2AHYA

Na+ complex of the nak channel
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
104
structure length
104
Chain Sequence
MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic structure of a Na+- and K+-conducting channel.
pubmed doi rcsb
molecule keywords Potassium channel protein
source organism Bacillus cereus
molecule tags Transport protein
total genus 46
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ahyA00
1JVMA 5CBGA 2AHZA 2KB1A 3ASNC 1S5HC 2X6BA 5IY5C 2EINC 1QLEC 3RVYA 2W0FC 1P7BA 4JTDB 1ORQC 2AHYA 3FB7C 4MVQA 2A9HA 2EIJC 2WLNA 4HZ3A 3LDDA 2X6CA 4MTFA 1K4DC 2WLLB 3SYOA 2HG5C 2ZD9A 3F7VC 4UUJC 4R6ZA 4WFHA 2DYSC 2WLLA 4GX5A 4J9ZB 4WFGA 1OCOC 4PDMA 4EKWA 1LNQA 3UKMA 4QE9A 4PDRA 3T4DA 4F4LA 4MVSA 5BZBA 2QKSA 3LNMB 3ZJZA 5KUKA 2A0LA 4LBEC 3OR7C 2JK5C 5EC1C 5B1AC 4MW3A 3LDEA 3AG1C 4JTAB 3ZRSA 1KKDA 3SJQC 4PA6A 3E8HA 3ABKC 3K0GA 4I9WA 3SPIA 3WG7C 4G28B 3K03A 4P9OA 2BOCC 2EILC 4G27B 4JTCB 3EFFK 3STLC 5EC2C 3JYCA 3BEHA 4KFMA 2OCCC 4XDLA 3ABLC 3IGAC 1OCZC 1J95A 4BW5A 3K0DA 3RVZA 2Y69C 3SPGA 3ASOC 1OCCC 3E8GA 3K04A 4LCUC 4MVRA 4X89A 3AG4C 2R9RB 2H8PC 3SPJA 3TETA 2Q68A 4MW8A 2HVJC 4DXWA 3SPCA 3R65A 3RW0A 2A79B 4GX1A 2WLJA 4MVMA 4WFEA 2WLKA 3TCUA 5CBHA 4HYOA 2WLHA 3FB6C 3SYPA 4H33A 4X88A 3AG3C 5KUMA 2DWEC 2Q69A 1R3IC 1K4CC 2Q6AA 4PA9A 3SYQA 1G4YB 3AG2C 3HPLC 1OCRC 3OUFA 4PDVA 4PA4A 4TWKA 5J9PC 2DWDC 5EBMC 2ITCC 4GX2A 2BOBC 2IH1C 4PA3A 4RUEA 4OXSA 5EBWC 3LUTB 3E83A 3E86A 2ZXWC 4MVUA 2IH3C 3T1CA 2DYRC 2QTOA 2WLMA 4H37A 3OGCC 1R3JC 2HJFC 4WFFA 1R3KC 4QE7A 1V54C 2HVKC 3LDCA 1M56C 4R50A 2YEVA 2P7TC 3E8FA 3KG2A 4MTGA 3PJSK 1BL8A 1XL6A 4MSWC 4R7CA 3SPHA 3T2MA 3E89A 4P2ZA 1R3LC 3GB7C 4MTOA 4GX0A 4PDLA 4XDKA 4LP8A 1V55C 3OR6C 5B1BC 4RO2A 3E8BA 1XL4A 5EK0A 2EIKC 3RBZA 4XDJA 2ATKC 4R8CA 4X8AA 4RUFA 4ZBMA 1ZWIC 3SYCA 3FB5C 1M57C 4QNHB 3IFXA 2WLIB 4CBCA 5B3SC 5E1AC 3SYAA 2Q67A 3FB8C 2NLJC 3ABMC 4PA7A 3UM7A 2ITDC 2WLIA 2K1EA 3OUSA 4RAIA 5CBFA 3X2QC 4MVOA 3VOUA 3K08A 4MVZA 3T4ZA 2HFEC 2X6AA 2EIMC 3F7YC 4P9PA 3STZC 4MS2A 4P30A 3K06A 5EBLC 4J9YB 3F5WC
chains in the Genus database with same CATH superfamily
1QR8A 2X6BA 2QM8A 1JCHA 4ICGA 3BRCA 4QGPA 1L0LH 1AILA 1S76D 2Y4TA 4HZ3A 1W59A 2BSKB 2X6CA 5DEDA 4DO2A 3CPWU 4D7TA 1W2BU 1J5EB 5E79Z 3CCLV 3CCSV 3CD6V 4H13B 1M9NA 2CTRA 4WFGA 3UQ8A 5ITZB 2OTJV 3AK3A 3JSNA 1GM9A 1KQSU 2P22C 2R70A 1E1RG 1VF6A 3JD3A 4PA6A 3LSUA 4LF6O 3BCCH 2RDCA 2QE7G 4UV9A 2IJKA 1I0HA 3PN1A 4DR5O 1X59A 1I94B 2LGQA 1I08A 4MVRA 1ROPA 2R9RB 3FYEB 3A2FA 2WWWA 1QLEB 1EZVH 4DUZO 3CRRA 2JGUA 4EFEA 3CE2A 5KHIA 5DECA 2Q69A 2KG7B 3I55V 2HHHB 4UB6Z 1PL4A 3TXQA 2V4DA 1AJPA 1RPRA 4LF9O 4C7UA 4U3JA 4AQYO 4FLVA 3ZHSA 5KA6A 1PD3A 1SQFA 1R3JC 3K59A 1XMOB 1IXMA 4FLTA 2YDEA 3KG2A 3PJSK 5LGTA 3GB7C 1YSCA 2ATKC 2Y69B 1XNQO 1OCCB 2KQXA 2GSMB 4DR4O 5FPOA 4UCRA 1EN4A 2V7QG 1M5IA 4TOIA 4MVOA 2UXDO 3H9VA 3BA8A 4L8JA 1WB7A 3SPJA 2AHZA 3ASNC 3WB0A 1YI2V 5IY5C 4GKKB 1BGYH 1HDJA 1X4TA 1F7YA 4JYAB 3W7WA 1NS1A 4DV1B 3CJHB 2HG5C 5A2QN 5CA1A 1OCOC 4F4LA 3T4DA 4OX9O 4I55A 4JI2O 5CA3A 1SA0B 3DC5A 5BR8O 4X1KA 5IYCO 1BCCH 4LFAB 4LF8O 2UXXA 3M99B 1LR1A 1QVFU 4YJ2A 4LNUA 4DV0O 1J95A 2ADQB 2FB5A 3E8GA 1NH2D 1HNZO 3RYFA 1PKXA 2H8PC 3KCYA 1N34B 2WA3A 3G4SV 1GN6A 2IJJA 2QWNB 4J10A 4B7KA 4WFEA 3HB3B 2P5OA 4HYOA 3T1YO 3B77A 3JCZA 3DC6A 4DV6O 3RYHA 2DMXA 4BR6A 3AG2C 1LUVA 3W7XA 3X2QB 1T5EA 2C2AA 1K5SA 5B1AB 4OXSA 5CA0B 2ZXWC 2QTOA 4YJ3B 4ZIBA 1P49A 1XL6A 4IGGA 4XDKA 4LH7A 4L87A 4DV7B 2Q4PA 1ZWIC 4X66B 4JZ2A 2PI5A 1Q8IA 5GONB 4K0KO 1Y76A 3K08A 1BMFG 3N2KB 2JEUA 4A5UB 1Q3EA 1N33O 4YHHB 2Q0OC 4O4HB 4UVCA 4GZRB 2VS0A 4DUYO 4MVQA 1N8RW 1RFYA 4FLUA 1WP8A 2IJIA 3W7TA 2WLLB 1VQPV 1OV9A 5LA6B 4I5SA 1AB3A 1MNGA 1M56B 4WFAV 4X62B 4W4LA 3CC4V 2Q0AA 2QKSA 3ZJZA 4JV5B 2VQEB 2EIKB 3LSQA 1KB9F 1VQ7V 1SZTA 1JA8A 1W0KG 4FK5C 3WG7C 3RYIA 1VIBA 2VQFB 3E22A 1Q86W 1CP9A 2N74A 2IJHA 3K0DA 1RM1C 2ZR2A 2HHHO 4B3RO 3MAQA 3H1JH 3IC9A 3CEIA 5H5NA 1OZ0A 3D3IA 2K9PA 5IJ0A 3SPCA 1H8EG 5BMVA 2BTQA 2WLKA 3Q4HB 3H1KH 3U10A 3L70H 4X88A 5DM6V 1ZAUA 4ZHQB 2A3QA 4U3FH 1NTMH 2BOBC 1DGSA 5IJ9B 3OAAG 3C3SA 1NT2B 2WLMA 2A06H 4QE7A 5FPRA 4CH3A 1HNWO 5TISZ 2P7TC 1BL8A 4DRXA 4P2ZA 4PDLA 4FIPC 1L1FA 1OCZB 2XAJA 2PYLA 4NTYA 1R1BA 4R8CA 2QWPB 3APOA 1Q6IA 5GTHZ 2F4VO 2L6LA 2FTKA 2EULA 2RN9A 3UO3A 4DV1O 4MS2A 1VQKV 3AG3B 1ZL8A 2JJ2G 3M7MX 3F5TA 1QLEC 1IBLO 1D5NA 2JJ1G 1JMKC 3CMEV 3BA9A 3ABUA 4TV9A 4FLXA 1FYJA 4NVPA 3SR2C 4PDMA 2ZINA 2D2CB 4QE9A 3CXCU 4KHPB 4LBEC 1NQTA 5EC1C 4YY3O 1Y66A 1Y74A 1NU1H 3SPIA 4ZI7A 1ZX3A 1HR0B 5LYJA 2YSUB 5JVDB 2OCCC 4XDLA 4ZKIA 1FKAO 2Y69C 3ASOC 1OCCC 3JALB 3H01A 5FNVA 3SJAC 1VQ8V 4FFKA 1HW7A 2ZT9B 2UUCB 4FLYA 2WSSG 1K5QA 5LMUO 2A79B 4LWSA 4UB8Z 2CH7A 4LF4B 1GM8A 3CC2V 3FB6C 5LHIA 4HNAB 1VQLV 4AI8A 1K4CC 2Q6AA 1QLNA 2WAMA 2EX3A 4PDVA 2YXYA 4TWKA 3GVMA 2ZCEA 4O2AB 1Q6UA 2W6JG 3ZIAG 1AI7A 3HKBA 4F6RB 1K33A 3ASNB 3OGCC 3QVNA 4O4IA 4UCOA 1S0VA 2JEXA 4BIOA 2YEVA 1ENVA 3BHPA 3E8FA 3HKDB 4DXWA 1MZFA 5KMGA 4RO2A 1MSDA 1WP7A 4LR3A 3MHSC 1VQ9V 3FYIB 2WPDG 4U7OA 4NXMO 2Y0IA 3THOA 2CTQA 1H8HG 3E2EA 4E2LA 1Y4MA 1JVMA 5JJEB 4X62O 1WN7A 2DQ0A 4YIPA 4IIJA 5J2TB 1RSOB 4K3AA 1HNXB 2ZE5A 4MTFA 4GKJO 1H2LA 2OTLV 2ZD9A 3N2GB 4UUJC 1V54B 1KU9A 4AILC 1Q81W 2F43G 5A9GA 4PDRA 4D7SA 4HBNA 4J42A 5B1AC 2WA4A 3ZHQA 1G6UA 3LDEA 1VARA 2E75B 1XI1A 2G38A 1YJ9V 4RWUA 3DGEA 1K7DA 5L3CA 5C8YB 1NTKH 4BW5A 3A0BZ 5B5EZ 4LF7O 1NVPB 3FAVA 2UU9O 2JDIG 3UO2A 3HR0A 1JJ2U 2X0LA 3ZHRA 4CS3A 4JI6O 5IWAB 2E76B 3P32A 3CCMV 4PD4F 2QM4A 1GRJA 2QKAA 5K1PA 4LF5B 4WBNA 3K58A 5LBQA 4X64B 1M1KW 2IH1C 3RYCA 2IH3C 1RPOA 2HEPA 3B40A 2JS5A 2GHYA 5LL6Y 1M56C 1H38A 2UXBO 3CRAA 5KAIZ 5B1BC 3RBZA 2EIKC 1K73W 3CRCA 3P3PA 5HFLA 4QNHB 1FFTB 2V1DA 3BY6A 3JSLA 2CDYA 2LFSA 3UM7A 1H2GA 1TUEB 1IBMB 3D36C 4PI2A 4I50A 3ZEDA 2Q73A 1YHQV 5EIBD 1VQNV 4KHPO 3JATA 3ZCCA 3OFNG 1SF9A 4DV3O 4TUYA 3ZRXA 2DJVA 1R6NA 1LUWA 1HR0O 1L8DA 5B66Z 1EN5A 4GX5A 4DR6B 5BZBA 5KLVH 3LNMB 4DV5B 1FJGB 1BQ0A 4I9WA 4B3MB 4DR1O 3NR7A 4JTCB 3EFFK 1A32A 3KZIZ 4H0LB 2MK3A 1FXVA 1OCZC 4I4TA 2PZSA 1YF2A 4O2BB 4LFCO 2Y4UA 1TUBA 4IL6Z 4FFBA 4LCUC 4X89A 4BIUA 4MW8A 3JAKA 3G6BA 4FZ1A 5B1OA 1XUQA 1QR9A 5JQGB 4JASA 4KXRA 4H33A 1VQOV 3AG3C 2DWEC 1SQXH 5LGNA 2H94A 4JAAA 1KBHA 4ZOLB 3BPZA 2UUAB 2ETNA 4O4JB 1QQCA 3FX7A 1XMQB 1SQBH 1D5AA 4K8XA 4O4LA 5LP6B 1EZJA 3AK2A 2QTSA 2EILB 1CPYA 1ZLZA 4QJFB 1WB8A 2XAHA 3AG4B 3FD9A 2RJZA 4N21A 3SYAA 2E3CA 4X1IA 5EYPB 4DW0A 3U0ZA 2HFEC 2YXLA 2ZM6O 1SRYA 3CP1A 3JASA 5CBGA 2JGDB 4FJCC 3CSXA 2XAQA 2LW1A 2OCCB 4X20A 5CN0A 1YXBA 2YIBD 1H2KA 1ORQC 5KHJA 1JPXA 2A9HA 1IURA 3B09A 4JI4O 3ASOB 3UCSC 4F6EA 1XOUA 1K4DC 2ARHA 2QM7A 5IJ0B 2E5LO 3LNNA 3ZN1A 1BHAA 3TJTA 1V55B 2A0LA 1N36B 1F51A 4NXNB 3B4SA 1S72V 4MW3A 5L3GA 2IU0A 3ZRSA 5LMNO 2ZIMA 1Z2GA 1N0JA 1AP6A 3A0HZ 4TV8B 3ABMB 3S3WA 4NTXA 5DN6G 3HKCB 4LC1A 4JI1B 1QCEA 3RVZA 2HKOA 2UUBB 3H1HH 4JI7B 5H6RA 1H2MA 1E1QG 3CXHF 2CTWA 1EM1A 1VP7A 3BFRA 1VF6C 4DR7B 1NR7A 3J80N 1IVSA 2XOKG 2XNDG 4DK1A 3HPLC 4PA4A 4FM0A 2ODMA 4B7EA 4DR2B 4CH5A 1AI5A 1K8AW 3AEIA 3M8AA 4X65O 4GX2A 4JYYA 1XEQA 1ZL8B 1KD1W 5JH7A 3OGIB 3AG7A 1FFXA 3K57A 1KP2A 2PY5A 1V54C 1WNSA 2DW4A 3L75H 1NZ6A 4BAYA 4LP8A 4TV9B 3OTOO 5FLXN 1KP3A 1BT8A 3RT3C 1SZXA 2WLIB 1SQVH 2MW2B 3FB8C 2F23A 2XAGA 3QF7A 2DN9A 4X1YB 1W0JG 4AHCA 3T1HB 2ZDIA 3HKEB 1DTOA 4K35A 1NVPD 4IHJB 1Y6XA 2E74B 2DE0X 3JD1A 5LYJB 3ETDA 5KX5B 3C3TA 1D2DA 3RVYA 4H44B 1VF5B 3FB7C 3CC7V 2LFRA 3ZHTA 2R9IA 2BSKA 5IDJA 4EKWA 5KAFZ 3JARB 3I5DA 4JI5B 5ITZA 2XHBA 1J5EO 3JD2A 4K8ZA 2ZR3A 1BHBA 4DV2B 1HWYA 1M57B 5B3SB 4XBFA 2OYQA 4CH4A 2Q8VA 3K5MA 5EC2C 2QWQB 1FD9A 2OIEA 1IZ3A 2GDSA 2FMLA 4O4IB 4KP4A 4Z2WA 2ZE7A 1IDSA 3K3WA 4JI8B 1BSMA 5EZYB 5LXTB 3MD0A 5B1BB 3L74H 2WLJA 3UT5B 3ZMVA 1I94O 3ETQA 3ZHUA 1R3IC 3SDLA 3JCUZ 1Q7YW 1YJWV 2KG7A 3FFQA 1TVKB 5B1NA 2LP7A 3LUTB 2QEXV 3BAAA 3E86A 4MVUA 4B3SB 3MDSA 2B1GA 3CHXA 2HVKC 4MSWC 4UCTA 2EBOA 2GUZB 5J2UB 5K1XA 4B3TB 2ZQMA 4XDJA 1GO3F 1XMOO 4NKGB 1I5XA 1G1XB 4DV4B 3FB5C 4E4EA 1F4MA 1UJWB 3IFXA 5IYZB 3OUSA 4EFBA 2ZE8A 3CX5F 2JRIA 4GCZA 3F7YC 3DXRA 1VF7A 4J9YB 4JGSA 3R66A 2KB1A 1JFFB 2W0FC 1GM7A 2IM9A 1AP5A 3FAVB 3ZMTA 3KKYA 1K3EA 2DYRB 3SYOA 3F7VC 3VQWA 4GKKO 1YJNV 3FKSG 3CJHA 1KMIZ 4JYAO 4CZZA 4JAVA 3G6EV 3N27A 1WA8B 4RQEA 5LP6C 1SA0A 3K0GA 1CEZA 1QBZA 1GMGA 2EILC 1FS0G 3D8CA 1AJNA 3IC7A 3JYCA 4OGQB 4J7ZA 1O9HA 3B8NA 4DR7O 1OJHA 2CTPA 4LFAO 2BCCH 2OWOA 1R73A 2QJ1A 3JAWB 4ABMA 3AG4C 1YEWA 1PL0A 4DR2O 1FXHA 2DQ3A 4FVMA 1FXKA 4LFBB 1N0NA 1B6QA 1N34O 2JVDA 3OUFA 2QSAA 4JYBA 4G2KA 2RQ6A 1PNKA 2CAZC 4OPHA 5L3BA 1P7GA 2R9AA 1R3KC 3CWBH 4YJ3A 2VWKA 1XNRB 1COWG 1O9GA 1V55C 3L73H 2W6IG 4TUYB 4X8AA 2PTMA 1NTZH 3G67A 4JI3B 3ABMC 3OW2U 4DV7O 1PNLA 1THZA 1SQGA 3T4ZA 4X66O 1JOYA 2ZNJA 4QIWF 1YIJV 3RGBA 1GN3A 3N2KA 2L35A 1DLBA 3AK1A 3OT7A 2F66C 5BY1A 1P7BA 4JF3A 4O4HA 4DV2O 4FFBB 4YHHO 1K92A 1XHXA 2EJRA 2WLLA 4J9ZB 3JAKB 2YICA 4KL1A 5LA6A 4LF6B 2Y48A 1HP8A 2XASA 3OR7C 2EJ7A 2LO1A 1EFRG 2DOSA 4DR5B 3ZRWA 3OEEG 4G28B 2YIAA 4JV5O 2VQEO 3BEHA 3H1IH 4KFMA 2PUSA 4MTXA 4DUZB 5LOVA 1S5LZ 2VQFO 1KYOF 2AZ0A 1TGOA 3ETEA 1FPOA 3JAMN 3VQVA 2ZNIA 1SQQH 4MT8A 3G80A 3GWKC 4GX1A 2YXHA 1VEWA 3TCUA 5KUMA 3Q4HA 1OHHG 1KECA 4B08A 1NH2B 3CB2A 1BS3A 2XT9A 4ZHQA 3QTCA 4U3JB 2ITCC 3VBBA 3JASB 5JCOC 2LJ2A 1XQ8A 2HLDG 1XREA 5IJ9A 3QNEA 3S3XA 3ABKB 4NB5A 1MZEA 4X20B 3QO5A 1R3LC 4DR4B 4Z1MG 5JJNB 1XL4A 2B1IA 3RN4A 2FL4A 1AI4A 3WB2A 2UXDB 1UPGA 1M57C 1WPXA 5B3SC 2YI8A 2Q67A 2B5UA 4PA7A 4RAIA 3K9SA 4FPPA 1ZUQA 3STZC 2QKCA 5EBLC 1JX9A 2Q7EA 3F5WC 1QVGU 4JI0B 1Q43A 1OCRB 5H9CA 3B2EE 5L3DA 2AHYA 3A0RA 4JI2B 3NXSA 4U7NA 5CA1B 5BR8B 1JJOA 4WFHA 2Y0PA 2PI4A 2BTOA 4I55B 4LF8B 4JZGA 3UKMA 4X1KB 1XILA 2JK5C 3I56V 1PNMA 2YUAA 4GLXA 4YJ2B 2BOCC 4LNUB 2A7WA 4UCUA 1VMGA 2PYJA 1HNZB 1S5JA 1YZBA 3ZMSA 5JVDA 3E35A 5JH7B 3RYFB 4ASUG 2Z5UA 1FFXB 3T1YB 4GYCB 4UV8A 3CRMA 4DV6B 4RQFA 1YITV 3VQYA 5L3EA 2AXTZ 3RYHB 3SYPA 2YIBA 2UUCO 2IU3A 4HAMA 5IYDO 1XNRO 2CE4A 1VQ6V 4LF4O 3KCXA 2KKWA 3W7SA 2KSDA 4O2AA 3AG1B 3BVOA 2DYRC 1US6A 2YI9A 5IYBO 4F6RA 1L0NH 2O57A 1YVWA 1EBOA 2EZPA 2JIZG 1URFA 4GX0A 4OPAA 2QDOA 3VQXA 4K0KB 3E8BA 3HKDA 3K5LA 4ZBMA 3K5NA 1Y76B 4LH6A 2NLJC 1SERA 5LHGA 2YIDA 1N33B 2Z3YA 2X7RB 3TGUH 2LW7A 5CBFA 2N05A 1VQMV 4DUYB 3QG5A 4P30A 2F1MA 1PP9H 1K9MW 4GUNA 1S5HC 5KHGA 4I9QA 1XHZA 2D3OW 3OEHG 3WB1A 5J2TA 1RSOA 4UXNA 2P6JA 2Q7GA 4Q6GA 5HFMA 3N2GA 4UVAA 1HNXO 4J11A 1B3QA 3RYIB 1KC8W 1GTOA 4CC5A 4WFBV 3E22B 2OIGA 1Q6HA 5AG2A 1B04A 1QHTA 2QWRB 3B8MA 4G27B 4B3RB 1U97A 2FYUH 1YTFB 2QR4A 2RNBA 3K04A 5C8YA 4EB6A 4FLWA 5BMVB 4FM2A 4YXWG 2BTQB 2CUGA 2XUMA 3SGIA 3DSQA 2XTAA 2GTSA 5D5PA 2EIJB 5CBHA 4PELA 2P4KA 4PA9A 1G4YB 2CGNA 5J9PC 5IWAO 1AI6A 1HNWB 2PGGA 4IYIA 3P30A 5FL7G 4PA3A 1U96A 3DXRB 4LF5O 2UXCB 4DRXB 3ZX6A 4CS4A 3CMAV 3SYQA 2LGWA 3LDCA 3OE7G 4X64O 4TQDA 3ZN0A 4I0XA 1M4UA 3ABLB 3H1LH 2F4VB 4RUFA 4JI0O 1QNMA 5GTIZ 4UCSA 2R72A 5E1AC 3CCJV 4DW1A 2ITDC 1P84F 1IBLB 3VOUA 3OMNB 1K97A 4TQFA 2VWJA 4CS2A 1E79G 3CCEV 1IBMO 3ZRVA 2CGOA 3L72H 4JTDB 4FMTA 2GTAA 2WLNA 1N32B 3L71H 1AR5A 1SESA 2LQTA 1BZKA 2DYSC 4YY3B 3SJCC 5CB4A 3L9DA 1LNQA 3OMAB 1FXKB 4MVSA 2RMKB 1Y74B 4ZI7B 4JTAB 3CCUV 2VRZA 3ABKC 4DR6O 1Z5VA 3WU2Z 4DV5O 4I7ZB 1FJGO 3C90A 1G8MA 1F4NA 1SQPH 1NR1A 2M6YA 2OCHA 4UFZA 5LMUB 3QO8A 2EIMB 1M93A 5FNVB 4B3MO 3ICXA 4WF9V 3APQA 4O2BA 4LWSB 1PM9A 1NI8A 2EINB 2QGNA 1B06A 2AGAA 2CH7B 1H2SB 3DTUB 4QPJA 2Q7HA 4MVMA 4FZ0A 4DK0A 5JQGA 2QA4V 2P4VA 1OCRC 1DF4A 2F95B 3K9AA 3HKBB 2GBOA 4ZOLA 4RUEA 3D3QA 4O4JA 2YEVB 1GK9A 5KMGB 2HR3A 2UUAO 5LP6A 1M90W 1XMQO 3J7AU 3CS5A 3T2MA 3E89A 1XDCA 1MABG 5LHHA 1IBKB 5EK0A 4J41A 4NXMB 5JJJB 1JQ0A 4X9QA 1DK1A 2GV9A 3A8TA 1AR1B 5EYPA 4EEQA 4IYHA 4MVZA 1WPBA 3OD4A 4W4KA 1SS3A 3ZRWB 5IE9A 5KHKA 4IIJB 3MHHC 4GKJB 2NN4A 3IAYA 2JGDA 2N04A 4JPRA 1XBLA 4PJ0Z 1NBMG 1P4RA 5LOVB 1NJIW 2RCVA 3W7UA 1AJQA 3K79A 2ZDIC 5IT9N 1AR4A 4UVBA 2B9ZA 3AG1C 3SJQC 1GN2A 4LF7B 1VQ5V 2OT5A 1PPJH 1N36O 2UU9B 1S3JA 3CYOA 4NXNO 4TV8A 5KA5A 3O65A 3SPGA 3HKCA 4JI6B 2PF4E 4NR1A 4J7JA 3JD0A 1MOFA 2HVJC 2YC0A 4JI1O 3OMIB 3R65A 3RWRD 2UUBO 1MG1A 4JI7O 2UXCO 4DR3B 5F2VO 2UXNA 3QO7A 4WBNB 3CCQV 2DWDC 4TT3G 5EBMC 3RYCB 1BQZA 4NYKA 2UXBB 2FKXA 2EZOA 3OTFA 5KHHA 3E83A 2ADPA 2HJFC 2AW9A 4R50A 1QU7A 4DYLA 4R7CA 5GW7A 4MTOA 1TA8A 3ABTA 2ZIOA 1GH6A 2M7WA 4CBCA 1I5YA 2WLIA 3ZBHA 3U11A 1YTFD 1N32O 4I50B 3ZHVA 1FAFA 4X1YA 4IT5A 4P9PA 1EN6A 3HKEA 3IJ4A 3K06A 5CA0A 4BW9A 1V9PA 1MMMA 4IHJA 4DV3B 1ZSPA 3JATB 3T1HO 3CCRV 5KX5A 2H3OA 2CK3G 1YCIA 2EIJC 2ZE6A 1Q5OA 3LDDA 4Z1VA 4FM1A 1SETA 5JCOA 3ZMUA 4R6ZA 3ZS8C 1SC5B 2P67A 3WFVA 1Y67A 4DR1B 4FLZA 5GONA 5KUKA 2F93B 1VQ4V 3JARA 1TAEA 1KKDA 3E8HA 1H2NA 4LFCB 3ML0A 4JYCA 4Q20A 4JI5O 4I4TB 3BABA 2NR5A 3ABLC 1F23A 1TUBB 1SKVA 1WJZA 4J80A 4NTWA 2AZ2A 5IY5B 1YDXA 2YS8A 2Q9LA 1IX9A 5EZYA 5LXTA 1RP3B 1GN4A 4UCVA 5L3FA 1Q90D 2WLHA 4JI8O 3UT5A 3SJBC 4PI0A 3ZMZA 2IBZH 1OCOB 2ILMA 1IXBA 1IBKO 4O4LB 1TVKA 5EBWC 4TSFG 3EVKA 4PV1B 3D36A 4H37A 4WFFA 5CMUA 1K34A 1R6KA 1FXKC 3CRQA 3OR6C 3JD4A 3G71V 4B3SO 4LF9B 3K5OA 2GUZA 5J2UA 2W0XA 4AQYB 3SYCA 2DYSB 2P06A 4X1IB 2ZM6B 1S77D 4B3TO 2K1EA 4CH6A 3X2QC 4DV4O 5IYZA 2EIMC 4GT1A 4JI4B 4WCEV 1AVMA 1XNQB 5D5QA 3AG2B 2EINC 1WLEA 2NNUA 2E5LB 1JFFA 1Z5WA 1AROP 1JR9A 1CXZB 1KUQA 2ZXWB 4YIOA 4EB6B 3P3NA 5H6QA 5BXZA 5LMNB 2P90A 2ZKOA 1WAZA 3OM3B 3GWOA 4D6TH 3J81N 1WA8A 3K03A 4P9OA 4KUMA 3STLC 2JS3A 3IGAC 4OX9B 2HJDA 4PHZA 4J7KA 3TK1A 4DR3O 2IW5A 1UFIA 1MSWD 4QPKA 3LSSA 4N23A 3JAWA 1GAXA 4I0XB 3TETA 2XAFA 2Q68A 1R6TA 5JWPA 3RW0A 1MA1A 3RFRA 4DV0B 4JAUA 4X65B 3O9OA 1PV0A 4LFBO 1KKCA 3EXAA 1N4CA 1BE3H 3T1CA 2Z0AA 3TXSA 3OTOB 5C93A 1I7FA 1NKDA 3ETGA 3CCVV 3WG7B 3JALA 2BE3A 5LGUA 2HP8A 4MTGA 3SPHA 5EIBC 1Q82W 3EHBB 2Q5ZA 1RM1B 4BWAA 4HNAA 1ZTEA 5CB4B 4BIZA 5H2FZ 4CC6A 2X6AA 1DF5A 1GKFA 4JI3O 2QWOB
chains in the Genus database with same CATH topology
1JVMA 2KB1A 1QR8A 2X6BA 1E79G 2QM8A 3CCEV 2DQ0A 1JCHA 3ZRVA 2W0FC 4JTDB 1GM7A 4FMTA 2WLNA 1S76D 4HZ3A 1SESA 2X6CA 4DO2A 4MTFA 3CPWU 1W2BU 3ZMTA 1K3EA 2DYRB 3SYOA 2OTLV 3CCLV 3CCSV 3CD6V 3F7VC 2ZD9A 4UUJC 2DYSC 1V54B 1YJNV 1M9NA 3FKSG 4WFGA 1Q81W 2F43G 2OTJV 1LNQA 3OMAB 4PDRA 1GM9A 4CZZA 1FXKB 4MVSA 4JAVA 1KQSU 3G6EV 1E1RG 5B1AC 3LDEA 4JTAB 4RQEA 3CCUV 3JD3A 4PA6A 3ABKC 3K0GA 1CEZA 1QBZA 1YJ9V 1GMGA 2EILC 1FS0G 2QE7G 4UV9A 1AJNA 3DGEA 3IC7A 1G8MA 3JYCA 1F4NA 1K7DA 2IJKA 1NR1A 5L3CA 3B8NA 4BW5A 3QO8A 2EIMB 1R73A 1NVPB 4MVRA 4WF9V 1ROPA 3AG4C 2JDIG 2R9RB 3FYEB 1PL0A 1JJ2U 2WWWA 2EINB 2X0LA 1QLEB 1FXHA 2DQ3A 3DTUB 4QPJA 1FXKA 4MVMA 1B6QA 3P32A 3CCMV 2Q69A 3I55V 2QA4V 3SYQA 3OUFA 1OCRC 1DF4A 1AJPA 4JYBA 3K9AA 1RPRA 5LBQA 4G2KA 1M1KW 2IH1C 1PNKA 4RUEA 5KA6A 1PD3A 2IH3C 1RPOA 5L3BA 2YEVB 1R3JC 1GK9A 1IXMA 1R3KC 2GHYA 2HR3A 1M56C 1H38A 1M90W 3KG2A 3PJSK 3T2MA 5LGTA 3E89A 3GB7C 1MABG 5B1BC 1COWG 1V55C 5LHHA 5EK0A 2EIKC 1YSCA 2W6IG 3RBZA 1K73W 2ATKC 2Y69B 4X8AA 1OCCB 1JQ0A 2GSMB 5HFLA 1FFTB 4QNHB 2V1DA 3BY6A 2LFSA 3ABMC 3OW2U 3UM7A 1AR1B 2V7QG 1H2GA 1TUEB 1PNLA 1THZA 4MVOA 3T4ZA 4MVZA 1JOYA 4QIWF 1YIJV 3SPJA 3ZRWB 2AHZA 3ASNC 1YHQV 3MHHC 1YI2V 5IY5C 1VQNV 1DLBA 3E2EA 1P7BA 4JPRA 4JF3A 3W7WA 1NBMG 1P4RA 3OFNG 3ZCCA 1NJIW 3ZRXA 1K92A 1R6NA 2EJRA 3W7UA 2HG5C 2WLLA 4GX5A 4J9ZB 1OCOC 4F4LA 3T4DA 1AJQA 3K79A 2ZDIC 5BZBA 3LNMB 2Y48A 2XASA 4UVBA 5CA3A 3OR7C 1EFRG 3AG1C 5IYCO 3SJQC 4I9WA 3ZRWA 2UXXA 3M99B 3OEEG 4G28B 1QVFU 4JTCB 1VQ5V 2OT5A 3EFFK 1S3JA 3BEHA 3CYOA 4KFMA 2MK3A 5KA5A 1FXVA 1OCZC 1J95A 4MTXA 3SPGA 3E8GA 4LCUC 1NH2D 3ETEA 4X89A 1PKXA 2H8PC 4MT8A 3G4SV 4BIUA 3JD0A 1MOFA 2HVJC 4MW8A 3OMIB 3R65A 5B1OA 2IJJA 4GX1A 1MG1A 1QR9A 4JASA 4WFEA 3HB3B 3TCUA 4HYOA 4H33A 1VQOV 3AG3C 3B77A 3JCZA 2DWEC 2UXNA 3QO7A 5KUMA 1OHHG 5LGNA 1KECA 2H94A 3CCQV 3AG2C 1NH2B 3W7XA 3X2QB 2DWDC 4TT3G 5EBMC 2ITCC 2C2AA 1K5SA 2EZOA 5B1AB 3VBBA 4OXSA 2HLDG 3E83A 2ZXWC 2QTOA 1EZJA 3QNEA 3ABKB 2HJFC 4R50A 2EILB 1CPYA 4R7CA 1XL6A 3QO5A 4XDKA 5GW7A 1R3LC 4MTOA 4L87A 4Z1MG 4QJFB 1XL4A 2B1IA 3ABTA 1ZWIC 1AI4A 2XAHA 2M7WA 1M57C 1WPXA 3AG4B 4CBCA 2PI5A 5B3SC 4N21A 2Q67A 3SYAA 2B5UA 4PA7A 1I5YA 2WLIA 4RAIA 1YTFD 4FPPA 3K08A 1BMFG 2HFEC 3STZC 4P9PA 1SRYA 3CP1A 3K06A 5EBLC 1JX9A 1QVGU 2JEUA 3F5WC 5CBGA 4FJCC 2XAQA 1OCRB 2OCCB 5H9CA 3CCRV 5CN0A 4UVCA 5L3DA 2CK3G 1ORQC 2AHYA 4MVQA 1JPXA 2A9HA 2EIJC 3A0RA 1N8RW 3ASOB 3LDDA 2IJIA 3W7TA 1SETA 1K4DC 2WLLB 3NXSA 4U7NA 1VQPV 3ZMUA 4I5SA 4WFHA 4R6ZA 2QM7A 2PI4A 1M56B 2P67A 4WFAV 3WFVA 3UKMA 3CC4V 3ZN1A 1BHAA 2QKSA 3ZJZA 1V55B 5KUKA 2A0LA 1F51A 2JK5C 2EIKB 3LSQA 3I56V 1VQ7V 1S72V 1VQ4V 4MW3A 5L3GA 2IU0A 1PNMA 3ZRSA 1SZTA 1KKDA 3E8HA 1W0KG 4FK5C 3WG7C 3ML0A 4JYCA 2BOCC 4Q20A 3ABMB 1Q86W 1CP9A 5DN6G 3ZMSA 3ABLC 1F23A 2IJHA 4LC1A 3K0DA 1QCEA 3E35A 3RVZA 1RM1C 2HKOA 4ASUG 2Z5UA 2ZR2A 5H6RA 1E1QG 5IY5B 4UV8A 1OZ0A 3D3IA 4RQFA 1YITV 3SPCA 1H8EG 5L3EA 5L3FA 2WLKA 2WLHA 3SYPA 1NR7A 4X88A 2IU3A 5DM6V 3ZMZA 2XOKG 2XNDG 4HAMA 5IYDO 1OCOB 3HPLC 4PA4A 1VQ6V 1AI5A 1K8AW 3AEIA 4GX2A 3W7SA 2BOBC 5EBWC 4TSFG 3AG1B 3OAAG 1KD1W 3D36A 2DYRC 2WLMA 4H37A 4WFFA 1KP2A 5IYBO 4QE7A 1V54C 2P7TC 5CMUA 1K34A 1BL8A 2DW4A 1R6KA 2JIZG 1EBOA 1FXKC 2EZPA 4P2ZA 4FIPC 4GX0A 4PDLA 4LP8A 1L1FA 1OCZB 3OR6C 3JD4A 4BAYA 3G71V 2XAJA 3E8BA 4R8CA 4ZBMA 3SYCA 1KP3A 2DYSB 1S77D 2WLIB 3FB8C 2NLJC 2XAGA 1SERA 5LHGA 1W0JG 2Z3YA 2X7RB 2K1EA 5CBFA 2ZDIA 2FTKA 3X2QC 1DTOA 1VQMV 2EIMC 4MS2A 1NVPD 4P30A 4GT1A 1VQKV 3AG3B 1K9MW 2JJ2G 3JD1A 4WCEV 3ETDA 1S5HC 3AG2B 2EINC 1QLEC 1WLEA 2NNUA 2JJ1G 3RVYA 3FB7C 3CMEV 2D3OW 3OEHG 1AROP 3CC7V 3ABUA 2LFRA 2ZXWB 2R9IA 5H6QA 5IDJA 4UXNA 2P6JA 2P90A 4EKWA 4PDMA 5HFMA 4QE9A 4UVAA 3CXCU 4LBEC 1NQTA 3JD2A 3OM3B 5EC1C 3GWOA 2ZR3A 1BHBA 1KC8W 1GTOA 1HWYA 4WFBV 1Y66A 3SPIA 1M57B 3K03A 4XBFA 2YSUB 4P9OA 3B8MA 5B3SB 4KUMA 4G27B 3STLC 5EC2C 2OCCC 4XDLA 4ZKIA 3IGAC 1YTFB 3TK1A 2Y69C 3ASOC 1OCCC 2IW5A 3K04A 4KP4A 3H01A 3K3WA 1VQ8V 1MSWD 4QPKA 3LSSA 4N23A 3MD0A 4YXWG 3TETA 2XAFA 2Q68A 2WSSG 1K5QA 5B1BB 3RW0A 2A79B 2WLJA 3ZMVA 2EIJB 5CBHA 1GM8A 3CC2V 3FB6C 4JAUA 5LHIA 4PELA 1VQLV 1R3IC 4E2LA 1K4CC 2Q6AA 1QLNA 2WAMA 4PA9A 1Q7YW 1G4YB 1YJWV 4PDVA 4TWKA 5J9PC 1AI6A 3P30A 5FL7G 4PA3A 2W6JG 3ZIAG 1AI7A 5B1NA 2LP7A 3LUTB 2QEXV 1K33A 3E86A 4MVUA 3ASNB 3T1CA 2B1GA 5C93A 3ETGA 1NKDA 3OGCC 3CCVV 3WG7B 1S0VA 3CMAV 2HVKC 2JEXA 3LDCA 3OE7G 2YEVA 1ENVA 3E8FA 4MTGA 3SPHA 4MSWC 5LGUA 3ZN0A 4DXWA 2EBOA 3ABLB 1Q82W 4RO2A 2ZQMA 4XDJA 1GO3F 3EHBB 1RM1B 4RUFA 1I5XA 3FB5C 1F4MA 1UJWB 3IFXA 3MHSC 5E1AC 1VQ9V 4BIZA 3FYIB 2WPDG 3CCJV 4U7OA 2ITDC 3OUSA 3VOUA 2X6AA 4GCZA 3F7YC 3OMNB 1K97A 1H8HG 1DF5A 1GKFA 4J9YB 1Y4MA 4JGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JVM A;  5CBG A;  2AHZ A;  2KB1 A;  3ASN C;  1S5H C;  2X6B A;  5IY5 C;  2EIN C;  1QLE C;  3RVY A;  2W0F C;  1P7B A;  4JTD B;  1ORQ C;  2AHY A;  3FB7 C;  4MVQ A;  2A9H A;  2EIJ C;  2WLN A;  4HZ3 A;  3LDD A;  2X6C A;  4MTF A;  1K4D C;  2WLL B;  3SYO A;  2HG5 C;  2ZD9 A;  3F7V C;  4UUJ C;  4R6Z A;  4WFH A;  2DYS C;  2WLL A;  4GX5 A;  4J9Z B;  4WFG A;  1OCO C;  4PDM A;  4EKW A;  1LNQ A;  3UKM A;  4QE9 A;  4PDR A;  3T4D A;  4F4L A;  4MVS A;  5BZB A;  2QKS A;  3LNM B;  3ZJZ A;  5KUK A;  2A0L A;  4LBE C;  3OR7 C;  2JK5 C;  5EC1 C;  5B1A C;  4MW3 A;  3LDE A;  3AG1 C;  4JTA B;  3ZRS A;  1KKD A;  3SJQ C;  4PA6 A;  3E8H A;  3ABK C;  3K0G A;  4I9W A;  3SPI A;  3WG7 C;  4G28 B;  3K03 A;  4P9O A;  2BOC C;  2EIL C;  4G27 B;  4JTC B;  3EFF K;  3STL C;  5EC2 C;  3JYC A;  3BEH A;  4KFM A;  2OCC C;  4XDL A;  3ABL C;  3IGA C;  1OCZ C;  1J95 A;  4BW5 A;  3K0D A;  3RVZ A;  2Y69 C;  3SPG A;  3ASO C;  1OCC C;  3E8G A;  3K04 A;  4LCU C;  4MVR A;  4X89 A;  3AG4 C;  2R9R B;  2H8P C;  3SPJ A;  3TET A;  2Q68 A;  4MW8 A;  2HVJ C;  4DXW A;  3SPC A;  3R65 A;  3RW0 A;  2A79 B;  4GX1 A;  2WLJ A;  4MVM A;  4WFE A;  2WLK A;  3TCU A;  5CBH A;  4HYO A;  2WLH A;  3FB6 C;  3SYP A;  4H33 A;  4X88 A;  3AG3 C;  5KUM A;  2DWE C;  2Q69 A;  1R3I C;  1K4C C;  2Q6A A;  4PA9 A;  3SYQ A;  1G4Y B;  3AG2 C;  3HPL C;  1OCR C;  3OUF A;  4PDV A;  4PA4 A;  4TWK A;  5J9P C;  2DWD C;  5EBM C;  2ITC C;  4GX2 A;  2BOB C;  2IH1 C;  4PA3 A;  4RUE A;  4OXS A;  5EBW C;  3LUT B;  3E83 A;  3E86 A;  2ZXW C;  4MVU A;  2IH3 C;  3T1C A;  2DYR C;  2QTO A;  2WLM A;  4H37 A;  3OGC C;  1R3J C;  2HJF C;  4WFF A;  1R3K C;  4QE7 A;  1V54 C;  2HVK C;  3LDC A;  1M56 C;  4R50 A;  2YEV A;  2P7T C;  3E8F A;  3KG2 A;  4MTG A;  3PJS K;  1BL8 A;  1XL6 A;  4MSW C;  4R7C A;  3SPH A;  3T2M A;  3E89 A;  4P2Z A;  1R3L C;  3GB7 C;  4MTO A;  4GX0 A;  4PDL A;  4XDK A;  4LP8 A;  1V55 C;  3OR6 C;  5B1B C;  4RO2 A;  3E8B A;  1XL4 A;  5EK0 A;  2EIK C;  3RBZ A;  4XDJ A;  2ATK C;  4R8C A;  4X8A A;  4RUF A;  4ZBM A;  1ZWI C;  3SYC A;  3FB5 C;  1M57 C;  4QNH B;  3IFX A;  2WLI B;  4CBC A;  5B3S C;  5E1A C;  3SYA A;  2Q67 A;  3FB8 C;  2NLJ C;  3ABM C;  4PA7 A;  3UM7 A;  2ITD C;  2WLI A;  2K1E A;  3OUS A;  4RAI A;  5CBF A;  3X2Q C;  4MVO A;  3VOU A;  3K08 A;  4MVZ A;  3T4Z A;  2HFE C;  2X6A A;  2EIM C;  3F7Y C;  4P9P A;  3STZ C;  4MS2 A;  4P30 A;  3K06 A;  5EBL C;  4J9Y B;  3F5W C; 
#chains in the Genus database with same CATH topology
 1QR8 A;  2X6B A;  2QM8 A;  1JCH A;  4ICG A;  3BRC A;  4QGP A;  1L0L H;  1AIL A;  1S76 D;  2Y4T A;  4HZ3 A;  1W59 A;  2BSK B;  2X6C A;  5DED A;  4DO2 A;  3CPW U;  4D7T A;  1W2B U;  1J5E B;  5E79 Z;  3CCL V;  3CCS V;  3CD6 V;  4H13 B;  1M9N A;  2CTR A;  4WFG A;  3UQ8 A;  5ITZ B;  2OTJ V;  3AK3 A;  3JSN A;  1GM9 A;  1KQS U;  2P22 C;  2R70 A;  1E1R G;  1VF6 A;  3JD3 A;  4PA6 A;  3LSU A;  4LF6 O;  3BCC H;  2RDC A;  2QE7 G;  4UV9 A;  2IJK A;  1I0H A;  3PN1 A;  4DR5 O;  1X59 A;  1I94 B;  2LGQ A;  1I08 A;  4MVR A;  1ROP A;  2R9R B;  3FYE B;  3A2F A;  2WWW A;  1QLE B;  1EZV H;  4DUZ O;  3CRR A;  2JGU A;  4EFE A;  3CE2 A;  5KHI A;  5DEC A;  2Q69 A;  2KG7 B;  3I55 V;  2HHH B;  4UB6 Z;  1PL4 A;  3TXQ A;  2V4D A;  1AJP A;  1RPR A;  4LF9 O;  4C7U A;  4U3J A;  4AQY O;  4FLV A;  3ZHS A;  5KA6 A;  1PD3 A;  1SQF A;  1R3J C;  3K59 A;  1XMO B;  1IXM A;  4FLT A;  2YDE A;  3KG2 A;  3PJS K;  5LGT A;  3GB7 C;  1YSC A;  2ATK C;  2Y69 B;  1XNQ O;  1OCC B;  2KQX A;  2GSM B;  4DR4 O;  5FPO A;  4UCR A;  1EN4 A;  2V7Q G;  1M5I A;  4TOI A;  4MVO A;  2UXD O;  3H9V A;  3BA8 A;  4L8J A;  1WB7 A;  3SPJ A;  2AHZ A;  3ASN C;  3WB0 A;  1YI2 V;  5IY5 C;  4GKK B;  1BGY H;  1HDJ A;  1X4T A;  1F7Y A;  4JYA B;  3W7W A;  1NS1 A;  4DV1 B;  3CJH B;  2HG5 C;  5A2Q N;  5CA1 A;  1OCO C;  4F4L A;  3T4D A;  4OX9 O;  4I55 A;  4JI2 O;  5CA3 A;  1SA0 B;  3DC5 A;  5BR8 O;  4X1K A;  5IYC O;  1BCC H;  4LFA B;  4LF8 O;  2UXX A;  3M99 B;  1LR1 A;  1QVF U;  4YJ2 A;  4LNU A;  4DV0 O;  1J95 A;  2ADQ B;  2FB5 A;  3E8G A;  1NH2 D;  1HNZ O;  3RYF A;  1PKX A;  2H8P C;  3KCY A;  1N34 B;  2WA3 A;  3G4S V;  1GN6 A;  2IJJ A;  2QWN B;  4J10 A;  4B7K A;  4WFE A;  3HB3 B;  2P5O A;  4HYO A;  3T1Y O;  3B77 A;  3JCZ A;  3DC6 A;  4DV6 O;  3RYH A;  2DMX A;  4BR6 A;  3AG2 C;  1LUV A;  3W7X A;  3X2Q B;  1T5E A;  2C2A A;  1K5S A;  5B1A B;  4OXS A;  5CA0 B;  2ZXW C;  2QTO A;  4YJ3 B;  4ZIB A;  1P49 A;  1XL6 A;  4IGG A;  4XDK A;  4LH7 A;  4L87 A;  4DV7 B;  2Q4P A;  1ZWI C;  4X66 B;  4JZ2 A;  2PI5 A;  1Q8I A;  5GON B;  4K0K O;  1Y76 A;  3K08 A;  1BMF G;  3N2K B;  2JEU A;  4A5U B;  1Q3E A;  1N33 O;  4YHH B;  2Q0O C;  4O4H B;  4UVC A;  4GZR B;  2VS0 A;  4DUY O;  4MVQ A;  1N8R W;  1RFY A;  4FLU A;  1WP8 A;  2IJI A;  3W7T A;  2WLL B;  1VQP V;  1OV9 A;  5LA6 B;  4I5S A;  1AB3 A;  1MNG A;  1M56 B;  4WFA V;  4X62 B;  4W4L A;  3CC4 V;  2Q0A A;  2QKS A;  3ZJZ A;  4JV5 B;  2VQE B;  2EIK B;  3LSQ A;  1KB9 F;  1VQ7 V;  1SZT A;  1JA8 A;  1W0K G;  4FK5 C;  3WG7 C;  3RYI A;  1VIB A;  2VQF B;  3E22 A;  1Q86 W;  1CP9 A;  2N74 A;  2IJH A;  3K0D A;  1RM1 C;  2ZR2 A;  2HHH O;  4B3R O;  3MAQ A;  3H1J H;  3IC9 A;  3CEI A;  5H5N A;  1OZ0 A;  3D3I A;  2K9P A;  5IJ0 A;  3SPC A;  1H8E G;  5BMV A;  2BTQ A;  2WLK A;  3Q4H B;  3H1K H;  3U10 A;  3L70 H;  4X88 A;  5DM6 V;  1ZAU A;  4ZHQ B;  2A3Q A;  4U3F H;  1NTM H;  2BOB C;  1DGS A;  5IJ9 B;  3OAA G;  3C3S A;  1NT2 B;  2WLM A;  2A06 H;  4QE7 A;  5FPR A;  4CH3 A;  1HNW O;  5TIS Z;  2P7T C;  1BL8 A;  4DRX A;  4P2Z A;  4PDL A;  4FIP C;  1L1F A;  1OCZ B;  2XAJ A;  2PYL A;  4NTY A;  1R1B A;  4R8C A;  2QWP B;  3APO A;  1Q6I A;  5GTH Z;  2F4V O;  2L6L A;  2FTK A;  2EUL A;  2RN9 A;  3UO3 A;  4DV1 O;  4MS2 A;  1VQK V;  3AG3 B;  1ZL8 A;  2JJ2 G;  3M7M X;  3F5T A;  1QLE C;  1IBL O;  1D5N A;  2JJ1 G;  1JMK C;  3CME V;  3BA9 A;  3ABU A;  4TV9 A;  4FLX A;  1FYJ A;  4NVP A;  3SR2 C;  4PDM A;  2ZIN A;  2D2C B;  4QE9 A;  3CXC U;  4KHP B;  4LBE C;  1NQT A;  5EC1 C;  4YY3 O;  1Y66 A;  1Y74 A;  1NU1 H;  3SPI A;  4ZI7 A;  1ZX3 A;  1HR0 B;  5LYJ A;  2YSU B;  5JVD B;  2OCC C;  4XDL A;  4ZKI A;  1FKA O;  2Y69 C;  3ASO C;  1OCC C;  3JAL B;  3H01 A;  5FNV A;  3SJA C;  1VQ8 V;  4FFK A;  1HW7 A;  2ZT9 B;  2UUC B;  4FLY A;  2WSS G;  1K5Q A;  5LMU O;  2A79 B;  4LWS A;  4UB8 Z;  2CH7 A;  4LF4 B;  1GM8 A;  3CC2 V;  3FB6 C;  5LHI A;  4HNA B;  1VQL V;  4AI8 A;  1K4C C;  2Q6A A;  1QLN A;  2WAM A;  2EX3 A;  4PDV A;  2YXY A;  4TWK A;  3GVM A;  2ZCE A;  4O2A B;  1Q6U A;  2W6J G;  3ZIA G;  1AI7 A;  3HKB A;  4F6R B;  1K33 A;  3ASN B;  3OGC C;  3QVN A;  4O4I A;  4UCO A;  1S0V A;  2JEX A;  4BIO A;  2YEV A;  1ENV A;  3BHP A;  3E8F A;  3HKD B;  4DXW A;  1MZF A;  5KMG A;  4RO2 A;  1MSD A;  1WP7 A;  4LR3 A;  3MHS C;  1VQ9 V;  3FYI B;  2WPD G;  4U7O A;  4NXM O;  2Y0I A;  3THO A;  2CTQ A;  1H8H G;  3E2E A;  4E2L A;  1Y4M A;  1JVM A;  5JJE B;  4X62 O;  1WN7 A;  2DQ0 A;  4YIP A;  4IIJ A;  5J2T B;  1RSO B;  4K3A A;  1HNX B;  2ZE5 A;  4MTF A;  4GKJ O;  1H2L A;  2OTL V;  2ZD9 A;  3N2G B;  4UUJ C;  1V54 B;  1KU9 A;  4AIL C;  1Q81 W;  2F43 G;  5A9G A;  4PDR A;  4D7S A;  4HBN A;  4J42 A;  5B1A C;  2WA4 A;  3ZHQ A;  1G6U A;  3LDE A;  1VAR A;  2E75 B;  1XI1 A;  2G38 A;  1YJ9 V;  4RWU A;  3DGE A;  1K7D A;  5L3C A;  5C8Y B;  1NTK H;  4BW5 A;  3A0B Z;  5B5E Z;  4LF7 O;  1NVP B;  3FAV A;  2UU9 O;  2JDI G;  3UO2 A;  3HR0 A;  1JJ2 U;  2X0L A;  3ZHR A;  4CS3 A;  4JI6 O;  5IWA B;  2E76 B;  3P32 A;  3CCM V;  4PD4 F;  2QM4 A;  1GRJ A;  2QKA A;  5K1P A;  4LF5 B;  4WBN A;  3K58 A;  5LBQ A;  4X64 B;  1M1K W;  2IH1 C;  3RYC A;  2IH3 C;  1RPO A;  2HEP A;  3B40 A;  2JS5 A;  2GHY A;  5LL6 Y;  1M56 C;  1H38 A;  2UXB O;  3CRA A;  5KAI Z;  5B1B C;  3RBZ A;  2EIK C;  1K73 W;  3CRC A;  3P3P A;  5HFL A;  4QNH B;  1FFT B;  2V1D A;  3BY6 A;  3JSL A;  2CDY A;  2LFS A;  3UM7 A;  1H2G A;  1TUE B;  1IBM B;  3D36 C;  4PI2 A;  4I50 A;  3ZED A;  2Q73 A;  1YHQ V;  5EIB D;  1VQN V;  4KHP O;  3JAT A;  3ZCC A;  3OFN G;  1SF9 A;  4DV3 O;  4TUY A;  3ZRX A;  2DJV A;  1R6N A;  1LUW A;  1HR0 O;  1L8D A;  5B66 Z;  1EN5 A;  4GX5 A;  4DR6 B;  5BZB A;  5KLV H;  3LNM B;  4DV5 B;  1FJG B;  1BQ0 A;  4I9W A;  4B3M B;  4DR1 O;  3NR7 A;  4JTC B;  3EFF K;  1A32 A;  3KZI Z;  4H0L B;  2MK3 A;  1FXV A;  1OCZ C;  4I4T A;  2PZS A;  1YF2 A;  4O2B B;  4LFC O;  2Y4U A;  1TUB A;  4IL6 Z;  4FFB A;  4LCU C;  4X89 A;  4BIU A;  4MW8 A;  3JAK A;  3G6B A;  4FZ1 A;  5B1O A;  1XUQ A;  1QR9 A;  5JQG B;  4JAS A;  4KXR A;  4H33 A;  1VQO V;  3AG3 C;  2DWE C;  1SQX H;  5LGN A;  2H94 A;  4JAA A;  1KBH A;  4ZOL B;  3BPZ A;  2UUA B;  2ETN A;  4O4J B;  1QQC A;  3FX7 A;  1XMQ B;  1SQB H;  1D5A A;  4K8X A;  4O4L A;  5LP6 B;  1EZJ A;  3AK2 A;  2QTS A;  2EIL B;  1CPY A;  1ZLZ A;  4QJF B;  1WB8 A;  2XAH A;  3AG4 B;  3FD9 A;  2RJZ A;  4N21 A;  3SYA A;  2E3C A;  4X1I A;  5EYP B;  4DW0 A;  3U0Z A;  2HFE C;  2YXL A;  2ZM6 O;  1SRY A;  3CP1 A;  3JAS A;  5CBG A;  2JGD B;  4FJC C;  3CSX A;  2XAQ A;  2LW1 A;  2OCC B;  4X20 A;  5CN0 A;  1YXB A;  2YIB D;  1H2K A;  1ORQ C;  5KHJ A;  1JPX A;  2A9H A;  1IUR A;  3B09 A;  4JI4 O;  3ASO B;  3UCS C;  4F6E A;  1XOU A;  1K4D C;  2ARH A;  2QM7 A;  5IJ0 B;  2E5L O;  3LNN A;  3ZN1 A;  1BHA A;  3TJT A;  1V55 B;  2A0L A;  1N36 B;  1F51 A;  4NXN B;  3B4S A;  1S72 V;  4MW3 A;  5L3G A;  2IU0 A;  3ZRS A;  5LMN O;  2ZIM A;  1Z2G A;  1N0J A;  1AP6 A;  3A0H Z;  4TV8 B;  3ABM B;  3S3W A;  4NTX A;  5DN6 G;  3HKC B;  4LC1 A;  4JI1 B;  1QCE A;  3RVZ A;  2HKO A;  2UUB B;  3H1H H;  4JI7 B;  5H6R A;  1H2M A;  1E1Q G;  3CXH F;  2CTW A;  1EM1 A;  1VP7 A;  3BFR A;  1VF6 C;  4DR7 B;  1NR7 A;  3J80 N;  1IVS A;  2XOK G;  2XND G;  4DK1 A;  3HPL C;  4PA4 A;  4FM0 A;  2ODM A;  4B7E A;  4DR2 B;  4CH5 A;  1AI5 A;  1K8A W;  3AEI A;  3M8A A;  4X65 O;  4GX2 A;  4JYY A;  1XEQ A;  1ZL8 B;  1KD1 W;  5JH7 A;  3OGI B;  3AG7 A;  1FFX A;  3K57 A;  1KP2 A;  2PY5 A;  1V54 C;  1WNS A;  2DW4 A;  3L75 H;  1NZ6 A;  4BAY A;  4LP8 A;  4TV9 B;  3OTO O;  5FLX N;  1KP3 A;  1BT8 A;  3RT3 C;  1SZX A;  2WLI B;  1SQV H;  2MW2 B;  3FB8 C;  2F23 A;  2XAG A;  3QF7 A;  2DN9 A;  4X1Y B;  1W0J G;  4AHC A;  3T1H B;  2ZDI A;  3HKE B;  1DTO A;  4K35 A;  1NVP D;  4IHJ B;  1Y6X A;  2E74 B;  2DE0 X;  3JD1 A;  5LYJ B;  3ETD A;  5KX5 B;  3C3T A;  1D2D A;  3RVY A;  4H44 B;  1VF5 B;  3FB7 C;  3CC7 V;  2LFR A;  3ZHT A;  2R9I A;  2BSK A;  5IDJ A;  4EKW A;  5KAF Z;  3JAR B;  3I5D A;  4JI5 B;  5ITZ A;  2XHB A;  1J5E O;  3JD2 A;  4K8Z A;  2ZR3 A;  1BHB A;  4DV2 B;  1HWY A;  1M57 B;  5B3S B;  4XBF A;  2OYQ A;  4CH4 A;  2Q8V A;  3K5M A;  5EC2 C;  2QWQ B;  1FD9 A;  2OIE A;  1IZ3 A;  2GDS A;  2FML A;  4O4I B;  4KP4 A;  4Z2W A;  2ZE7 A;  1IDS A;  3K3W A;  4JI8 B;  1BSM A;  5EZY B;  5LXT B;  3MD0 A;  5B1B B;  3L74 H;  2WLJ A;  3UT5 B;  3ZMV A;  1I94 O;  3ETQ A;  3ZHU A;  1R3I C;  3SDL A;  3JCU Z;  1Q7Y W;  1YJW V;  2KG7 A;  3FFQ A;  1TVK B;  5B1N A;  2LP7 A;  3LUT B;  2QEX V;  3BAA A;  3E86 A;  4MVU A;  4B3S B;  3MDS A;  2B1G A;  3CHX A;  2HVK C;  4MSW C;  4UCT A;  2EBO A;  2GUZ B;  5J2U B;  5K1X A;  4B3T B;  2ZQM A;  4XDJ A;  1GO3 F;  1XMO O;  4NKG B;  1I5X A;  1G1X B;  4DV4 B;  3FB5 C;  4E4E A;  1F4M A;  1UJW B;  3IFX A;  5IYZ B;  3OUS A;  4EFB A;  2ZE8 A;  3CX5 F;  2JRI A;  4GCZ A;  3F7Y C;  3DXR A;  1VF7 A;  4J9Y B;  4JGS A;  3R66 A;  2KB1 A;  1JFF B;  2W0F C;  1GM7 A;  2IM9 A;  1AP5 A;  3FAV B;  3ZMT A;  3KKY A;  1K3E A;  2DYR B;  3SYO A;  3F7V C;  3VQW A;  4GKK O;  1YJN V;  3FKS G;  3CJH A;  1KMI Z;  4JYA O;  4CZZ A;  4JAV A;  3G6E V;  3N27 A;  1WA8 B;  4RQE A;  5LP6 C;  1SA0 A;  3K0G A;  1CEZ A;  1QBZ A;  1GMG A;  2EIL C;  1FS0 G;  3D8C A;  1AJN A;  3IC7 A;  3JYC A;  4OGQ B;  4J7Z A;  1O9H A;  3B8N A;  4DR7 O;  1OJH A;  2CTP A;  4LFA O;  2BCC H;  2OWO A;  1R73 A;  2QJ1 A;  3JAW B;  4ABM A;  3AG4 C;  1YEW A;  1PL0 A;  4DR2 O;  1FXH A;  2DQ3 A;  4FVM A;  1FXK A;  4LFB B;  1N0N A;  1B6Q A;  1N34 O;  2JVD A;  3OUF A;  2QSA A;  4JYB A;  4G2K A;  2RQ6 A;  1PNK A;  2CAZ C;  4OPH A;  5L3B A;  1P7G A;  2R9A A;  1R3K C;  3CWB H;  4YJ3 A;  2VWK A;  1XNR B;  1COW G;  1O9G A;  1V55 C;  3L73 H;  2W6I G;  4TUY B;  4X8A A;  2PTM A;  1NTZ H;  3G67 A;  4JI3 B;  3ABM C;  3OW2 U;  4DV7 O;  1PNL A;  1THZ A;  1SQG A;  3T4Z A;  4X66 O;  1JOY A;  2ZNJ A;  4QIW F;  1YIJ V;  3RGB A;  1GN3 A;  3N2K A;  2L35 A;  1DLB A;  3AK1 A;  3OT7 A;  2F66 C;  5BY1 A;  1P7B A;  4JF3 A;  4O4H A;  4DV2 O;  4FFB B;  4YHH O;  1K92 A;  1XHX A;  2EJR A;  2WLL A;  4J9Z B;  3JAK B;  2YIC A;  4KL1 A;  5LA6 A;  4LF6 B;  2Y48 A;  1HP8 A;  2XAS A;  3OR7 C;  2EJ7 A;  2LO1 A;  1EFR G;  2DOS A;  4DR5 B;  3ZRW A;  3OEE G;  4G28 B;  2YIA A;  4JV5 O;  2VQE O;  3BEH A;  3H1I H;  4KFM A;  2PUS A;  4MTX A;  4DUZ B;  5LOV A;  1S5L Z;  2VQF O;  1KYO F;  2AZ0 A;  1TGO A;  3ETE A;  1FPO A;  3JAM N;  3VQV A;  2ZNI A;  1SQQ H;  4MT8 A;  3G80 A;  3GWK C;  4GX1 A;  2YXH A;  1VEW A;  3TCU A;  5KUM A;  3Q4H A;  1OHH G;  1KEC A;  4B08 A;  1NH2 B;  3CB2 A;  1BS3 A;  2XT9 A;  4ZHQ A;  3QTC A;  4U3J B;  2ITC C;  3VBB A;  3JAS B;  5JCO C;  2LJ2 A;  1XQ8 A;  2HLD G;  1XRE A;  5IJ9 A;  3QNE A;  3S3X A;  3ABK B;  4NB5 A;  1MZE A;  4X20 B;  3QO5 A;  1R3L C;  4DR4 B;  4Z1M G;  5JJN B;  1XL4 A;  2B1I A;  3RN4 A;  2FL4 A;  1AI4 A;  3WB2 A;  2UXD B;  1UPG A;  1M57 C;  1WPX A;  5B3S C;  2YI8 A;  2Q67 A;  2B5U A;  4PA7 A;  4RAI A;  3K9S A;  4FPP A;  1ZUQ A;  3STZ C;  2QKC A;  5EBL C;  1JX9 A;  2Q7E A;  3F5W C;  1QVG U;  4JI0 B;  1Q43 A;  1OCR B;  5H9C A;  3B2E E;  5L3D A;  2AHY A;  3A0R A;  4JI2 B;  3NXS A;  4U7N A;  5CA1 B;  5BR8 B;  1JJO A;  4WFH A;  2Y0P A;  2PI4 A;  2BTO A;  4I55 B;  4LF8 B;  4JZG A;  3UKM A;  4X1K B;  1XIL A;  2JK5 C;  3I56 V;  1PNM A;  2YUA A;  4GLX A;  4YJ2 B;  2BOC C;  4LNU B;  2A7W A;  4UCU A;  1VMG A;  2PYJ A;  1HNZ B;  1S5J A;  1YZB A;  3ZMS A;  5JVD A;  3E35 A;  5JH7 B;  3RYF B;  4ASU G;  2Z5U A;  1FFX B;  3T1Y B;  4GYC B;  4UV8 A;  3CRM A;  4DV6 B;  4RQF A;  1YIT V;  3VQY A;  5L3E A;  2AXT Z;  3RYH B;  3SYP A;  2YIB A;  2UUC O;  2IU3 A;  4HAM A;  5IYD O;  1XNR O;  2CE4 A;  1VQ6 V;  4LF4 O;  3KCX A;  2KKW A;  3W7S A;  2KSD A;  4O2A A;  3AG1 B;  3BVO A;  2DYR C;  1US6 A;  2YI9 A;  5IYB O;  4F6R A;  1L0N H;  2O57 A;  1YVW A;  1EBO A;  2EZP A;  2JIZ G;  1URF A;  4GX0 A;  4OPA A;  2QDO A;  3VQX A;  4K0K B;  3E8B A;  3HKD A;  3K5L A;  4ZBM A;  3K5N A;  1Y76 B;  4LH6 A;  2NLJ C;  1SER A;  5LHG A;  2YID A;  1N33 B;  2Z3Y A;  2X7R B;  3TGU H;  2LW7 A;  5CBF A;  2N05 A;  1VQM V;  4DUY B;  3QG5 A;  4P30 A;  2F1M A;  1PP9 H;  1K9M W;  4GUN A;  1S5H C;  5KHG A;  4I9Q A;  1XHZ A;  2D3O W;  3OEH G;  3WB1 A;  5J2T A;  1RSO A;  4UXN A;  2P6J A;  2Q7G A;  4Q6G A;  5HFM A;  3N2G A;  4UVA A;  1HNX O;  4J11 A;  1B3Q A;  3RYI B;  1KC8 W;  1GTO A;  4CC5 A;  4WFB V;  3E22 B;  2OIG A;  1Q6H A;  5AG2 A;  1B04 A;  1QHT A;  2QWR B;  3B8M A;  4G27 B;  4B3R B;  1U97 A;  2FYU H;  1YTF B;  2QR4 A;  2RNB A;  3K04 A;  5C8Y A;  4EB6 A;  4FLW A;  5BMV B;  4FM2 A;  4YXW G;  2BTQ B;  2CUG A;  2XUM A;  3SGI A;  3DSQ A;  2XTA A;  2GTS A;  5D5P A;  2EIJ B;  5CBH A;  4PEL A;  2P4K A;  4PA9 A;  1G4Y B;  2CGN A;  5J9P C;  5IWA O;  1AI6 A;  1HNW B;  2PGG A;  4IYI A;  3P30 A;  5FL7 G;  4PA3 A;  1U96 A;  3DXR B;  4LF5 O;  2UXC B;  4DRX B;  3ZX6 A;  4CS4 A;  3CMA V;  3SYQ A;  2LGW A;  3LDC A;  3OE7 G;  4X64 O;  4TQD A;  3ZN0 A;  4I0X A;  1M4U A;  3ABL B;  3H1L H;  2F4V B;  4RUF A;  4JI0 O;  1QNM A;  5GTI Z;  4UCS A;  2R72 A;  5E1A C;  3CCJ V;  4DW1 A;  2ITD C;  1P84 F;  1IBL B;  3VOU A;  3OMN B;  1K97 A;  4TQF A;  2VWJ A;  4CS2 A;  1E79 G;  3CCE V;  1IBM O;  3ZRV A;  2CGO A;  3L72 H;  4JTD B;  4FMT A;  2GTA A;  2WLN A;  1N32 B;  3L71 H;  1AR5 A;  1SES A;  2LQT A;  1BZK A;  2DYS C;  4YY3 B;  3SJC C;  5CB4 A;  3L9D A;  1LNQ A;  3OMA B;  1FXK B;  4MVS A;  2RMK B;  1Y74 B;  4ZI7 B;  4JTA B;  3CCU V;  2VRZ A;  3ABK C;  4DR6 O;  1Z5V A;  3WU2 Z;  4DV5 O;  4I7Z B;  1FJG O;  3C90 A;  1G8M A;  1F4N A;  1SQP H;  1NR1 A;  2M6Y A;  2OCH A;  4UFZ A;  5LMU B;  3QO8 A;  2EIM B;  1M93 A;  5FNV B;  4B3M O;  3ICX A;  4WF9 V;  3APQ A;  4O2B A;  4LWS B;  1PM9 A;  1NI8 A;  2EIN B;  2QGN A;  1B06 A;  2AGA A;  2CH7 B;  1H2S B;  3DTU B;  4QPJ A;  2Q7H A;  4MVM A;  4FZ0 A;  4DK0 A;  5JQG A;  2QA4 V;  2P4V A;  1OCR C;  1DF4 A;  2F95 B;  3K9A A;  3HKB B;  2GBO A;  4ZOL A;  4RUE A;  3D3Q A;  4O4J A;  2YEV B;  1GK9 A;  5KMG B;  2HR3 A;  2UUA O;  5LP6 A;  1M90 W;  1XMQ O;  3J7A U;  3CS5 A;  3T2M A;  3E89 A;  1XDC A;  1MAB G;  5LHH A;  1IBK B;  5EK0 A;  4J41 A;  4NXM B;  5JJJ B;  1JQ0 A;  4X9Q A;  1DK1 A;  2GV9 A;  3A8T A;  1AR1 B;  5EYP A;  4EEQ A;  4IYH A;  4MVZ A;  1WPB A;  3OD4 A;  4W4K A;  1SS3 A;  3ZRW B;  5IE9 A;  5KHK A;  4IIJ B;  3MHH C;  4GKJ B;  2NN4 A;  3IAY A;  2JGD A;  2N04 A;  4JPR A;  1XBL A;  4PJ0 Z;  1NBM G;  1P4R A;  5LOV B;  1NJI W;  2RCV A;  3W7U A;  1AJQ A;  3K79 A;  2ZDI C;  5IT9 N;  1AR4 A;  4UVB A;  2B9Z A;  3AG1 C;  3SJQ C;  1GN2 A;  4LF7 B;  1VQ5 V;  2OT5 A;  1PPJ H;  1N36 O;  2UU9 B;  1S3J A;  3CYO A;  4NXN O;  4TV8 A;  5KA5 A;  3O65 A;  3SPG A;  3HKC A;  4JI6 B;  2PF4 E;  4NR1 A;  4J7J A;  3JD0 A;  1MOF A;  2HVJ C;  2YC0 A;  4JI1 O;  3OMI B;  3R65 A;  3RWR D;  2UUB O;  1MG1 A;  4JI7 O;  2UXC O;  4DR3 B;  5F2V O;  2UXN A;  3QO7 A;  4WBN B;  3CCQ V;  2DWD C;  4TT3 G;  5EBM C;  3RYC B;  1BQZ A;  4NYK A;  2UXB B;  2FKX A;  2EZO A;  3OTF A;  5KHH A;  3E83 A;  2ADP A;  2HJF C;  2AW9 A;  4R50 A;  1QU7 A;  4DYL A;  4R7C A;  5GW7 A;  4MTO A;  1TA8 A;  3ABT A;  2ZIO A;  1GH6 A;  2M7W A;  4CBC A;  1I5Y A;  2WLI A;  3ZBH A;  3U11 A;  1YTF D;  1N32 O;  4I50 B;  3ZHV A;  1FAF A;  4X1Y A;  4IT5 A;  4P9P A;  1EN6 A;  3HKE A;  3IJ4 A;  3K06 A;  5CA0 A;  4BW9 A;  1V9P A;  1MMM A;  4IHJ A;  4DV3 B;  1ZSP A;  3JAT B;  3T1H O;  3CCR V;  5KX5 A;  2H3O A;  2CK3 G;  1YCI A;  2EIJ C;  2ZE6 A;  1Q5O A;  3LDD A;  4Z1V A;  4FM1 A;  1SET A;  5JCO A;  3ZMU A;  4R6Z A;  3ZS8 C;  1SC5 B;  2P67 A;  3WFV A;  1Y67 A;  4DR1 B;  4FLZ A;  5GON A;  5KUK A;  2F93 B;  1VQ4 V;  3JAR A;  1TAE A;  1KKD A;  3E8H A;  1H2N A;  4LFC B;  3ML0 A;  4JYC A;  4Q20 A;  4JI5 O;  4I4T B;  3BAB A;  2NR5 A;  3ABL C;  1F23 A;  1TUB B;  1SKV A;  1WJZ A;  4J80 A;  4NTW A;  2AZ2 A;  5IY5 B;  1YDX A;  2YS8 A;  2Q9L A;  1IX9 A;  5EZY A;  5LXT A;  1RP3 B;  1GN4 A;  4UCV A;  5L3F A;  1Q90 D;  2WLH A;  4JI8 O;  3UT5 A;  3SJB C;  4PI0 A;  3ZMZ A;  2IBZ H;  1OCO B;  2ILM A;  1IXB A;  1IBK O;  4O4L B;  1TVK A;  5EBW C;  4TSF G;  3EVK A;  4PV1 B;  3D36 A;  4H37 A;  4WFF A;  5CMU A;  1K34 A;  1R6K A;  1FXK C;  3CRQ A;  3OR6 C;  3JD4 A;  3G71 V;  4B3S O;  4LF9 B;  3K5O A;  2GUZ A;  5J2U A;  2W0X A;  4AQY B;  3SYC A;  2DYS B;  2P06 A;  4X1I B;  2ZM6 B;  1S77 D;  4B3T O;  2K1E A;  4CH6 A;  3X2Q C;  4DV4 O;  5IYZ A;  2EIM C;  4GT1 A;  4JI4 B;  4WCE V;  1AVM A;  1XNQ B;  5D5Q A;  3AG2 B;  2EIN C;  1WLE A;  2NNU A;  2E5L B;  1JFF A;  1Z5W A;  1ARO P;  1JR9 A;  1CXZ B;  1KUQ A;  2ZXW B;  4YIO A;  4EB6 B;  3P3N A;  5H6Q A;  5BXZ A;  5LMN B;  2P90 A;  2ZKO A;  1WAZ A;  3OM3 B;  3GWO A;  4D6T H;  3J81 N;  1WA8 A;  3K03 A;  4P9O A;  4KUM A;  3STL C;  2JS3 A;  3IGA C;  4OX9 B;  2HJD A;  4PHZ A;  4J7K A;  3TK1 A;  4DR3 O;  2IW5 A;  1UFI A;  1MSW D;  4QPK A;  3LSS A;  4N23 A;  3JAW A;  1GAX A;  4I0X B;  3TET A;  2XAF A;  2Q68 A;  1R6T A;  5JWP A;  3RW0 A;  1MA1 A;  3RFR A;  4DV0 B;  4JAU A;  4X65 B;  3O9O A;  1PV0 A;  4LFB O;  1KKC A;  3EXA A;  1N4C A;  1BE3 H;  3T1C A;  2Z0A A;  3TXS A;  3OTO B;  5C93 A;  1I7F A;  1NKD A;  3ETG A;  3CCV V;  3WG7 B;  3JAL A;  2BE3 A;  5LGU A;  2HP8 A;  4MTG A;  3SPH A;  5EIB C;  1Q82 W;  3EHB B;  2Q5Z A;  1RM1 B;  4BWA A;  4HNA A;  1ZTE A;  5CB4 B;  4BIZ A;  5H2F Z;  4CC6 A;  2X6A A;  1DF5 A;  1GKF A;  4JI3 O;  2QWO B; 
#chains in the Genus database with same CATH homology
 1JVM A;  2KB1 A;  1QR8 A;  2X6B A;  1E79 G;  2QM8 A;  3CCE V;  2DQ0 A;  1JCH A;  3ZRV A;  2W0F C;  4JTD B;  1GM7 A;  4FMT A;  2WLN A;  1S76 D;  4HZ3 A;  1SES A;  2X6C A;  4DO2 A;  4MTF A;  3CPW U;  1W2B U;  3ZMT A;  1K3E A;  2DYR B;  3SYO A;  2OTL V;  3CCL V;  3CCS V;  3CD6 V;  3F7V C;  2ZD9 A;  4UUJ C;  2DYS C;  1V54 B;  1YJN V;  1M9N A;  3FKS G;  4WFG A;  1Q81 W;  2F43 G;  2OTJ V;  1LNQ A;  3OMA B;  4PDR A;  1GM9 A;  4CZZ A;  1FXK B;  4MVS A;  4JAV A;  1KQS U;  3G6E V;  1E1R G;  5B1A C;  3LDE A;  4JTA B;  4RQE A;  3CCU V;  3JD3 A;  4PA6 A;  3ABK C;  3K0G A;  1CEZ A;  1QBZ A;  1YJ9 V;  1GMG A;  2EIL C;  1FS0 G;  2QE7 G;  4UV9 A;  1AJN A;  3DGE A;  3IC7 A;  1G8M A;  3JYC A;  1F4N A;  1K7D A;  2IJK A;  1NR1 A;  5L3C A;  3B8N A;  4BW5 A;  3QO8 A;  2EIM B;  1R73 A;  1NVP B;  4MVR A;  4WF9 V;  1ROP A;  3AG4 C;  2JDI G;  2R9R B;  3FYE B;  1PL0 A;  1JJ2 U;  2WWW A;  2EIN B;  2X0L A;  1QLE B;  1FXH A;  2DQ3 A;  3DTU B;  4QPJ A;  1FXK A;  4MVM A;  1B6Q A;  3P32 A;  3CCM V;  2Q69 A;  3I55 V;  2QA4 V;  3SYQ A;  3OUF A;  1OCR C;  1DF4 A;  1AJP A;  4JYB A;  3K9A A;  1RPR A;  5LBQ A;  4G2K A;  1M1K W;  2IH1 C;  1PNK A;  4RUE A;  5KA6 A;  1PD3 A;  2IH3 C;  1RPO A;  5L3B A;  2YEV B;  1R3J C;  1GK9 A;  1IXM A;  1R3K C;  2GHY A;  2HR3 A;  1M56 C;  1H38 A;  1M90 W;  3KG2 A;  3PJS K;  3T2M A;  5LGT A;  3E89 A;  3GB7 C;  1MAB G;  5B1B C;  1COW G;  1V55 C;  5LHH A;  5EK0 A;  2EIK C;  1YSC A;  2W6I G;  3RBZ A;  1K73 W;  2ATK C;  2Y69 B;  4X8A A;  1OCC B;  1JQ0 A;  2GSM B;  5HFL A;  1FFT B;  4QNH B;  2V1D A;  3BY6 A;  2LFS A;  3ABM C;  3OW2 U;  3UM7 A;  1AR1 B;  2V7Q G;  1H2G A;  1TUE B;  1PNL A;  1THZ A;  4MVO A;  3T4Z A;  4MVZ A;  1JOY A;  4QIW F;  1YIJ V;  3SPJ A;  3ZRW B;  2AHZ A;  3ASN C;  1YHQ V;  3MHH C;  1YI2 V;  5IY5 C;  1VQN V;  1DLB A;  3E2E A;  1P7B A;  4JPR A;  4JF3 A;  3W7W A;  1NBM G;  1P4R A;  3OFN G;  3ZCC A;  1NJI W;  3ZRX A;  1K92 A;  1R6N A;  2EJR A;  3W7U A;  2HG5 C;  2WLL A;  4GX5 A;  4J9Z B;  1OCO C;  4F4L A;  3T4D A;  1AJQ A;  3K79 A;  2ZDI C;  5BZB A;  3LNM B;  2Y48 A;  2XAS A;  4UVB A;  5CA3 A;  3OR7 C;  1EFR G;  3AG1 C;  5IYC O;  3SJQ C;  4I9W A;  3ZRW A;  2UXX A;  3M99 B;  3OEE G;  4G28 B;  1QVF U;  4JTC B;  1VQ5 V;  2OT5 A;  3EFF K;  1S3J A;  3BEH A;  3CYO A;  4KFM A;  2MK3 A;  5KA5 A;  1FXV A;  1OCZ C;  1J95 A;  4MTX A;  3SPG A;  3E8G A;  4LCU C;  1NH2 D;  3ETE A;  4X89 A;  1PKX A;  2H8P C;  4MT8 A;  3G4S V;  4BIU A;  3JD0 A;  1MOF A;  2HVJ C;  4MW8 A;  3OMI B;  3R65 A;  5B1O A;  2IJJ A;  4GX1 A;  1MG1 A;  1QR9 A;  4JAS A;  4WFE A;  3HB3 B;  3TCU A;  4HYO A;  4H33 A;  1VQO V;  3AG3 C;  3B77 A;  3JCZ A;  2DWE C;  2UXN A;  3QO7 A;  5KUM A;  1OHH G;  5LGN A;  1KEC A;  2H94 A;  3CCQ V;  3AG2 C;  1NH2 B;  3W7X A;  3X2Q B;  2DWD C;  4TT3 G;  5EBM C;  2ITC C;  2C2A A;  1K5S A;  2EZO A;  5B1A B;  3VBB A;  4OXS A;  2HLD G;  3E83 A;  2ZXW C;  2QTO A;  1EZJ A;  3QNE A;  3ABK B;  2HJF C;  4R50 A;  2EIL B;  1CPY A;  4R7C A;  1XL6 A;  3QO5 A;  4XDK A;  5GW7 A;  1R3L C;  4MTO A;  4L87 A;  4Z1M G;  4QJF B;  1XL4 A;  2B1I A;  3ABT A;  1ZWI C;  1AI4 A;  2XAH A;  2M7W A;  1M57 C;  1WPX A;  3AG4 B;  4CBC A;  2PI5 A;  5B3S C;  4N21 A;  2Q67 A;  3SYA A;  2B5U A;  4PA7 A;  1I5Y A;  2WLI A;  4RAI A;  1YTF D;  4FPP A;  3K08 A;  1BMF G;  2HFE C;  3STZ C;  4P9P A;  1SRY A;  3CP1 A;  3K06 A;  5EBL C;  1JX9 A;  1QVG U;  2JEU A;  3F5W C;  5CBG A;  4FJC C;  2XAQ A;  1OCR B;  2OCC B;  5H9C A;  3CCR V;  5CN0 A;  4UVC A;  5L3D A;  2CK3 G;  1ORQ C;  2AHY A;  4MVQ A;  1JPX A;  2A9H A;  2EIJ C;  3A0R A;  1N8R W;  3ASO B;  3LDD A;  2IJI A;  3W7T A;  1SET A;  1K4D C;  2WLL B;  3NXS A;  4U7N A;  1VQP V;  3ZMU A;  4I5S A;  4WFH A;  4R6Z A;  2QM7 A;  2PI4 A;  1M56 B;  2P67 A;  4WFA V;  3WFV A;  3UKM A;  3CC4 V;  3ZN1 A;  1BHA A;  2QKS A;  3ZJZ A;  1V55 B;  5KUK A;  2A0L A;  1F51 A;  2JK5 C;  2EIK B;  3LSQ A;  3I56 V;  1VQ7 V;  1S72 V;  1VQ4 V;  4MW3 A;  5L3G A;  2IU0 A;  1PNM A;  3ZRS A;  1SZT A;  1KKD A;  3E8H A;  1W0K G;  4FK5 C;  3WG7 C;  3ML0 A;  4JYC A;  2BOC C;  4Q20 A;  3ABM B;  1Q86 W;  1CP9 A;  5DN6 G;  3ZMS A;  3ABL C;  1F23 A;  2IJH A;  4LC1 A;  3K0D A;  1QCE A;  3E35 A;  3RVZ A;  1RM1 C;  2HKO A;  4ASU G;  2Z5U A;  2ZR2 A;  5H6R A;  1E1Q G;  5IY5 B;  4UV8 A;  1OZ0 A;  3D3I A;  4RQF A;  1YIT V;  3SPC A;  1H8E G;  5L3E A;  5L3F A;  2WLK A;  2WLH A;  3SYP A;  1NR7 A;  4X88 A;  2IU3 A;  5DM6 V;  3ZMZ A;  2XOK G;  2XND G;  4HAM A;  5IYD O;  1OCO B;  3HPL C;  4PA4 A;  1VQ6 V;  1AI5 A;  1K8A W;  3AEI A;  4GX2 A;  3W7S A;  2BOB C;  5EBW C;  4TSF G;  3AG1 B;  3OAA G;  1KD1 W;  3D36 A;  2DYR C;  2WLM A;  4H37 A;  4WFF A;  1KP2 A;  5IYB O;  4QE7 A;  1V54 C;  2P7T C;  5CMU A;  1K34 A;  1BL8 A;  2DW4 A;  1R6K A;  2JIZ G;  1EBO A;  1FXK C;  2EZP A;  4P2Z A;  4FIP C;  4GX0 A;  4PDL A;  4LP8 A;  1L1F A;  1OCZ B;  3OR6 C;  3JD4 A;  4BAY A;  3G71 V;  2XAJ A;  3E8B A;  4R8C A;  4ZBM A;  3SYC A;  1KP3 A;  2DYS B;  1S77 D;  2WLI B;  3FB8 C;  2NLJ C;  2XAG A;  1SER A;  5LHG A;  1W0J G;  2Z3Y A;  2X7R B;  2K1E A;  5CBF A;  2ZDI A;  2FTK A;  3X2Q C;  1DTO A;  1VQM V;  2EIM C;  4MS2 A;  1NVP D;  4P30 A;  4GT1 A;  1VQK V;  3AG3 B;  1K9M W;  2JJ2 G;  3JD1 A;  4WCE V;  3ETD A;  1S5H C;  3AG2 B;  2EIN C;  1QLE C;  1WLE A;  2NNU A;  2JJ1 G;  3RVY A;  3FB7 C;  3CME V;  2D3O W;  3OEH G;  1ARO P;  3CC7 V;  3ABU A;  2LFR A;  2ZXW B;  2R9I A;  5H6Q A;  5IDJ A;  4UXN A;  2P6J A;  2P90 A;  4EKW A;  4PDM A;  5HFM A;  4QE9 A;  4UVA A;  3CXC U;  4LBE C;  1NQT A;  3JD2 A;  3OM3 B;  5EC1 C;  3GWO A;  2ZR3 A;  1BHB A;  1KC8 W;  1GTO A;  1HWY A;  4WFB V;  1Y66 A;  3SPI A;  1M57 B;  3K03 A;  4XBF A;  2YSU B;  4P9O A;  3B8M A;  5B3S B;  4KUM A;  4G27 B;  3STL C;  5EC2 C;  2OCC C;  4XDL A;  4ZKI A;  3IGA C;  1YTF B;  3TK1 A;  2Y69 C;  3ASO C;  1OCC C;  2IW5 A;  3K04 A;  4KP4 A;  3H01 A;  3K3W A;  1VQ8 V;  1MSW D;  4QPK A;  3LSS A;  4N23 A;  3MD0 A;  4YXW G;  3TET A;  2XAF A;  2Q68 A;  2WSS G;  1K5Q A;  5B1B B;  3RW0 A;  2A79 B;  2WLJ A;  3ZMV A;  2EIJ B;  5CBH A;  1GM8 A;  3CC2 V;  3FB6 C;  4JAU A;  5LHI A;  4PEL A;  1VQL V;  1R3I C;  4E2L A;  1K4C C;  2Q6A A;  1QLN A;  2WAM A;  4PA9 A;  1Q7Y W;  1G4Y B;  1YJW V;  4PDV A;  4TWK A;  5J9P C;  1AI6 A;  3P30 A;  5FL7 G;  4PA3 A;  2W6J G;  3ZIA G;  1AI7 A;  5B1N A;  2LP7 A;  3LUT B;  2QEX V;  1K33 A;  3E86 A;  4MVU A;  3ASN B;  3T1C A;  2B1G A;  5C93 A;  3ETG A;  1NKD A;  3OGC C;  3CCV V;  3WG7 B;  1S0V A;  3CMA V;  2HVK C;  2JEX A;  3LDC A;  3OE7 G;  2YEV A;  1ENV A;  3E8F A;  4MTG A;  3SPH A;  4MSW C;  5LGU A;  3ZN0 A;  4DXW A;  2EBO A;  3ABL B;  1Q82 W;  4RO2 A;  2ZQM A;  4XDJ A;  1GO3 F;  3EHB B;  1RM1 B;  4RUF A;  1I5X A;  3FB5 C;  1F4M A;  1UJW B;  3IFX A;  3MHS C;  5E1A C;  1VQ9 V;  4BIZ A;  3FYI B;  2WPD G;  3CCJ V;  4U7O A;  2ITD C;  3OUS A;  3VOU A;  2X6A A;  4GCZ A;  3F7Y C;  3OMN B;  1K97 A;  1H8H G;  1DF5 A;  1GKF A;  4J9Y B;  1Y4M A;  4JGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...