A 3CP7A 1ESAA 3QTOH 1K1OA 2O8MA 2ZU4A 1OP0A 3DFJA 5EXNA 4Q7ZA 2KCAA 2QXIA 3SNEA 1TPPA 1DXPA 4OS4A 1W0JD 1ELDE 2UWOA 5AFZH 1TQ0B 1O2OA 1CVWH 2JH0D 2BD3A 4I8GA 2FI3E 3SJKA 1C5SA 2VIQA 3CNRA 5EQQA 2XNIA 1V2TT 3OY5U 1ESTA 4WXVA 5JYIA 4MNWA 3K65B 2FLBH 2BY5X 1A0JA 4GCHF 1F7ZA 5HIZA 3U69H 3RMNH 4CBNA 2Y7XA 3AAVA 1C4V2 2AGGX 1C1VH 2VIPA 3FO8D 1K1JA 3KQBA 1BTHH 2YMSD 4MNYA 2QXGA 3R3GB 3QDZB 4IC5A 3DT0H 3N7DA 4K8BA 1ELCA 4JZFH 5DP9A 1AO5A 3QN7A 1EZUC 1BMMH 1D3TB 3SV8A 4U2WA 4X1RU 1XKBC 4X6NA 4I86A 2BHGA 2GVFA 2ZHDA 2YNAA 3LH3A 1NBME 4MVNA 1BDAA 1GI0A 3GCHC 1EAXA 2ZHFH 2A45B 1DE7H 1V2RT 3GY6A 5ETXA 1PFXC 1FY8E 2WV5A 5KECA 4RN6A 2FXRA 3SV2H 1C1OA 3QGNB 2GV6A 4OS5A 2QF4A 4WMDA 1ZSKA 3A89A 3SHCH 3TGJE 4OS1A 2A32A 1SC8U 4Q7XA 3TNTA 3SJ8A 2EA3A 4B2AA 1V2OT 3GYLB 1QA7A 1Z8IB 1MD8A 1WXRA 4WVPE 3OU0A 1AE8H 1GCTC 7GCHG 5LGOA 1V2UT 4DG4A 1ZTJA 3ZVBA 4BAKB 3BTQE 3T2NA 5JBAS 1TONA 3WWBA 1O32A 3RXLA 1MKWK 1B7XB 2ESTE 2ZU5A 1GBIA 2ANYA 2BZ6H 4YT6H 3SGBE 3P8OA 1BCUH 1EASA 1HAIH 2RFKC 1BT7A 3GDSA 3K6YA 1A46H 2PW8H 1TRYA 1GCDA 3AAUA 1AKSB 4X2VA 2FIRH 4ZMAH 3TH4H 4IBLH 1CGJE 1C2GA 1RJXB 2PHBA 5F6MA 7ESTE 1K21H 1EOLA 3EA9A 1GI8B 2ILNA 2ZPQA 4RT0A 5C2ZA 4FVBA 2AH4X 2M2AA 3PLPA 4YESB 3MH4A 3NKKA 4FUIA 4DT4A 3DSGA 3SU4A 1KYNA 1IHTH 2WYJA 1S6HA 1N8OC 1HV7A 1O37A 2W5EA 4NIVA 3PROA 5FBEA 1DUEA 5TCCA 2BOKA 1GJ7B 4AZ2B 1YWUA 1GDUA 4A7IB 4A1XA 1IQNA 1YBWA 3SU2A 3ZVFA 2BY6X 1V2WT 4KGAA 4AFUA 3UB0A 4HZHA 1AN1E 2C8YB 1ANDA 1S6LA 2IJOB 3JZ2B 4K1EA 4RSPA 3LU9B 2ZCLP 1MH0A 1DSTA 1YPHC 2KCYA 1C1MA 2J5UA 2ZP0H 1GBMA 2FS9A 3F9FA 3AW1A 3MI4A 5E0GA 1GJ8B 3DUXH 3SU0A 3CS0A 1KSNA 1NFXA 1UK4A 1AVXA 1GHWH 2GDDA 1NY22 3A7YA 1O38A 2Z3EA 4FETA 1BMNH 3ENSB 1JMOH 1HUTH 3SW2B 2ALPA 2BY8X 4Q2KA 1C1NA 1A3EH 1EXFA 2JIZD 1KMHB 1SOZA 1SQTA 3D62A 3SU6A 2BZAA 3KQ5A 4VGCC 3NXPA 4ABBA 4U01A 1ANCA 1U6QA 3ZZ7A 1MKWH 2GT7A 1KLTA 5DN6D 1UTJA 2VWMA 5JBCS 2CF9H 1C5RA 2VBCA 5A2MH 1B5GH 3BSQA 1C2LA 1PJPA 4A1TA 5BRRE 1P2KA 1O35A 3LONA 2F9VA 2OTVA 2WPKS 4IMQA 2Z3DA 2GJGA 3ZZ9A 4U32A 2GCHF 2V6NA 3MOCA 6CHAB 1EAUA 5TCAA 2GP9B 1FAKH 2I6QA 3BEIB 1CT0E 2P3TB 1O2WA 3GY3A 3ATLA 1H8HD 1MBMA 2OC8A 2VIVA 1GGDB 3VFEA 3SUGA 2BVXH 2W6ID 3E1XB 3MH7A 1O2UA 3O8CA 2Y5FA 1OWKA 2H5DA 1XUIA 1T8OA 2ZFSA 1MU8B 1IQJA 1ARCA 2BVRH 3LGIA 5E8EH 4AOQA 4Y6DA 1LCYA 1ZMNA 4NA7A 2LELA 1O2KA 1F5LA 3A87A 1Z1IA 2P8OB 4ABHA 2L74A 5AFYH 5DPAA 3O8DA 1H4WA 5DO4H 1ELAA 2ASUB 4BAHB 3MHWU 4OS7A 1ELFA 2BD7A 1FPHH 3UR6A 4D8NA 1O2RA 1SGRE 3GY8A 1P06A 2SGAA 3Q77A 2FOMB 2PSYA 1Y3YA 2HPPH 3RLWH 1LQEA 3ZZ6A 2TGAA 2ZGXH 1MZAA 3RU4D 2ODQA 3ZZAA 3BEFB 1LKBA 3TGIE 1K1NA 1TB6H 1ZJKA 2ZTXA 5I25A 1C2MA 1E1RD 1RRKA 1TMTH 2A1DB 2OBOA 4YOIA 4IC6A 1YPLH 4DVAU 1LQDB 4ZAEA 3SJOA 2CHAB 1C5YB 1T4UH 4YM9A 4YOJA 5DP7A 5KGOA 1D9IA 1AY6H 2G55A 2DE8A 3BTEE 1C2FA 1F0RA 2QGRA 2EC9H 2XW9A 3P8FA 4RI0A 4ZCNA 2AMDA 2GCTB 1Q2WA 3FP6E 3L33A 3UIRA 1RS0A 2Z7FE 2AERH 4I32A 1TLDA 1JRSA 1OYTH 3PLBA 3VGCB 2BD9A 5L2ZH 2IJD1 3RXVA 3FKSD 1EAIA 2FODA 1MCVA 1Q31A 2DE9A 2ZU2A 3MWIU 4KTCA 2FZZA 4OS6A 1Z6JH 3P17H 1TNGA 3SU5A 2ANMH 1SL3A 2BDHA 5L2YH 2ALVA 2CV3A 7KMEH 1BMFD 2FPZA 4RKOB 3KCGH 2PWXA 1YP9A 4J2YB 2ZEBA 1PQ5A 1YCPM 1DXWA 2Q6GA 2VVCA 1GJ4H 1BRCE 1TGSZ 4X1SU 1IQEA 4I8HA 1EOJA 5B6LA 2BDCA 2B5TB 1TNJA 3GOVB 2LNCA 1TGTA 1G3BA 3ITIA 5T6DA 1YC0A 4BTIB 1KXAA 1O2PA 3ZZCA 5EW1H 2OXSA 2VGCC 1YPJH 3NPSA 5H4IB 4ABDA 3UOPA 3KHVA 2WSSD 3HK3B 2OBQA 3GDVA 1W7XH 2NWNA 1SSXA 1W7GH 5EQSA 4BTUB 4I7YH 3E6PH 4E06H 3ELAH 4KTUA 1DITH 1W11U 1GL0E 1KXCA 1E37B 2F43B 1J14A 4TY6A 3RC6A 3KNXA 1DANH 1UTNA 1H9IE 2ANKH 4MQAA 2H9TH 4TY7A 1AQ7A 4CRGA 5E2PA 1YGCH 5C17A 1GI7B 1FIWA 4AGJA 2HPQH 7LPRA 2XTTB 4XFQA 3F68H 1O33A 4TPIZ 1EAWA 1H8IH 1INCA 3BG8A 2KAIB 5C0UA 3VEQB 4CRBA 1LVYA 3AASA 3I29A 4CRDA 3NUMA 3KEEA 4LK4A 4X1PU 4F4OC 4FUJA 1K1PA 1YF4A 4RT1A 4DW2U 2VVUA 5LPRA 2HWLB 1O3GA 2JJ1D 1FQ3A 1O3DA
chains in the Genus database with same CATH topology
1W3CA 4R8TB 5DN6D 5CDFE 1DY8A 4I31A 2JJ2D 2F4LA 5EPYA 5FPSA 4A92A 4B6EA 4I32A 5IDKA 1W0KD 5F53A 3WWBA 2VBCA 3M5NA 5FL7D 1COWD 2IJD1 3SZEA 3FKSD 4I33A 4TT3D 4Q4LA 4A1TA 4Q63A 5GJ4B 5EQRA 3F0PA 3LONA 2F9VA 3P8OA 5HKKD 2JDID 1RTLA 4KTCA 3RC4A 4M9FA 1CU1A 3SU5A 2CK3D 3SUFA 3W1EA 2A4RA 4OM9A 3AK5A 2WV9A 1BT7A 1H8ED 2O8MA 3L6PA 3OAAD 5GPIB 1BMFD 1N1LA 4B73A 2KCPA 2KCAA 4NWKA 1DXPA 4B71A 3F2GA 3FN8A 2W6JD 2V7QD 5GNDA 1W0JD 3NRLA 2XCNA 1DXWA 1H8HD 2OC8A 2KCOA 3DCLA 3WWFA 2HLDD 3KF2A 3PRDA 3SUGA 2W6ID 2K1QA 3O8CA 4Z1MD 2QF5A 4B74A 3SV6A 4WH6A 2YMSB 2M2AA 5B6LA 3F0OA 4ASUD 2OC0A 4DT4A 1JXPA 4B6FA 5EQQA 3SU4A 2XNIA 2WZQA 3FOAA 1NBMD 2LELA 2K0QA 3SV9A 2XCFA 3F3BA 2FP7B 3OYPA 1NS3A 1SKYE 1DY9A 3P8NA 3OFND 3OTPA 2L6OA 2XNDD 3OE7D 5H4IB 2K8IA 2QE7D 3PV5A 3LOXA 5CHBA 4A1XA 2WSSD 3FO8D 2KM0A 3O8DA 3SU2A 2YMSD 2OBQA 3M5LA 3OEHD 4NWLA 3UB0A 4B75A 2AHME 3DSOA 2OK5A 1OHHD 5EQSA 1MABB 1S6LA 2XOKD 5T1VA 2IJOB 3N7DA 1E1QD 4K8BA 3M5MA 2KR7A 3SV8A 3LKWA 4A1VA 3E90B 2KCYA 2OC1A 2GVFA 2J5UA 2F9UA 3EYDA 3SU1A 3O8BA 3SV7A 3ZIAD 2FOMB 5ESBA 5DSFA 2F43B 3PV2A 1NBME 2WHXA 3RC6A 3SU0A 1EFRD 2OC7A 3KNXA 3U1JB 3N7EA 2P59A 5ETXA 5FPYA 3WW7A 3O8RA 5C0TA 2QV1A 1E79D 3GS9A 4WF8A 3DSPA 2A4GA 2WPDD 4XD7D 3KN2A 2A4QA 1FX0B 2YOLA 5C17A 1A1RA 2FM2A 3VG8A 5IK2D 2QF4A 1E1RD 2OBOA 3M5OA 4FETA 5EPNA 3SYJA 4F55A 3SU3A 3U1IB 1RGQA 2YMSC 5C0UA 4YXWD 4WH8A 2KFWA 3H09A 2JIZD 1KMHB 3SUDA 2KZ4A 3F2FA 4JMYA 4TSFD 3KEEA 2GGVB 1WXRA 2OINA 4B76A 3SU6A 3F2HA 5FPTA 3OEED 4RI0A 3RC5A 3SUEA 3N99A 4TYDA 4ZCNA 4U01A 3PRBA 2JJ1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AHM E;  3UB0 A; 
#chains in the Genus database with same CATH topology
 3RU4 E;  1S82 A;  4I31 A;  3VB5 A;  3M3S A;  1YPK H;  3GYM A;  4IN1 A;  1TNI A;  4YZU A;  1HGT H;  2ZDL A;  3BV9 B;  4GVU A;  2UUK B;  1G2L A;  3RXH A;  2KX4 A;  2BTC E;  3SHA H;  1GBT A;  3SUF A;  2O8L A;  3OY6 U;  1ZOM A;  1GJD B;  3BTM E;  2GZ8 A;  3RLY H;  1H8E D;  2AEI H;  2D8W A;  2PLX A;  1P9S A;  2H9E H;  1EP5 A;  1O2N A;  1FNI A;  1HIA B;  3EE7 A;  2R3U A;  5EXM A;  4B71 A;  3RXC A;  3N7O A;  2FX6 A;  2XCN A;  3TK9 A;  1IHS H;  1VKY A;  4ZKR U;  1ZSJ A;  3GY2 A;  3WWF A;  2HLD D;  1VR1 H;  2W3I A;  3GCO A;  1T8M A;  1A7S A;  3A85 A;  4ABJ A;  3A86 A;  3GIS B;  1LVB A;  1A61 H;  4UDW H;  1W0Y H;  1O3H A;  3D49 H;  1YPM H;  1VJ9 U;  2DUC A;  1C1R A;  1EKB B;  1OOK B;  1D3Q B;  2G51 A;  1V2S T;  4I8K A;  2ZQ1 A;  1NS3 A;  3T26 A;  3P8N A;  3P70 B;  1HXF H;  3V13 A;  5FCK A;  4PRO A;  1XKA C;  3LGW A;  1NRP H;  1BQY A;  2XBW A;  3VB6 A;  4J1Y A;  4INL A;  1UVO A;  2J2U A;  1C5U A;  3OEH D;  1YPG H;  1P2I A;  1L4Z A;  4NA8 A;  8EST E;  1SGY E;  4H6S B;  4RKJ B;  2ZC9 H;  4AG1 A;  1VGC B;  1CHG A;  1TPA E;  2OC1 A;  3A7X A;  3Q3X A;  1GVK B;  3MH5 A;  1GHX H;  1NT1 A;  4WMF A;  2GMT C;  2HVX A;  2R0L A;  5EJL A;  1E79 D;  1O3J A;  3KN2 A;  4MNV A;  1LVM A;  3VG8 A;  5IK2 D;  2ZU3 A;  1GI5 A;  4X6M A;  8KME 2;  2XC4 A;  1C1S A;  2J98 A;  1NZQ H;  1C9T A;  2XRC A;  3MNS A;  1DSU A;  3V0X A;  2R2W U;  2GGV B;  3TLO A;  3SI3 H;  1K28 D;  1GG6 C;  2FOB A;  3T29 A;  3PTN A;  3E91 A;  1DPO A;  2R9P A;  1EQ9 A;  2F4L A;  3EA8 A;  2QF3 A;  4AFQ A;  1AB9 C;  2G5N A;  3R0F A;  1JIM A;  1O36 A;  2BD5 A;  2P3U B;  4Q4L A;  5FXL A;  1H9H E;  4ZH8 A;  3FZD A;  2Y7Z A;  1EP6 A;  1G32 B;  1ZRK A;  4IN2 A;  2GT8 A;  5AVD A;  1GHA G;  4OM9 A;  1BUI A;  1W14 U;  3OAA D;  6EST A;  1W0Z U;  4Y10 E;  5A8Y A;  5EGM A;  3H7O A;  1A5I A;  1IQL A;  2OQ5 A;  3F6U H;  4Y8Z A;  1P3E A;  1DWD H;  3RXQ A;  3TIU A;  4THN H;  1ETT H;  1HB0 B;  2ZDV H;  2R2M B;  5IYT A;  2XWA A;  3SV6 A;  1QTF A;  5SGA E;  2HNT E;  2FX4 A;  2ZHW H;  3PB1 E;  1W12 U;  2HOB A;  4YO9 A;  5FHT A;  5JBT A;  1K1M A;  1Y5U T;  3F3B A;  4FOU C;  1BTX A;  1RD3 B;  1SG8 B;  2IPH A;  2XND D;  4K2Y A;  3ZVE A;  1QR3 E;  1KTS B;  3URD A;  3NCL A;  1UVU H;  2ZFT A;  4GAW A;  1KIG H;  1OS8 A;  3NK8 A;  1LPK B;  1O2I A;  3M35 A;  1Z8G A;  4DJZ B;  3M5L A;  1QB6 A;  2CJI A;  3S9C A;  3T5F H;  4ZHA A;  5B6O A;  1FAX A;  2XOK D;  5L30 H;  1SBW A;  4EST E;  1UCY E;  1TRM A;  3UWI A;  4ZKN U;  1V2J T;  1CO7 E;  1VIT H;  3ZZ4 A;  4NSY A;  3RXA A;  4IW4 E;  4ASH A;  5T6F A;  5EIY A;  2QAA A;  2QA9 E;  1M9U A;  3VB4 A;  4E7N A;  5F8Z A;  4XOJ A;  4P02 A;  1KXD A;  4HGC A;  3O8R A;  1O30 A;  3DSP A;  4XD7 D;  1MZD A;  1FX0 B;  1AE5 A;  4UFG H;  1ZGI A;  3FAN A;  3TPI Z;  1P57 B;  3BTT E;  3P6Z B;  1CHO G;  3A7V A;  2BDI A;  1EZS C;  1C5N H;  3TK5 A;  1AIX H;  1KLJ H;  2PFE A;  4NG9 H;  2UUF B;  1HJA B;  4YXW D;  2BY9 X;  1ORF A;  1XUH A;  3H09 A;  4ZHM U;  2A5K A;  2EQN A;  5CE1 A;  1ELB A;  2D26 C;  1TYN A;  5FPT A;  1A0L A;  1GI4 A;  1ABI H;  1YM0 A;  1IAU A;  3B9F H;  1P8V C;  2RCE A;  3SND A;  3AW0 A;  2BD8 A;  1GI1 A;  3W95 A;  3UR9 A;  3KYF A;  5FPS A;  1HAZ B;  5DGJ A;  5PTP A;  1UTP A;  3PV4 A;  1GMH F;  1PYT C;  5FL7 D;  2UWL A;  1COW D;  3QZQ A;  4WWY A;  2ZEC A;  5A0C A;  3SBK A;  2ZDA H;  2FEQ H;  1TA2 A;  3UWJ H;  1P03 A;  3F0P A;  1L1J A;  1MTW A;  3BTH E;  4P00 A;  4D9R A;  2G00 A;  4M9F A;  1WDI A;  2ZDM A;  2YNB A;  1YKT A;  3PM3 A;  1C2H A;  1T8N A;  4ISN A;  1AKS A;  3PWC A;  1GJC B;  2PSX A;  4U30 A;  2FO9 A;  2J4I A;  3M36 A;  4JYT A;  1E36 B;  3Q76 A;  1ZPB A;  5GCH G;  1GHZ A;  2G5V A;  1C2K A;  4KEL A;  2R3Y A;  1MCT A;  2Z94 A;  2G4T A;  4MTB A;  1TPO A;  2P94 A;  1GL1 A;  4X2W A;  3RU4 T;  1WOF A;  4B6F A;  2ZGH A;  4BOH A;  2WZQ A;  1GI2 A;  4AG2 A;  4JZ1 A;  1E38 B;  2ULL A;  6CHA C;  1ESB A;  3KGP A;  2IPQ X;  3QX5 H;  3TJO A;  2STA E;  1DY9 A;  2B9L A;  3U8O H;  2L6O A;  1Q3X A;  5EW2 H;  2K8I A;  3ZVG A;  2CN0 H;  4XSK U;  3BEU A;  2C8W B;  3IIT A;  1GGD C;  1F0T A;  3KQE A;  4Y0Z E;  1FJS A;  1NC6 A;  4X6P A;  2AHM E;  1OHH D;  1O5B B;  2B7D H;  1NU9 A;  4X1Q U;  1EPT B;  2GV7 A;  2V35 A;  4F49 A;  2XWB I;  3P92 A;  2F9U A;  1G3C A;  3SU1 A;  1DX5 M;  2WHX A;  1Z8R A;  3RXF A;  5C3N A;  3RXE A;  2P93 A;  1ETS H;  3GS9 A;  1THR H;  2EI7 A;  2THF B;  2YOL A;  2ZZU H;  3KL6 A;  3P95 A;  1EZQ A;  1O2T A;  4NIX A;  2AMQ A;  4UFD H;  1DT2 A;  2Z9K A;  1C1U H;  1C5V A;  2J95 A;  2YMS C;  1SQO A;  3TIT A;  1GBF A;  3MU1 A;  1MBQ A;  1WTH D;  1SR5 C;  1UO6 A;  4JZE H;  3SJ9 A;  2KZ4 A;  3I78 A;  4DIH H;  5E0J A;  2FTM A;  1IQH A;  1WV7 H;  1TNK A;  1EZX C;  1FMG A;  1XUF A;  3E0N B;  1W8B H;  1VZQ H;  1ACB E;  1LVO A;  4CRF A;  1MUE B;  3MU8 A;  2JJ2 D;  1HJ9 A;  1O0D H;  1GHA F;  2VIO A;  3LIW A;  3NZI A;  2O8W A;  1VJA U;  3M5N A;  3MNX A;  4HFP B;  4ZXY H;  2Y82 A;  2F9O A;  4I33 A;  1O2Z A;  3RXT A;  1AGJ A;  3RXJ A;  2OD3 B;  1C2J A;  1P09 A;  2CHA C;  3QK1 A;  3RP2 A;  1NFY A;  2JDI D;  3RC4 A;  2ZQ2 A;  1PQA A;  3OX7 U;  3M7Q A;  1YYY 1;  4Z0K A;  3ZYE A;  1BTY A;  3QWC H;  3MH6 A;  4ZKS U;  2ZCH P;  2XBY A;  1F0S A;  2GCT C;  1O31 A;  3E16 B;  3GCH B;  1FZZ A;  1XX9 A;  2PGB B;  3RXG A;  4AGK A;  4NWK A;  3LPR A;  1MTS A;  3FAO A;  2IOT A;  4JZD H;  3VGC C;  1SLX B;  3T25 A;  4AB8 A;  1BBR E;  3ZZ8 A;  1O2H A;  1O3E A;  3PRD A;  3WY8 A;  1O3C A;  1TAB E;  2D1J A;  3QZR A;  5DP6 A;  1XXD A;  1S0R A;  3KQC A;  4HTC H;  4NIY A;  5DG6 A;  1OXG A;  4IS5 A;  2BLW A;  3DHK H;  2SGQ E;  1AHT H;  1FON A;  1ZTK A;  2G52 A;  1A5G H;  3SNC A;  1ZPC A;  1WSS H;  1UTM A;  3A8C A;  1FY4 A;  3OYP A;  4CRA A;  1TBR H;  2Y6T A;  1TGC A;  5AF9 H;  1QJ6 B;  3UUZ A;  1T7C A;  1LKA A;  1UW7 A;  3QGJ A;  1B0F A;  2BQW B;  1IQF A;  2FOA A;  3ZVD A;  3BG4 C;  2PR3 A;  1UJ1 A;  1TAL A;  1HPG A;  4E05 H;  3SZN A;  1HAO H;  1QRZ A;  4A6L A;  1E1Q D;  1V2P T;  2RG3 A;  3A88 A;  1TX6 A;  1RIW C;  3M5M A;  3SQE E;  5AHG H;  1QBV H;  1Z7K A;  1ZZZ A;  2BLO A;  3O8B A;  1ZRB A;  3RXB A;  3SOR A;  2P59 A;  5FPY A;  1TPS A;  3WW7 A;  2IN2 A;  2BXU H;  1MQ5 A;  2ZF0 H;  4NCY A;  3GCT G;  1V6D A;  1JIR A;  3RM2 H;  3LC3 A;  2ZFR H;  4WY3 A;  1C5Z B;  3EGK H;  1P2J A;  3HKJ B;  3ODF A;  3ATW A;  3TJN A;  1BRB E;  1LO6 A;  5EOD A;  1KY9 A;  1K1L A;  3M3V A;  1K2I 1;  2Z9G A;  2CMY A;  5J4Q A;  3PMB B;  4X2Y A;  3F2F A;  2A31 A;  5C5N A;  2SGP E;  4X8U H;  3RXS A;  2A2X H;  1GBE A;  3A7Z A;  1O5F H;  3DA9 B;  1UK2 A;  1SQR A;  2BLV A;  3PMJ A;  5A0A E;  2W3K A;  3ZZB A;  5CDF E;  4LOY H;  4MG3 A;  1J15 A;  2ZCK P;  2VNT A;  3RXO A;  1X7A C;  1O3P B;  3C1K A;  1BZX E;  1XXF A;  1V3X A;  7GCH F;  2UWP A;  4YTA A;  5HKK D;  2WPH S;  4MNX A;  1O3K A;  5GCH F;  3UFA A;  4D7G A;  4CRC A;  2QIQ A;  1SHH B;  1GBL A;  4XBD A;  1YCP K;  4B73 A;  4MPX A;  1QCP A;  3SNA A;  1TQ7 B;  1ZJD A;  4FUC A;  1ZTL A;  3FN8 A;  2Z6B D;  4H6T A;  2VB0 A;  4Q7Y A;  1KXE A;  3VB7 A;  1TX7 A;  4NSV A;  1OP8 A;  5CHA B;  1XUK A;  1V2N T;  4FUE A;  2NU4 E;  4Z1M D;  1GMC G;  4ACA A;  1XUJ A;  1CBW C;  2TGP Z;  1KXF A;  4E7R G;  1PQ7 A;  5C1U A;  2WYG A;  1WCZ A;  2UUY A;  1J17 T;  4VGC B;  4B2B A;  1ARB A;  1OP2 A;  1BJU A;  3U8T H;  2A2Q H;  1YY3 A;  2XBV A;  5CHB A;  1BIO A;  1AI8 H;  1PQ8 A;  1THS H;  1QQU A;  3D65 E;  1C5M D;  1HAG E;  3S9B A;  2V3O H;  2ZHE H;  2A7C A;  3MNB A;  3RM0 H;  1G2M A;  2H1U A;  2A4O A;  3QO6 A;  2VIW A;  3OSY A;  2VJ1 A;  3LKW A;  2VH0 A;  2WPM S;  5C1X A;  1OSS A;  4Q80 A;  4Y76 A;  4XRN A;  4FU7 A;  1C5P A;  4ABI A;  2F83 A;  2P95 A;  3GCN A;  5JDU B;  2HGT H;  1D6W A;  4JK5 A;  2WPD D;  4SGB E;  4ISO A;  1QBN A;  1TBQ H;  1A1R A;  2C93 B;  3LGT A;  4AN7 A;  3RMM H;  1DFP A;  1FY1 A;  2AFQ B;  2B8O H;  3EA7 A;  1SB1 H;  1T4V H;  2TIO A;  3VXF H;  3RXR A;  3EE0 B;  2JH5 D;  3HGN A;  1HAV B;  1UVS H;  1AFQ C;  4INH A;  2KAI A;  1HCG A;  1QBO A;  2O8U A;  1PPH E;  4ABE A;  3M3T A;  3F2H A;  4FUG A;  3OEE D;  1Y3W A;  1O2M A;  4TYD A;  2Y5G A;  4CHA C;  1XVO A;  1DDJ A;  1GI9 B;  3H7T A;  4X0W U;  1PPF E;  1W0K D;  4YLQ H;  2OP9 A;  1G36 A;  1SGF A;  4H42 U;  4Y0Y E;  3SZE A;  2QXH A;  1LPG B;  1DWE H;  4Q63 A;  2BVS H;  1ZYO A;  1YCP H;  5GDS H;  2AIP A;  4O3T A;  1HXE H;  1GBA A;  1CU1 A;  1RXP A;  1CT4 E;  2CK3 D;  2R0K A;  2TBS A;  2FOF A;  5JB8 S;  1CT2 E;  1QZ8 A;  4OS2 A;  1NN6 A;  1IQM A;  1N1L A;  1W2K H;  3SGA E;  6LPR A;  2ZGB H;  1Z1J A;  2KCP A;  3RXM A;  1Y59 T;  5C20 A;  1O2V A;  1QY6 A;  3ZYD A;  3EDX B;  3S7K B;  1PPB H;  1HIA A;  4JYV H;  2W6J D;  4I8L A;  2Z3C A;  4NFF A;  1CSO E;  3FFG A;  2XBX A;  1SFQ B;  5KED A;  1S84 A;  1FN8 A;  8LPR A;  3A80 A;  1SGT A;  1GHY H;  1TMB H;  2PP6 A;  1S81 A;  4KP0 A;  4B74 A;  1SPJ A;  2HAL A;  4TPY A;  1H8D H;  2HRV A;  4FXG H;  1BMA A;  3ATK A;  2VU8 E;  1MTN B;  3TNS A;  1SLV B;  1WBG B;  5I46 H;  1P10 A;  1UHB B;  1V2K T;  3A82 A;  4Y7B A;  3EAJ A;  1CGH A;  2O8T A;  4K69 A;  1HAH H;  4D9Q A;  1DVA H;  3UAI C;  1FLE E;  1AD8 H;  1L1N A;  2QYI A;  2JKH A;  1CA0 B;  1VCW A;  1BTP A;  1Y3U A;  2FTL E;  5A0B A;  5DK1 A;  2PKA B;  5T1V A;  1UVT H;  2ODP A;  2RDE A;  1Y8T A;  1FXY A;  1GDQ A;  3TH2 H;  3ZIA D;  5ESB A;  3PV2 A;  1HBT H;  1UTL M;  4LXB H;  5DP4 A;  4AFS A;  1BTZ A;  3U1J B;  1KDQ B;  2ZGJ A;  1A4W H;  1F2S E;  2BQ6 B;  1Z6E A;  1AFE H;  1HNE E;  1C5Q A;  3T27 A;  3V12 A;  1NPM A;  1QJ7 B;  3TU7 H;  3GY4 A;  1VCP A;  2VWL A;  1SGC A;  2Q1J A;  4K1S A;  1IQK A;  2H2Z A;  2KFW A;  1SGP E;  2FS8 A;  1YPE H;  1ZML A;  1F92 A;  1JRT A;  1VIT G;  4O03 A;  1SFI A;  3BIU H;  3LC5 A;  3RDZ A;  3N99 A;  1SLW B;  1ELV A;  2ZGC A;  3EQ0 H;  2AMP A;  4R8T B;  2ZDN A;  3LGU A;  2LPR A;  1WQV H;  4ZHL U;  2D2D A;  5DP3 A;  3BTK E;  1ELT A;  2ZTZ A;  1F0U A;  4OGY A;  3STJ A;  4X8S H;  4NFE A;  1NM6 A;  1HJA C;  1QL7 A;  3RXU A;  1C1P A;  3TJU A;  2GZ7 A;  1GBJ A;  3IG6 B;  4IGD A;  4FUB A;  4K8Y A;  1P11 E;  3W1E A;  2SFA A;  2FMJ A;  2A4R A;  2TRM A;  4AB9 A;  1THP B;  1GMC F;  2C4F H;  1BML A;  3A7W A;  4Y71 A;  2F91 A;  5CMX H;  1GHB G;  2PGQ B;  1QRX A;  2HLC A;  2BX3 A;  2KCO A;  4K3J A;  4NGA H;  4JCN A;  1TAW A;  1D6R A;  1YLD A;  1TOM H;  2QCY A;  4KKD A;  3FVF B;  1V2Q T;  3S9A A;  2AYW A;  3MU5 A;  1TRN A;  1T31 A;  1GBC A;  1L1G A;  3VB3 A;  2HNT C;  3SV9 A;  2K0Q A;  1O3L A;  2W26 A;  1QQ4 A;  1OWE A;  1V2L T;  3OE7 D;  2QE7 D;  3PV5 A;  5C5O A;  3PLK A;  5E0H A;  1P2M A;  5ABW A;  3M7T A;  2A5A A;  2KM0 A;  2LP6 A;  2ZFF H;  2RDL A;  3UNS A;  2FYR A;  4B75 A;  1YLN A;  3SQH E;  1ZHM A;  2J34 A;  3BTD E;  5BPE A;  5LH8 A;  3M37 A;  4ZRO A;  3SOS A;  2J94 A;  3E90 B;  2Y81 A;  3EYD A;  2ZG0 H;  3BF6 H;  2C90 B;  1J9C H;  1AVW A;  4YT7 H;  3N7E A;  2BDY A;  2BYA X;  3RXD A;  1EJA A;  3Q00 A;  4Y8X A;  1F5K U;  4D7F A;  1TWX B;  2FM2 A;  1JBU H;  1TNH A;  2NU1 E;  4GHQ A;  1GHV H;  1RFN A;  2J92 A;  4ISI H;  4BAN B;  3S0N A;  1H1B A;  5A09 A;  3GIC B;  3PMH B;  2BLQ A;  1ZMJ A;  1EPT C;  3RXI A;  1PPC E;  3BTF E;  1ANB A;  1SGD E;  2OIN A;  3HK6 B;  3SUE A;  1XUG A;  1O3N A;  2OQU A;  1FN6 A;  3ZZD A;  1W3C A;  1C1T A;  4O9V A;  1NFU A;  1FY3 A;  1P9U A;  1Y5A T;  1EAT A;  1FV9 A;  2GCH G;  3LDX H;  3S69 A;  4TT3 D;  1E35 B;  1TFX A;  1ANE A;  3PO1 B;  1UMA H;  3Q3Y A;  1LHG H;  1TE0 A;  1ABJ H;  4NZQ A;  3TH3 H;  4X8V H;  1G3E A;  1SVP A;  1O5A B;  2AGE X;  2ZIQ H;  2GMT B;  2JET B;  1SI5 H;  3MO6 A;  4R0I A;  1P12 E;  4XBC A;  2CGA A;  5K0H A;  1AMH A;  1FIZ A;  4SGA E;  1MTV A;  3V7T A;  3UTU H;  2VH6 A;  1K22 H;  3EST A;  2VWO A;  1O2Y A;  1GMD G;  3ODD A;  4ABG A;  1NTP A;  1TIO A;  2F9N A;  3LGY A;  1QHR B;  5FAH A;  1BTU A;  2PUX B;  1ELE E;  1ZHP A;  1GG6 B;  1XMN B;  2XCF A;  4X2X A;  2I6S A;  1P04 A;  2G4U A;  5FCR A;  1LPZ B;  5HXF A;  2SNW A;  1S6F A;  4K5Z A;  2ZFP H;  3MU0 A;  1O2J A;  4KTS A;  1AB9 B;  4GHT A;  4XDE A;  1OWD A;  3PTB A;  1XVM A;  4NWL A;  4ZUH A;  1S83 A;  5DKM A;  3FZZ A;  2OK5 A;  3MYW A;  3A81 A;  3URE A;  4OGX A;  4INK A;  1EPT A;  1IQI A;  2VIN A;  3SV7 A;  3UNR A;  4Y7A A;  1ZLR A;  1RTK A;  2OC7 A;  5C94 A;  1OWH A;  3SN8 A;  4DCD A;  1J16 A;  2BXT H;  5JB9 S;  4Y8Y A;  2PKS B;  1DWC H;  1VIT F;  2H5C A;  5GWZ A;  3MU4 A;  3M5O A;  3SYJ A;  1B0E A;  2BD4 A;  2ZPS A;  1O39 A;  3U1I B;  4K1T A;  1RGQ A;  5EOK A;  5EJZ A;  2JH6 D;  4HI3 A;  2AS9 A;  1MMJ N;  3LJO A;  1K0H A;  2Y80 A;  1MQ6 A;  3H5C B;  2M5T A;  2BDA A;  2GD4 B;  4ZXX H;  3UOU A;  1O2Q A;  1DM4 B;  3PRB A;  3RXK A;  3ZZ5 A;  2P8O C;  8GCH G;  3E3T A;  1N6Y A;  1C5L H;  1KLI H;  2J9N A;  2VVV A;  1OWJ A;  3VXE H;  3UNQ A;  1HLT H;  2G8T A;  1BA8 B;  1BHX B;  1KXB A;  1LHC H;  1GHB F;  1SGE E;  2BM2 A;  2WV9 A;  2FI5 E;  4ISH H;  4I8J A;  4AX9 H;  1FY5 A;  1S85 A;  3ZVA A;  2TGT A;  1D3P B;  2EI8 A;  3ZVC A;  4LZ4 B;  1GJB B;  2PTC E;  1QRW A;  4F48 B;  2PTN A;  4DUR A;  1AZ8 A;  3UY9 A;  1G3D A;  1GDN A;  2WUB A;  1UTO A;  2RA0 A;  4CR9 A;  2FOC A;  1N6X A;  1K9O E;  2WPJ S;  1ZHR A;  1NU7 B;  4BNR A;  3ATM A;  1C9P A;  1DOJ A;  3VPK A;  3MO9 A;  3FOA A;  3UQV A;  2QC2 A;  1QA0 A;  3OTJ E;  4Y79 A;  9LPR A;  5HM2 A;  1O5E H;  2XC0 A;  2FYQ A;  3OTP A;  4GPG A;  3GY7 A;  1ZPZ A;  3P8G A;  1EB1 H;  2BMG B;  3LJJ A;  1HJ8 A;  1Z8J B;  4B2C A;  1LHF H;  6GCH G;  2ZNK H;  2F3C E;  3UPE A;  1C5T A;  1BJV A;  5CHA C;  1O2G H;  3RUO A;  1A5H A;  1TOC B;  5DP8 A;  1O5G H;  1YPH E;  1LDT T;  2Q6F A;  2J38 A;  4XBB A;  1G30 B;  2NU2 E;  3A84 A;  5JPM H;  1TGN A;  4UD9 H;  3CEN A;  2EY4 C;  2WIN I;  4K60 A;  1GCT B;  2OLG A;  3TJV A;  2ODY B;  1GBH A;  2ZA5 A;  3FP7 E;  1EB2 A;  4WF8 A;  4ABA A;  2SGE E;  2A4Q A;  2CF8 H;  4MPV A;  5HYO A;  3I77 A;  3SGQ E;  4GUX A;  4ABF A;  3FP8 E;  3QLP H;  3ZV9 A;  2AGI X;  1J8A A;  3KID U;  5EST E;  2Z9I A;  1SGI B;  4YLU A;  5TJX A;  1GI3 A;  4BAM B;  3LT3 A;  1BRA A;  1GI6 A;  3A7T A;  2NU3 E;  1CHO F;  3BN9 A;  4TWY A;  5J4S A;  2ZO3 H;  1CE5 A;  2J97 A;  2ZDK A;  2QV1 A;  1BIT A;  5HIY A;  1K1I A;  1LHD H;  3RXP A;  4UFE H;  4CH8 B;  5IDK A;  1C5W B;  1P2Q A;  4TWW A;  1JWT A;  1C4Y 2;  3MMG A;  5EJ1 A;  3MNC A;  1O3I A;  1AZZ A;  1TBZ H;  2PUQ H;  3PWB A;  1UCY K;  1AWH B;  1MAY A;  2XYA A;  3HGP A;  3U98 H;  2G81 E;  2Z9L A;  1WTG H;  2TGD A;  1N8O B;  1MD7 A;  1IOE A;  2A7H A;  2STB E;  5E2O A;  3E0P B;  2C8X B;  1GMD F;  1GJ5 H;  3HPT B;  3F2G A;  5GND A;  3C27 B;  1GJA B;  3DCL A;  1AWF H;  3KF2 A;  2K1Q A;  2C8Z B;  2BDB A;  3GY5 A;  2ZWL H;  3PMA B;  2YMS B;  1PPE E;  1HAY B;  4ASU D;  1FI8 A;  2OC0 A;  1C5X B;  1W10 U;  3S7H B;  1QUR H;  2F9B H;  3UQO A;  4MPU A;  1GJ9 B;  1DUA A;  2FP7 B;  2P16 A;  1SKY E;  5F03 A;  2ZHQ H;  1O5D H;  1D4P B;  1A3B H;  4WME A;  5F8T A;  3STI A;  5JBB S;  1C2I A;  2BD2 A;  4DII H;  1QIX B;  1O2L A;  2AIQ A;  1AU8 A;  3DSO A;  4MDS A;  4NA9 H;  3GDU A;  3NWU A;  2VID A;  1DLK B;  4LZ1 H;  2H6M A;  4A1V A;  1TMU H;  2Z9J A;  2GZ9 A;  1WUN H;  5FX6 A;  3JZ1 B;  1LMW B;  5DSF A;  3M61 U;  3MQK C;  1MTN C;  2SGF E;  3URC A;  1TNL A;  1OPH B;  1SOT A;  1C2D A;  2A4G A;  3LH1 A;  4YOG A;  1O3B A;  1O5C B;  1NRN H;  1CA0 C;  4BTT B;  4MLF B;  1P2O A;  1T8L A;  1CA8 B;  2WV4 A;  4F55 A;  1TGB A;  1GBB A;  1H9L B;  2A0Q B;  8GCH F;  5HGG A;  1SHY A;  1AUT C;  1DWB H;  1UVP A;  1OWI A;  2ZI2 H;  5LPF A;  1DS2 E;  1HAV A;  4JMY A;  1GJ6 A;  2W7U A;  4TSF D;  4JK6 A;  1NRQ H;  3RC5 A;  1MKX K;  1UK3 A;  2FWW A;  2WPL S;  1FPC H;  3F9H A;  2H9H A;  1Y5B T;  4A5T S;  2EI6 A;  5T6G A;  1Z71 A;  3BIV H;  5EPY A;  1QGF A;  1HAP H;  4B6E A;  3DFL A;  3PYH A;  4B1T A;  4GSO A;  2Y5H A;  3BG4 B;  2TPI Z;  4DY7 B;  2UUJ B;  1IQG A;  1UCY H;  1O3A A;  3HKI B;  1OX1 A;  5GJ4 B;  3T28 A;  3U8R H;  1QB9 A;  2CXV A;  1RIW B;  1VGC C;  4O97 A;  4AYY B;  4UEH H;  1LHE H;  3F9E A;  1O3O A;  5GPI B;  3KQD A;  4IMZ A;  1WU1 A;  3K9X B;  1L4D A;  2OUA A;  4Y11 E;  1D3D B;  2V7Q D;  4NZL A;  4AYV B;  1KTT B;  4Z6A H;  3U9A H;  1AVG H;  4JYU H;  2SGD E;  4WH6 A;  1BTW A;  2ZU1 A;  4X6O A;  1WYK A;  1MAX A;  4CR5 A;  6GCH F;  4M7G A;  2FI4 E;  3T62 A;  2BQ7 B;  3B8J A;  3SNB A;  1XM1 A;  1O2S A;  3QUM P;  5EG4 A;  5GIB A;  2PV9 B;  3OFN D;  1HYL A;  1BOQ A;  1BRU P;  1L2E A;  1UHB A;  3LOX A;  2A7J A;  1O3F A;  3U28 C;  2GDE H;  4FU9 A;  4FVD A;  1P01 A;  2V3M A;  2PKA A;  4GCH G;  4ZKO U;  1O3M A;  1HRT H;  2OCV B;  1UTQ A;  3KYG A;  3A8B A;  1EJN A;  1T32 A;  2HNT F;  4NIW A;  3LGV A;  1SLU B;  1QL9 A;  4HG6 A;  3RMO H;  2EEK A;  2QF0 A;  1MTU A;  1ZR0 A;  1KDQ A;  1C5O H;  2BOH B;  2ZFQ H;  1AUJ A;  1NO9 H;  1Y3X A;  1VCQ A;  4XE4 A;  2BY7 X;  1G37 A;  3Q3K A;  2V3H H;  1Y3V A;  3MTY A;  1BBR K;  1ETR H;  2WPI S;  1ZSL A;  1MKX H;  1ZGV A;  3CS7 A;  4CRE A;  4D76 A;  1CBW B;  4QT8 C;  3K6Z A;  4WH8 A;  2BB4 A;  4BAQ B;  3GCT F;  3SUD A;  1GMH G;  1FDP A;  3M7U A;  4X8T H;  4CBO A;  1MU6 B;  1NRR H;  1G9I E;  3IWM A;  5EXL A;  4ACB A;  4ISL A;  1PPZ A;  2FLR H;  2FOE A;  5HMA A;  4DOQ A;  1DY8 A;  1V2V T;  5DJ7 A;  3DD2 H;  4AOR A;  9EST A;  5HM9 A;  2B0F A;  5L6N H;  4BAO B;  4FUH A;  3F1S B;  1CGI E;  5LPE A;  5EQR A;  3F9G A;  3G01 A;  2O9Q A;  2ZPR A;  4UE7 H;  1QB1 A;  5T3H A;  3E8L A;  1RTL A;  1BHX F;  4H4F A;  5A8X A;  1OYQ A;  4MPW A;  1SQA A;  3AK5 A;  3TK6 A;  5K7R A;  3L6P A;  1C2E A;  2GX4 A;  1TX8 A;  2HVY B;  2VGC B;  2ANW A;  4JZI A;  1QL8 A;  5C67 A;  4CH2 B;  3NRL A;  3ZV8 A;  3ZZ3 A;  1ELG A;  2ZKS A;  2ZTY A;  3A8A A;  2QF5 A;  5C1Y A;  1WAY B;  2F9P A;  4DGJ A;  1EX3 A;  1P02 A;  3F0O A;  3PO1 C;  3QTV H;  1S0Q A;  5G4B A;  1AFQ B;  1GWA A;  1JXP A;  1F5R A;  2FDA A;  3V3M A;  1FUJ A;  1GBK A;  2RA3 A;  5FX5 A;  2QN5 T;  1NBM D;  4WJG 2;  4CHA B;  1E34 B;  2JET C;  1NRO H;  1SGN E;  3MO3 A;  4BXW A;  1JOU B;  1CQQ A;  1O2X A;  1HFD A;  4AFZ A;  5DP5 A;  3TVJ B;  1MAB B;  2C3S A;  5FBI A;  2QXJ A;  2VWN A;  2KR7 A;  1BB0 B;  1SMF E;  3AVZ A;  2XC5 A;  1GVZ A;  1SGQ E;  3W94 A;  1HDT H;  2QY0 B;  3SJI A;  2GTB A;  1O34 A;  4BXS A;  1P0S H;  4FU8 A;  1EFR D;  1EUF A;  2XXL A;  2V0B A;  5C0T A;  5GXP A;  1PYT D;  3SO3 A;  1BBR H;  3K2U A;  1EJM A;  3MFJ A;  1DLE A;  1UTK A;  1C1Q A;  4AC9 A;  1NRS H;  1OKX A;  4DT7 B;  5EPN A;  3B23 B;  1PPG E;  3SU3 A;  2J98 B;  4UON A;  5F8X A;  1E0F D;  1GBD A;  1HAX B;  2BDG A;  2FES H;  3A8D A;  1C1W H;  2FOH A;  1YLC A;  1GVL A;  1P3C A;  4O3U A;  2Q6D A;  3ATI A;  2P3F H;  2A5I A;  3BTG E;  4B76 A;  5A8Z A;  1SGF G;  1NES E;  3TGK E;  2FOG A;  1WQS A;  1S5S A;  1ID5 H;  4FUD A;  4X1N U;  4GLY A;  2PKS C;  1P2N A;  2WUC A;  4A92 A;  1V2M T;  2NU0 E;  1LTO A;  3L3T A;  1W13 U;  3A83 A;  5F53 A;  3RML H;  2SNV A;  1GPZ A;  2GKV E;  3HAT H;  4FUF A;  3SI4 H;  1NFW A;  1RTF B;  1DIC A;  1L0Z A;  1QJ1 B;  1C4U 2;  1A0H B;  1P05 A;  1QFK H;  1TA6 A;  2W7S A;  4UFF H;  3D23 A;  3BTW E;  1A2C H;  2BX4 A;  1QNJ A;  4WXI A;  5EU8 A;  3CP7 A;  1ESA A;  3QTO H;  1K1O A;  2O8M A;  2ZU4 A;  1OP0 A;  3DFJ A;  5EXN A;  4Q7Z A;  2KCA A;  2QXI A;  3SNE A;  1TPP A;  1DXP A;  4OS4 A;  1W0J D;  1ELD E;  2UWO A;  5AFZ H;  1TQ0 B;  1O2O A;  1CVW H;  2JH0 D;  2BD3 A;  4I8G A;  2FI3 E;  3SJK A;  1C5S A;  2VIQ A;  3CNR A;  5EQQ A;  2XNI A;  1V2T T;  3OY5 U;  1EST A;  4WXV A;  5JYI A;  4MNW A;  3K65 B;  2FLB H;  2BY5 X;  1A0J A;  4GCH F;  1F7Z A;  5HIZ A;  3U69 H;  3RMN H;  4CBN A;  2Y7X A;  3AAV A;  1C4V 2;  2AGG X;  1C1V H;  2VIP A;  3FO8 D;  1K1J A;  3KQB A;  1BTH H;  2YMS D;  4MNY A;  2QXG A;  3R3G B;  3QDZ B;  4IC5 A;  3DT0 H;  3N7D A;  4K8B A;  1ELC A;  4JZF H;  5DP9 A;  1AO5 A;  3QN7 A;  1EZU C;  1BMM H;  1D3T B;  3SV8 A;  4U2W A;  4X1R U;  1XKB C;  4X6N A;  4I86 A;  2BHG A;  2GVF A;  2ZHD A;  2YNA A;  3LH3 A;  1NBM E;  4MVN A;  1BDA A;  1GI0 A;  3GCH C;  1EAX A;  2ZHF H;  2A45 B;  1DE7 H;  1V2R T;  3GY6 A;  5ETX A;  1PFX C;  1FY8 E;  2WV5 A;  5KEC A;  4RN6 A;  2FXR A;  3SV2 H;  1C1O A;  3QGN B;  2GV6 A;  4OS5 A;  2QF4 A;  4WMD A;  1ZSK A;  3A89 A;  3SHC H;  3TGJ E;  4OS1 A;  2A32 A;  1SC8 U;  4Q7X A;  3TNT A;  3SJ8 A;  2EA3 A;  4B2A A;  1V2O T;  3GYL B;  1QA7 A;  1Z8I B;  1MD8 A;  1WXR A;  4WVP E;  3OU0 A;  1AE8 H;  1GCT C;  7GCH G;  5LGO A;  1V2U T;  4DG4 A;  1ZTJ A;  3ZVB A;  4BAK B;  3BTQ E;  3T2N A;  5JBA S;  1TON A;  3WWB A;  1O32 A;  3RXL A;  1MKW K;  1B7X B;  2EST E;  2ZU5 A;  1GBI A;  2ANY A;  2BZ6 H;  4YT6 H;  3SGB E;  3P8O A;  1BCU H;  1EAS A;  1HAI H;  2RFK C;  1BT7 A;  3GDS A;  3K6Y A;  1A46 H;  2PW8 H;  1TRY A;  1GCD A;  3AAU A;  1AKS B;  4X2V A;  2FIR H;  4ZMA H;  3TH4 H;  4IBL H;  1CGJ E;  1C2G A;  1RJX B;  2PHB A;  5F6M A;  7EST E;  1K21 H;  1EOL A;  3EA9 A;  1GI8 B;  2ILN A;  2ZPQ A;  4RT0 A;  5C2Z A;  4FVB A;  2AH4 X;  2M2A A;  3PLP A;  4YES B;  3MH4 A;  3NKK A;  4FUI A;  4DT4 A;  3DSG A;  3SU4 A;  1KYN A;  1IHT H;  2WYJ A;  1S6H A;  1N8O C;  1HV7 A;  1O37 A;  2W5E A;  4NIV A;  3PRO A;  5FBE A;  1DUE A;  5TCC A;  2BOK A;  1GJ7 B;  4AZ2 B;  1YWU A;  1GDU A;  4A7I B;  4A1X A;  1IQN A;  1YBW A;  3SU2 A;  3ZVF A;  2BY6 X;  1V2W T;  4KGA A;  4AFU A;  3UB0 A;  4HZH A;  1AN1 E;  2C8Y B;  1AND A;  1S6L A;  2IJO B;  3JZ2 B;  4K1E A;  4RSP A;  3LU9 B;  2ZCL P;  1MH0 A;  1DST A;  1YPH C;  2KCY A;  1C1M A;  2J5U A;  2ZP0 H;  1GBM A;  2FS9 A;  3F9F A;  3AW1 A;  3MI4 A;  5E0G A;  1GJ8 B;  3DUX H;  3SU0 A;  3CS0 A;  1KSN A;  1NFX A;  1UK4 A;  1AVX A;  1GHW H;  2GDD A;  1NY2 2;  3A7Y A;  1O38 A;  2Z3E A;  4FET A;  1BMN H;  3ENS B;  1JMO H;  1HUT H;  3SW2 B;  2ALP A;  2BY8 X;  4Q2K A;  1C1N A;  1A3E H;  1EXF A;  2JIZ D;  1KMH B;  1SOZ A;  1SQT A;  3D62 A;  3SU6 A;  2BZA A;  3KQ5 A;  4VGC C;  3NXP A;  4ABB A;  4U01 A;  1ANC A;  1U6Q A;  3ZZ7 A;  1MKW H;  2GT7 A;  1KLT A;  5DN6 D;  1UTJ A;  2VWM A;  5JBC S;  2CF9 H;  1C5R A;  2VBC A;  5A2M H;  1B5G H;  3BSQ A;  1C2L A;  1PJP A;  4A1T A;  5BRR E;  1P2K A;  1O35 A;  3LON A;  2F9V A;  2OTV A;  2WPK S;  4IMQ A;  2Z3D A;  2GJG A;  3ZZ9 A;  4U32 A;  2GCH F;  2V6N A;  3MOC A;  6CHA B;  1EAU A;  5TCA A;  2GP9 B;  1FAK H;  2I6Q A;  3BEI B;  1CT0 E;  2P3T B;  1O2W A;  3GY3 A;  3ATL A;  1H8H D;  1MBM A;  2OC8 A;  2VIV A;  1GGD B;  3VFE A;  3SUG A;  2BVX H;  2W6I D;  3E1X B;  3MH7 A;  1O2U A;  3O8C A;  2Y5F A;  1OWK A;  2H5D A;  1XUI A;  1T8O A;  2ZFS A;  1MU8 B;  1IQJ A;  1ARC A;  2BVR H;  3LGI A;  5E8E H;  4AOQ A;  4Y6D A;  1LCY A;  1ZMN A;  4NA7 A;  2LEL A;  1O2K A;  1F5L A;  3A87 A;  1Z1I A;  2P8O B;  4ABH A;  2L74 A;  5AFY H;  5DPA A;  3O8D A;  1H4W A;  5DO4 H;  1ELA A;  2ASU B;  4BAH B;  3MHW U;  4OS7 A;  1ELF A;  2BD7 A;  1FPH H;  3UR6 A;  4D8N A;  1O2R A;  1SGR E;  3GY8 A;  1P06 A;  2SGA A;  3Q77 A;  2FOM B;  2PSY A;  1Y3Y A;  2HPP H;  3RLW H;  1LQE A;  3ZZ6 A;  2TGA A;  2ZGX H;  1MZA A;  3RU4 D;  2ODQ A;  3ZZA A;  3BEF B;  1LKB A;  3TGI E;  1K1N A;  1TB6 H;  1ZJK A;  2ZTX A;  5I25 A;  1C2M A;  1E1R D;  1RRK A;  1TMT H;  2A1D B;  2OBO A;  4YOI A;  4IC6 A;  1YPL H;  4DVA U;  1LQD B;  4ZAE A;  3SJO A;  2CHA B;  1C5Y B;  1T4U H;  4YM9 A;  4YOJ A;  5DP7 A;  5KGO A;  1D9I A;  1AY6 H;  2G55 A;  2DE8 A;  3BTE E;  1C2F A;  1F0R A;  2QGR A;  2EC9 H;  2XW9 A;  3P8F A;  4RI0 A;  4ZCN A;  2AMD A;  2GCT B;  1Q2W A;  3FP6 E;  3L33 A;  3UIR A;  1RS0 A;  2Z7F E;  2AER H;  4I32 A;  1TLD A;  1JRS A;  1OYT H;  3PLB A;  3VGC B;  2BD9 A;  5L2Z H;  2IJD 1;  3RXV A;  3FKS D;  1EAI A;  2FOD A;  1MCV A;  1Q31 A;  2DE9 A;  2ZU2 A;  3MWI U;  4KTC A;  2FZZ A;  4OS6 A;  1Z6J H;  3P17 H;  1TNG A;  3SU5 A;  2ANM H;  1SL3 A;  2BDH A;  5L2Y H;  2ALV A;  2CV3 A;  7KME H;  1BMF D;  2FPZ A;  4RKO B;  3KCG H;  2PWX A;  1YP9 A;  4J2Y B;  2ZEB A;  1PQ5 A;  1YCP M;  1DXW A;  2Q6G A;  2VVC A;  1GJ4 H;  1BRC E;  1TGS Z;  4X1S U;  1IQE A;  4I8H A;  1EOJ A;  5B6L A;  2BDC A;  2B5T B;  1TNJ A;  3GOV B;  2LNC A;  1TGT A;  1G3B A;  3ITI A;  5T6D A;  1YC0 A;  4BTI B;  1KXA A;  1O2P A;  3ZZC A;  5EW1 H;  2OXS A;  2VGC C;  1YPJ H;  3NPS A;  5H4I B;  4ABD A;  3UOP A;  3KHV A;  2WSS D;  3HK3 B;  2OBQ A;  3GDV A;  1W7X H;  2NWN A;  1SSX A;  1W7G H;  5EQS A;  4BTU B;  4I7Y H;  3E6P H;  4E06 H;  3ELA H;  4KTU A;  1DIT H;  1W11 U;  1GL0 E;  1KXC A;  1E37 B;  2F43 B;  1J14 A;  4TY6 A;  3RC6 A;  3KNX A;  1DAN H;  1UTN A;  1H9I E;  2ANK H;  4MQA A;  2H9T H;  4TY7 A;  1AQ7 A;  4CRG A;  5E2P A;  1YGC H;  5C17 A;  1GI7 B;  1FIW A;  4AGJ A;  2HPQ H;  7LPR A;  2XTT B;  4XFQ A;  3F68 H;  1O33 A;  4TPI Z;  1EAW A;  1H8I H;  1INC A;  3BG8 A;  2KAI B;  5C0U A;  3VEQ B;  4CRB A;  1LVY A;  3AAS A;  3I29 A;  4CRD A;  3NUM A;  3KEE A;  4LK4 A;  4X1P U;  4F4O C;  4FUJ A;  1K1P A;  1YF4 A;  4RT1 A;  4DW2 U;  2VVU A;  5LPR A;  2HWL B;  1O3G A;  2JJ1 D;  1FQ3 A;  1O3D A; 
#chains in the Genus database with same CATH homology
 1W3C A;  4R8T B;  5DN6 D;  5CDF E;  1DY8 A;  4I31 A;  2JJ2 D;  2F4L A;  5EPY A;  5FPS A;  4A92 A;  4B6E A;  4I32 A;  5IDK A;  1W0K D;  5F53 A;  3WWB A;  2VBC A;  3M5N A;  5FL7 D;  1COW D;  2IJD 1;  3SZE A;  3FKS D;  4I33 A;  4TT3 D;  4Q4L A;  4A1T A;  4Q63 A;  5GJ4 B;  5EQR A;  3F0P A;  3LON A;  2F9V A;  3P8O A;  5HKK D;  2JDI D;  1RTL A;  4KTC A;  3RC4 A;  4M9F A;  1CU1 A;  3SU5 A;  2CK3 D;  3SUF A;  3W1E A;  2A4R A;  4OM9 A;  3AK5 A;  2WV9 A;  1BT7 A;  1H8E D;  2O8M A;  3L6P A;  3OAA D;  5GPI B;  1BMF D;  1N1L A;  4B73 A;  2KCP A;  2KCA A;  4NWK A;  1DXP A;  4B71 A;  3F2G A;  3FN8 A;  2W6J D;  2V7Q D;  5GND A;  1W0J D;  3NRL A;  2XCN A;  1DXW A;  1H8H D;  2OC8 A;  2KCO A;  3DCL A;  3WWF A;  2HLD D;  3KF2 A;  3PRD A;  3SUG A;  2W6I D;  2K1Q A;  3O8C A;  4Z1M D;  2QF5 A;  4B74 A;  3SV6 A;  4WH6 A;  2YMS B;  2M2A A;  5B6L A;  3F0O A;  4ASU D;  2OC0 A;  4DT4 A;  1JXP A;  4B6F A;  5EQQ A;  3SU4 A;  2XNI A;  2WZQ A;  3FOA A;  1NBM D;  2LEL A;  2K0Q A;  3SV9 A;  2XCF A;  3F3B A;  2FP7 B;  3OYP A;  1NS3 A;  1SKY E;  1DY9 A;  3P8N A;  3OFN D;  3OTP A;  2L6O A;  2XND D;  3OE7 D;  5H4I B;  2K8I A;  2QE7 D;  3PV5 A;  3LOX A;  5CHB A;  4A1X A;  2WSS D;  3FO8 D;  2KM0 A;  3O8D A;  3SU2 A;  2YMS D;  2OBQ A;  3M5L A;  3OEH D;  4NWL A;  3UB0 A;  4B75 A;  2AHM E;  3DSO A;  2OK5 A;  1OHH D;  5EQS A;  1MAB B;  1S6L A;  2XOK D;  5T1V A;  2IJO B;  3N7D A;  1E1Q D;  4K8B A;  3M5M A;  2KR7 A;  3SV8 A;  3LKW A;  4A1V A;  3E90 B;  2KCY A;  2OC1 A;  2GVF A;  2J5U A;  2F9U A;  3EYD A;  3SU1 A;  3O8B A;  3SV7 A;  3ZIA D;  2FOM B;  5ESB A;  5DSF A;  2F43 B;  3PV2 A;  1NBM E;  2WHX A;  3RC6 A;  3SU0 A;  1EFR D;  2OC7 A;  3KNX A;  3U1J B;  3N7E A;  2P59 A;  5ETX A;  5FPY A;  3WW7 A;  3O8R A;  5C0T A;  2QV1 A;  1E79 D;  3GS9 A;  4WF8 A;  3DSP A;  2A4G A;  2WPD D;  4XD7 D;  3KN2 A;  2A4Q A;  1FX0 B;  2YOL A;  5C17 A;  1A1R A;  2FM2 A;  3VG8 A;  5IK2 D;  2QF4 A;  1E1R D;  2OBO A;  3M5O A;  4FET A;  5EPN A;  3SYJ A;  4F55 A;  3SU3 A;  3U1I B;  1RGQ A;  2YMS C;  5C0U A;  4YXW D;  4WH8 A;  2KFW A;  3H09 A;  2JIZ D;  1KMH B;  3SUD A;  2KZ4 A;  3F2F A;  4JMY A;  4TSF D;  3KEE A;  2GGV B;  1WXR A;  2OIN A;  4B76 A;  3SU6 A;  3F2H A;  5FPT A;  3OEE D;  4RI0 A;  3RC5 A;  3SUE A;  3N99 A;  4TYD A;  4ZCN A;  4U01 A;  3PRB A;  2JJ1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...