2AHYA

Na+ complex of the nak channel
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
104
structure length
104
Chain Sequence
b'MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Atomic structure of a Na+- and K+-conducting channel.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 46
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ahyA00
1K4CC 3ASOC 3FB6C 3SYCA 4X8AA 3IFXA 4G28B 3TETA 5KUKA 2KB1A 3K0DA 3ZRSA 2Q6AA 3JYCA 1XL6A 4MW8A 2WLJA 4PA3A 3K03A 3LDEA 1S5HC 4RUFA 4CBCA 5EBMC 3T2MA 3SPJA 3ZJZA 2X6CA 5B3SC 3OGCC 3LUTB 1V54C 2QKSA 2P7TC 2ATKC 4HYOA 4TWKA 4H37A 2EINC 2IH3C 3K06A 3SPHA 3AG2C 2Q69A 4HZ3A 2HG5C 4X89A 3LDDA 4WFHA 3T1CA 2H8PC 4PA6A 2YEVA 2DYRC 1R3IC 5BZBA 4R50A 4EKWA 5IY5C 1BL8A 4OXSA 1J95A 3FB8C 4PDVA 2ZD9A 4MTFA 3E8GA 5EC1C 5E1AC 4F4LA 2X6BA 5KUMA 2Q68A 3IGAC 3F5WC 4JTCB 3HPLC 4MVSA 4P2ZA 5B1BC 3OUSA 1R3KC 2EILC 4QE7A 1G4YB 2ZXWC 5EK0A 3RW0A 4PDMA 1OCOC 2BOCC 1V55C 3LNMB 3R65A 4H33A 4MS2A 4MVOA 3SYOA 3SPCA 2W0FC 3GB7C 3SPIA 3STLC 2EIMC 4PA4A 3STZC 1M57C 2DWEC 3E8BA 5EBLC 1K4DC 2WLMA 3K0GA 3K08A 4MW3A 1P7BA 3E8FA 1OCRC 5EBWC 3VOUA 4WFEA 2ITDC 2WLIA 3FB7C 4PDRA 4QNHB 2QTOA 3OUFA 2WLLA 2A0LA 2ITCC 3RBZA 3T4ZA 3WG7C 2A9HA 3AG3C 3TCUA 2HFEC 4MVQA 3X2QC 3OR7C 4GX2A 4LBEC 4MTOA 1OCZC 2WLLB 2DWDC 4JTAB 4XDLA 4JTDB 2EIKC 2R9RB 1R3JC 4J9YB 4R6ZA 2AHZA 2Q67A 1XL4A 3KG2A 2BOBC 4PA9A 4MVRA 3T4DA 1JVMA 2WLNA 3E89A 3RVYA 5J9PC 4I9WA 4DXWA 3E8HA 4QE9A 4R7CA 3SYQA 3ASNC 3SYAA 3E83A 3FB5C 3UKMA 2HJFC 4GX0A 4BW5A 4WFFA 4LP8A 1OCCC 4MVMA 5EC2C 4P9OA 1ZWIC 4PDLA 3AG1C 4G27B 4XDJA 4P9PA 3UM7A 3SPGA 4MVZA 5CBFA 2K1EA 3E86A 4X88A 2A79B 4MTGA 1QLEC 4P30A 3K04A 2WLIB 3F7YC 4ZBMA 5CBGA 2AHYA 4LCUC 1LNQA 2WLKA 4J9ZB 4WFGA 4GX5A 3EFFK 3OR6C 2HVKC 4MVUA 2X6AA 3LDCA 4R8CA 4KFMA 3SYPA 2DYSC 2Y69C 3PJSK 4RUEA 2OCCC 3SJQC 4MSWC 3RVZA 3ABKC 3F7VC 4PA7A 3AG4C 4GX1A 2JK5C 4RAIA 2NLJC 3ABLC 1KKDA 4UUJC 1M56C 2HVJC 2WLHA 4RO2A 3ABMC 4XDKA 2IH1C 1ORQC 3BEHA 2EIJC 5B1AC 5CBHA 1R3LC
chains in the Genus database with same CATH superfamily
1OCRB 2CK3G 1AP5A 3HKEB 4UFZA 4J11A 1YIJV 4MTXA 5GONA 4KHPO 4X1IA 4FLXA 1H2GA 2JGDB 4K0KO 3UQ8A 1I5XA 5KAIZ 1GN2A 2LFRA 4B08A 1VQKV 2OT5A 3GWKC 2IM9A 3BA9A 4DV0O 4OXSA 2YEVB 1E79G 4KHPB 3I55V 3K9SA 5IJ0B 1AR5A 3OE7G 4JTCB 1ENVA 5A2QN 3L70H 3JD3A 1G4YB 4GUNA 5H6RA 1N36B 4MVOA 3B09A 2ETNA 2CTWA 5CA0A 3RWRD 3UO3A 4D6TH 3K0GA 2QTSA 3KCXA 2Y0PA 1GN3A 1N8RW 4FLVA 3VQYA 4LF7O 2HHHB 2UXNA 4UCTA 3DSQA 4ASUG 3TGUH 3ZMSA 1XOUA 4F6RA 2UUAB 1HNZO 3OTOO 1S0VA 4J9YB 2AHZA 1Y74A 1VF7A 4MVRA 1AB3A 5J9PC 3MHSC 3ABKB 1R6KA 2RCVA 4PD4F 3CPWU 1RM1C 1Q6HA 2Q8VA 2X0LA 4J7KA 4EB6A 3CRMA 2VRZA 1FXKC 1H8EG 1L1FA 1GAXA 1HNXB 3OTFA 4MVUA 2X6AA 5B1BB 4ZHQB 1OCOB 1K8AW 3AG4C 3I5DA 4HBNA 4LFCO 5LXTB 3DXRB 3WB0A 3IFXA 4QPJA 3WG7B 1EBOA 1WP8A 2F95B 1S5HC 1B06A 3L73H 3RT3C 4UCOA 1J5EB 1NTZH 4X1KB 2P4KA 5CA3A 1SA0A 1OHHG 2CTQA 2XASA 2A06H 4FJCC 3K79A 4YIPA 2X7RB 5LP6C 4J7ZA 3ZEDA 2H8PC 4PA6A 1FS0G 1VMGA 1QVFU 1BL8A 3JATA 3HB3B 3BFRA 5C93A 4JYYA 1WLEA 2BTQA 2X6BA 5BXZA 2YC0A 3APQA 4U7NA 4JI1O 2DQ3A 2ZINA 4WBNB 4YHHO 2XAHA 1WPBA 1NR1A 4FMTA 4GT1A 3E8FA 1IXBA 1VQOV 1MABG 1BHAA 2OIGA 1GM7A 3CMAV 1M4UA 1A32A 2DWDC 4XDLA 1Q90D 1TUBA 4JTDB 4JF3A 1R3JC 4RQFA 3ABUA 1OJHA 5KHIA 3B8MA 4C7UA 3ASNC 3FB5C 4B3MO 2E5LB 1AI5A 3TXSA 3A2FA 1ZWIC 4G27B 4XDJA 3RYFA 5F2VO 4X88A 3HKDB 2ZR2A 4GLXA 5EZYB 2Z0AA 3EFFK 2YUAA 1HW7A 5C8YA 4PA7A 4B3MB 1WB8A 1M56C 3HKEA 1ORQC 4DV7B 5CBHA 2WA3A 3SJCC 4CZZA 3HKBB 3SYCA 2V7QG 4FZ1A 3SJAC 1N34B 3LSUA 2JGDA 1IURA 4UXNA 1KP2A 2QKSA 2EIKB 1H8HG 3C3TA 1BQ0A 3RN4A 2IH3C 4W4KA 5LMUO 2F4VO 3JD0A 1QNMA 3WU2Z 2YEVA 1YTFB 2HKOA 1Q8IA 1HDJA 4I5SA 2DJVA 4JI5O 1B3QA 5IJ0A 4OPAA 1I94O 3QNEA 4MTFA 5EC1C 3H01A 1SQQH 2Q68A 2V4DA 3CC4V 1FJGO 4LFAO 3ZRVA 4DK1A 4QE7A 1Y76A 1TUEB 2QE7G 4U7OA 4CC5A 5LMUB 2F4VB 3AK1A 4JV5O 3SPCA 1SKVA 2JEXA 4JI5B 1DF5A 5BY1A 1I94B 5LBQA 2W0XA 4LF8O 3B40A 2LP7A 2EJRA 3JAWB 4LFBO 3AEIA 1NH2D 2QM7A 2B9ZA 2WLLB 2YIAA 3G67A 4X66O 4JAUA 1SS3A 3E8HA 3ZBHA 1I5YA 4I7ZB 3OMAB 4CC6A 4WFAV 4LFBB 4AILC 3UM7A 4CS4A 5CBFA 3BA8A 1BMFG 4ZHQA 1NKDA 4DR6B 4WFGA 3CMEV 3ZHUA 4B3TO 2Y0IA 3G4SV 1VQ4V 1MG1A 1SQVH 5KHJA 1IVSA 2ZE5A 3ZMZA 2EIMB 4W4LA 3DXRA 4DUZO 4FIPC 1S72V 1GTOA 2QWOB 1XUQA 1MOFA 3M99B 3D36C 3ASOC 4JZ2A 5GW7A 1WPXA 2KB1A 2Z3YA 4I50B 1XL6A 4BR6A 3A0HZ 1GM8A 4B3TB 5ITZB 1WN7A 4U3FH 3VQXA 3OGCC 4X9QA 1XMQB 3K5OA 2F1MA 2Q4PA 5KA6A 2EZOA 4H37A 4JI3B 4PHZA 4K8XA 1XHZA 3H9VA 1W2BU 1R3IC 3CHXA 3AK3A 3CC7V 4NTWA 2M6YA 2QSAA 5H2FZ 4QJFB 4DR5O 3ZN0A 3ZHQA 3ZIAG 3CEIA 4GZRB 4X62O 1SRYA 3W7TA 4DR7B 4MVSA 4WBNA 3N27A 4OX9B 1JA8A 4YY3O 2ZIOA 5GONB 1KKCA 3MD0A 4PELA 1H38A 1AJNA 2CE4A 3ABMB 4MW3A 5B1AB 2EIJB 4JI6B 5JWPA 3FAVB 2EX3A 2VQEB 3T4ZA 4H0LB 2BSKB 2CDYA 4MTOA 1KQSU 1OCZC 4YY3B 1KECA 2G38A 4KP4A 4R6ZA 3IC7A 1XL4A 2LO1A 3KKYA 1K7DA 1QQCA 3JALB 3CRAA 4LP8A 3HKDA 1K92A 3WFVA 1RFYA 4OGQB 5EZYA 5H6QA 1NQTA 3RGBA 3E22B 1QLEC 1GMGA 2CTPA 4J41A 4J9ZB 5IE9A 3K57A 4DUYO 4RUEA 3O65A 4IYIA 4FLTA 4JI4O 3KZIZ 3QO7A 2JJ1G 1ZUQA 3AK2A 3HKBA 4UB8Z 2PI4A 4XDKA 4NR1A 4NXNB 2FTKA 2IJJA 1XI1A 5LHIA 3K0DA 3AG3B 4XBFA 3BVOA 2UXDO 1ZLZA 1M5IA 3EVKA 4JI0O 5LGUA 4JI4B 1URFA 2GDSA 2EINC 1PM9A 2W6JG 4LWSB 4HZ3A 2PZSA 2OYQA 3T1CA 1YITV 1KC8W 2UXDB 1JFFB 2OTLV 5K1PA 3OEHG 3BY6A 4PV1B 4YJ3B 4H44B 2ZXWC 4ICGA 2Y69B 2P90A 2BOCC 3K59A 2QGNA 1Q6IA 5L3BA 2QA4V 1DF4A 1M57C 1FKAO 2P6JA 1SZXA 2Z5UA 2E74B 3JAWA 3O9OA 4Q6GA 1UJWB 4K3AA 3JCZA 2QTOA 2WLLA 3C90A 4EFEA 4GX2A 4O2AB 3M8AA 2BTQB 3CCRV 1KBHA 5IJ9B 2DYSB 2Q67A 3TK1A 2PY5A 1FXHA 3H1JH 4LF9O 4AQYB 1BQZA 1SF9A 2LGQA 3KCYA 3B4SA 1YVWA 5J2UA 2HJFC 2JS3A 1VIBA 1N33O 4P9PA 3F7YC 5LHGA 5CBGA 4WCEV 3RFRA 3TJTA 2VQFO 3OM3B 1W0KG 4X1YB 1GN4A 5CN0A 5LYJB 5GTHZ 3CWBH 4NVPA 1VQ7V 1Q81W 4J10A 1BSMA 2E3CA 4CH4A 2ZT9B 4FZ0A 3T1YO 2PYJA 3M7MX 4U3JB 4JGSA 1AP6A 2L35A 4I50A 3C3SA 1THZA 5ITZA 3JARB 4NB5A 3QO8A 1R73A 3FKSG 5CB4B 3LSSA 4DV2O 3WB1A 3OAAG 4JYAB 3BCCH 4HYOA 2UXBO 4O4LB 2R9IA 2DOSA 3K06A 4DR1B 3AG2C 1XNRO 3LDDA 2IJHA 2LW7A 4GKJB 2HEPA 4EKWA 3RYCB 2FB5A 5E1AC 4JI7O 1FXKB 5IWAO 1AVMA 3JASB 1D5AA 1IBLO 3HPLC 3CCUV 5FNVB 3OUSA 2F66C 3W7SA 1LR1A 1RPOA 5KX5B 1XNRB 4H33A 3AG4B 4JI8O 3E8BA 1QR9A 1PNLA 3FAVA 5JCOA 2ADPA 3VOUA 2EBOA 2XT9A 2BSKA 3ZS8C 1AR1B 1IBLB 2RN9A 3TCUA 2HFEC 3X2QC 4KXRA 4JPRA 3P32A 2ODMA 4K0KB 2VWKA 3T4DA 4AHCA 3QTCA 1XEQA 3JALA 3RVYA 3ETGA 3CCLV 2YI8A 1Y76B 5LP6B 3JD4A 3CP1A 4DV0B 3E22A 1NTMH 5DEDA 4I9QA 4B3SO 1PNMA 4DV6O 2CTRA 4NTYA 4CS2A 2XTAA 1IBKO 3OR6C 1MZFA 4R8CA 1S5LZ 4DW1A 1WA8B 4FM2A 5IYCO 2QDOA 1MZEA 3H1KH 2ZDIC 1Y6XA 3L72H 1K73W 2QEXV 1SQGA 4LF7B 5CA1B 3VQVA 1WNSA 3CE2A 4PA3A 3CXHF 1Z5VA 1HNZB 3OTOB 3G80A 1JJOA 2Q0OC 1MSWD 3R66A 5L3DA 3SDLA 1H2MA 4HAMA 4LWSA 1YI2V 1PKXA 4TWKA 1H2NA 1MA1A 4GKKO 1V55B 4UVAA 2HG5C 3GVMA 3ASNB 1I08A 1WJZA 1JFFA 2YXLA 1QU7A 5JH7B 3FB8C 1PL0A 2OCHA 2RJZA 1Q82W 2GUZB 4YJ3A 3W7WA 1G1XB 4TSFG 1BZKA 3JSNA 3SYOA 3E35A 2W0FC 3GB7C 1VARA 4LFCB 2FL4A 2W6IG 4O4IB 1M56B 5IYBO 2PYLA 3K08A 4WFEA 2ITDC 2JEUA 5H9CA 1BS3A 4O2AA 3CS5A 1YCIA 4JYBA 3CXCU 5IJ9A 4JTAB 3CRRA 2ZE8A 2FKXA 4YJ2A 2QKCA 4DXWA 4DR2O 5K1XA 1Z5WA 2L6LA 1ZX3A 2DN9A 4DV4O 4OPHA 1OCCC 3I56V 4FM1A 3ZMVA 3SPGA 1GM9A 1YJNV 3UT5A 4X1YA 5LYJA 5B66Z 2WLKA 4JI1B 2HR3A 2A7WA 4YHHB 2ZE7A 1JOYA 4GCZA 3ABKC 1PPJH 2XAJA 2N04A 2JK5C 2P22C 4U3JA 2NLJC 3IAYA 5KLVH 3JARA 1KD1W 1Y66A 1FPOA 2Q7GA 5KUKA 1AI7A 1N0JA 5CB4A 4MW8A 1AILA 1RPRA 3HKCB 4O4LA 3P30A 4G2KA 2XNDG 1K5SA 2XAFA 3JAMN 3SPHA 4X89A 1DLBA 3RYCA 4BIOA 1FXKA 5IY5C 3JASA 3J81N 2UUCO 2LFSA 3S3XA 5FNVA 4CS3A 5KUMA 2Q7EA 5KX5A 4UCRA 3VBBA 5KAFZ 2IBZH 1IZ3A 1JPXA 1PD3A 1D5NA 2YICA 3T1HO 4TOIA 1F7YA 2UUBO 5LMNO 5IT9N 3ASOB 1M93A 2ITCC 2A9HA 1VF6C 3DC6A 4LH6A 2ZE6A 5J2TB 3KG2A 4JZGA 5LP6A 3T1HB 2PUSA 1JVMA 4X65O 2ZNJA 2UUBB 1AJQA 1VQ8V 1NR7A 1DK1A 4QGPA 1RP3B 1SERA 3AG1C 4B7EA 3U0ZA 2KG7B 1CP9A 4YIOA 4I55B 4ZBMA 1YJWV 1FJGB 4LFAB 2WWWA 3ETQA 5DN6G 4FLUA 1WA8A 2AW9A 3SYPA 4X65B 2OCCC 4JV5B 1F4MA 4MSWC 5L3GA 1VQ5V 1Q3EA 5EYPB 3UCSC 5FPOA 3RYHB 4UUJC 4JAVA 5CA1A 1COWG 4LF8B 2GHYA 4UCSA 1K4CC 1KP3A 4X8AA 4G28B 3TETA 5J2UB 1SQFA 3G6BA 1S5JA 3BPZA 2WLJA 4BAYA 2XHBA 1N0NA 1OCZB 1DTOA 2Q7HA 3ZJZA 5B3SC 4X66B 1V54C 3DGEA 1YSCA 4RWUA 2PTMA 4LNUB 4UV8A 2BTOA 1XHXA 2RNBA 5JH7A 2DMXA 4Z1MG 2DYRC 5DM6V 4TQDA 1G6UA 2GUZA 1J95A 4PJ0Z 4PDVA 1K33A 2EULA 2XOKG 1QLEB 2YXHA 5AG2A 3PN1A 3ZX6A 1I0HA 1P7GA 2VS0A 1VQMV 1R3KC 3RW0A 5KHHA 3JSLA 4O4IA 1NBMG 5KA5A 4Q20A 2VWJA 4DUZB 3SPIA 3STLC 1IX9A 1KYOF 5JVDB 3ZHVA 2WLIA 2FYUH 3CSXA 3L74H 1M90W 3OR7C 4LBEC 1YEWA 4CH5A 2JS5A 2UU9O 1EZJA 3K5MA 3SJBC 3FFQA 3CCMV 4MT8A 4LF6O 2DE0X 2OTJV 4DR5B 3NXSA 2IW5A 5LGTA 1EM1A 4X62B 4I0XB 4JI2O 4N21A 1NVPD 2ZXWB 2XUMA 1EN6A 4GX1A 2MW2B 3ABLC 2QWNB 4FM0A 2QM4A 2HVJC 1UPGA 2LGWA 2YIDA 1NJIW 3HKCA 4JI2B 3FYEB 2EJ7A 3DC5A 1HNWO 3F5TA 4UVBA 1T5EA 4IHJB 2AZ0A 2NR5A 4TQFA 2GBOA 1W0JG 2ZM6O 4K8ZA 4FPPA 1RSOB 2QWQB 1GKFA 2QKAA 3F5WC 4DUYB 1K9MW 2XAQA 4IYHA 2KSDA 1XNQO 2BE3A 3BRCA 1FXVA 2ZM6B 3B8NA 3OEEG 5IYZB 4DO2A 3D36A 2YI9A 5TISZ 1Z2GA 1EZVH 5B1OA 3CCEV 3CRQA 5FPRA 4NXMO 1N4CA 3GWOA 4MVQA 4JI0B 1QCEA 4K35A 5J2TA 4DYLA 1XNQB 1QVGU 3U11A 4QIWF 4CH3A 1R1BA 4DV1O 1EFRG 3AG2B 4KL1A 3OT7A 4O2BB 2KG7A 5B1NA 5KHGA 1P84F 1O9GA 2ZCEA 4I55A 4LF5O 3MAQA 2GTSA 1IBMO 5LGNA 3H1LH 1NH2B 2AHYA 2CAZC 1UFIA 4I4TB 5EYPA 5LOVB 3RYHA 3QVNA 2P67A 2YIBD 3K3WA 4YJ2B 4ZKIA 1Y4MA 5E79Z 1SESA 2CGNA 4B3RO 1H2SB 1NTKH 4L8JA 1OV9A 4TUYA 1G8MA 4FFBB 3SPJA 4LNUA 3MHHC 3N2KB 4RQEA 4X64O 3UT5B 3SR2C 4LF9B 2CH7B 4IGGA 1XBLA 1N33B 4DV5O 2VQFB 4X64B 1S77D 3OD4A 2UXXA 1NS1A 3CCSV 1Q5OA 4AI8A 3UO2A 5A9GA 3LNMB 3T1YB 5JVDA 1ZTEA 4IIJB 1N32O 1AJPA 3CJHB 4LH7A 4DRXB 2WLMA 3ZHRA 2GSMB 3JD2A 1F4NA 1HP8A 1X59A 1RM1B 4DR4O 2A0LA 3ETEA 4FK5C 4DV2B 1AI6A 2UXBB 2P06A 1P4RA 2F93B 3ZRWB 4YXWG 1VP7A 3E83A 2E75B 2Q73A 4BWAA 2ZKOA 4I0XA 4JI7B 5IWAB 4MVZA 2MK3A 3E86A 3J80N 3FX7A 2A79B 2Y4TA 2N05A 2IJIA 1NI8A 1NVPB 3E2EA 2HVKC 2DYSC 2ZIMA 4JI8B 3RVZA 3A0RA 1N36O 1KKDA 4NYKA 2PGGA 1YTFD 2Q0AA 2IH1C 1TVKB 1Y67A 2YXYA 2EZPA 1NZ6A 2JGUA 3OMNB 4FFKA 1TGOA 3W7XA 2HHHO 4IHJA 5EBMC 2E76B 2NNUA 1P49A 5EIBC 3NR7A 3Q4HB 5BMVB 2UUAO 1JX9A 4EFBA 1XILA 2R9AA 2KQXA 1S3JA 4UVCA 3CRCA 2Q69A 1F23A 4WFHA 1M1KW 3K5NA 1OCCB 1RSOA 1U97A 4GYCB 3CCJV 4B3SB 4LR3A 4DV6B 3E8GA 1PL4A 1IBKB 3IGAC 4UCVA 2EILC 1HNXO 4D7SA 5IYZA 5JJNB 4UCUA 3ZMTA 1KB9F 2KKWA 1K4DC 1QHTA 5HFMA 1OCRC 3DTUB 4H13B 5FLXN 1XMOO 3D3IA 4UB6Z 1FFXB 3A8TA 4FLYA 5HFLA 5IDJA 5L3CA 1YF2A 4TV8B 3HR0A 3A0BZ 1J5EO 4GKKB 1FD9A 2ZNIA 3E89A 4O2BA 4R7CA 4MVMA 5B5EZ 5LL6Y 3N2GB 3P3PA 5IY5B 1XMOB 3BHPA 3QG5A 4X20B 4MTGA 2WLIB 3ZHSA 1ZAUA 4I4TA 5LOVA 4FLWA 4PI2A 5D5PA 5JQGB 2AZ2A 5KMGB 4LC1A 4TT3G 1K3EA 2XAGA 3RYIB 4TV9B 2R72A 3VQWA 1BGYH 4DK0A 4RO2A 3G71V 2GTAA 4GX5A 2DQ0A 3ZCCA 3QO5A 4FFBA 2Q5ZA 4BIUA 3N2KA 1VF5B 3G6EV 1VQNV 1H2KA 4J42A 3LNNA 4DV3O 1Q6UA 3LUTB 2ATKC 2YSUB 2CH7A 1GH6A 4DR2B 2H3OA 1K5QA 4DV4B 2ARHA 3JD1A 4JASA 2B1GA 1HWYA 2E5LO 1SQBH 3AG1B 5LHHA 1ZL8B 3BAAA 4DV3B 5IYDO 5LA6A 1BCCH 2JDIG 1B04A 2D3OW 5B1BC 2OCCB 1K97A 4IIJA 1OCOC 1V55C 3IJ4A 2UXCO 3CJHA 2ZDIA 1GN6A 4DRXA 1OZ0A 2AXTZ 2O57A 3D3QA 1R6NA 4DV7O 4CH6A 1XREA 3WG7C 1TA8A 3P3NA 3CD6V 1Q86W 4ZI7A 1US6A 1N34O 2HP8A 1H2LA 5B3SB 2UXCB 1V54B 3ZRWA 1DGSA 2BOBC 1NU1H 4I9WA 4J7JA 1FAFA 4GX0A 1MSDA 1SQXH 5L3FA 2DYRB 3K58A 2UUCB 1LUVA 3J7AU 1E1RG 2Y48A 5JJEB 1BE3H 4P30A 1Q7YW 1TAEA 1LNQA 2C2AA 1VQ6V 3SGIA 5FL7G 3PJSK 3B2EE 1PNKA 2PF4E 2QR4A 1IDSA 4IT5A 4DR3O 2NN4A 1FYJA 1TVKA 1CEZA 1F51A 5LMNB 2WLHA 3S3WA 3FD9A 3BEHA 1R3LC 3EXAA 1GK9A 1KU9A 1BT8A 1SZTA 3W7UA 3CX5F 3Q4HA 1YHQV 5BMVA 2D2CB 2X6CA 3L9DA 4DR3B 2P7TC 2OIEA 2F23A 3H1IH 4PI0A 4ZOLB 1HR0O 3CB2A 5BZBA 2CUGA 2ZD9A 3LSQA 1U96A 1SETA 2F43G 1L0LH 4WF9V 4DR6O 5EK0A 2WPDG 4TUYB 3D8CA 1HR0B 4MS2A 1Q43A 1S76D 2K9PA 2ADQB 4O4JB 3ABLB 4J80A 3ICXA 1VQ9V 2B1IA 2RMKB 5EBWC 3FB7C 1FFXA 3CYOA 2QWRB 3U10A 4F6EA 3L71H 1CXZB 1WB7A 4FLZA 1R6TA 4TV8A 3K9AA 2WSSG 2EIKC 1ROPA 5EIBD 2V1DA 1JJ2U 1XMQO 5LXTA 2WLNA 4BW9A 3CCQV 4QE9A 4N23A 4UV9A 3SYAA 4JI3O 1I7FA 3N2GA 3UKMA 1PP9H 1KMIZ 4X20A 2IJKA 3L75H 2GV9A 3JAKB 4O4HB 1GO3F 4E2LA 4X1KA 2BCCH 5JQGA 2JIZG 5KMGA 1JCHA 2DW4A 1L0NH 4DR7O 4IL6Z 4HNAB 3RYIA 3SJQC 4TV9A 2YIBA 4FVMA 4OX9O 3F7VC 1JR9A 4Z2WA 2EINB 1QLNA 4Z1VA 1KUQA 3ZMUA 3ZRXA 4NTXA 3FB6C 1SQPH 3ZRSA 1VF6A 4JI6O 3OW2U 4RUFA 3LDEA 4CBCA 2VQEO 1GRJA 3T2MA 2Y4UA 2UU9B 4X1IB 1QR8A 3CCVV 3FYIB 4BIZA 3WB2A 4LF6B 1M57B 1ZL8A 4R50A 1AI4A 1PV0A 4DW0A 1AR4A 2JVDA 4P2ZA 3OMIB 1EN5A 3STZC 4PA4A 2EIMC 4JAAA 4NKGB 1AROP 5EBLC 1XDCA 1MNGA 4D7TA 1FFTB 1P7BA 5CA0B 3MDSA 2PI5A 4PDRA 3ML0A 1YDXA 4NXNO 3OUFA 1L8DA 3H1HH 1HNWB 2ZR3A 1YJ9V 1W59A 5D5QA 1D2DA 1B6QA 3APOA 4F6RB 1O9HA 3JCUZ 3ETDA 3SYQA 1Y74B 1XQ8A 4KUMA 2YS8A 5DECA 2JRIA 4WFFA 5EC2C 4P9OA 1M9NA 5BR8O 2P5OA 2WAMA 2K1EA 2N74A 2YDEA 4EB6B 5KHKA 3LDCA 4KFMA 2LW1A 2R70A 4A5UB 2CGOA 5CMUA 1VQPV 1K34A 4RAIA 2LJ2A 1X4TA 5BR8B 4QPKA 3ABMC 4B7KA 5B1AC 2EIJC 4NXMB 5JCOC 1ZSPA 2Q6AA 3JYCA 4LF4O 3K03A 5L3EA 1VQLV 2AGAA 2HJDA 2HLDG 4ZOLA 2FMLA 3BABA 2M7WA 2A3QA 4DV1B 2ZQMA 3EHBB 1SA0B 4AQYO 1JQ0A 1YXBA 4LF5B 3CC2V 2JJ2G 2QM8A 2ILMA 1IBMB 4LF4B 4ZIBA 1WAZA 1EN4A 3TXQA 4F4LA 1YZBA 2WA4A 3JATB 3X2QB 1E1QG 5GTIZ 2P4VA 2QWPB 3B77A 3QF7A 2IU3A 4O4JA 5JJJB 1IXMA 1VEWA 4PDMA 3R65A 3OGIB 2DWEC 2OWOA 4JYCA 1LUWA 1NT2B 4L87A 4B3RB 4QNHB 1CPYA 3RBZA 3AG3C 1BHBA 1WP7A 2LQTA 2RQ6A 3K5LA 2R9RB 3THOA 2Q9LA 5H5NA 5LA6B 4PA9A 1TUBB 4JYAO 2H94A 3ZN1A 4ABMA 4E4EA 4DR1O 1V9PA 4DV5B 3JAKA 4BW5A 4EEQA 4PDLA 4O4HA 2QJ1A 4GKJO 3ZHTA 3RYFB 2B5UA 3K04A 2IU0A 4WFBV 4HNAA 4LCUC 3AG7A 1QBZA 2EILB 2Y69C 4ZI7B 1JMKC 3ABTA 3IC9A 3OFNG 1N32B 2RDCA 5C8YB 1MMMA 1SC5B 4DR4B
chains in the Genus database with same CATH topology
1K4CC 1OCRB 2CK3G 1KP3A 2DQ0A 2IJJA 4X8AA 4G28B 3ZCCA 3QO5A 3TETA 5LHIA 3K0DA 4BIUA 3AG3B 4XBFA 2WLJA 3G6EV 1VQNV 4BAYA 1YIJV 1OCZB 1DTOA 4MTXA 3ZJZA 5B3SC 5LGUA 3LUTB 1V54C 1H2GA 3DGEA 1YSCA 2ATKC 2YSUB 4UV8A 2EINC 2W6JG 1I5XA 4HZ3A 1K5QA 3T1CA 2LFRA 4Z1MG 3JD1A 1VQKV 1YITV 2DYRC 2OT5A 5DM6V 4JASA 2B1GA 1HWYA 3AG1B 1KC8W 4OXSA 2YEVB 1J95A 4PDVA 1E79G 1K33A 2OTLV 5LHHA 2XOKG 3I55V 1QLEB 5IYDO 3OEHG 3OE7G 4JTCB 2JDIG 1ENVA 3BY6A 2D3OW 5B1BC 1VQMV 3JD3A 1R3KC 1G4YB 2ZXWC 3RW0A 2Y69B 2OCCB 1K97A 2P90A 5H6RA 1OCOC 2BOCC 1V55C 1NBMG 4MVOA 2ZDIA 4Q20A 5KA5A 3SPIA 3STLC 5L3BA 1DF4A 2QA4V 1OZ0A 1M57C 2P6JA 3K0GA 1R6NA 2Z5UA 2WLIA 1UJWB 3JCZA 2QTOA 1N8RW 2WLLA 3WG7C 2UXNA 1M90W 3OR7C 3CD6V 1Q86W 4ASUG 4GX2A 4LBEC 3ZMSA 5B3SB 1S0VA 1V54B 3CCRV 3ZRWA 2DYSB 4J9YB 2AHZA 2Q67A 3TK1A 2BOBC 4MVRA 1FXHA 5J9PC 3MHSC 3ABKB 4I9WA 1R6KA 1EZJA 3CCMV 2HJFC 4GX0A 4MT8A 3CPWU 5L3FA 2OTJV 2DYRB 1RM1C 3NXSA 2X0LA 4P9PA 2IW5A 5LGTA 1FXKC 1H8EG 1L1FA 1E1RG 2Y48A 1Q7YW 4P30A 3F7YC 5LHGA 5CBGA 4WCEV 1LNQA 2C2AA 4N21A 4MVUA 1NVPD 2X6AA 3OM3B 1VQ6V 5B1BB 1W0KG 5FL7G 3PJSK 2ZXWB 1PNKA 5CN0A 1VQ7V 1Q81W 1OCOB 1K8AW 3AG4C 4GX1A 3ABLC 1CEZA 1F51A 2HVJC 2WLHA 4JGSA 3BEHA 1R3LC 1GK9A 3IFXA 4QPJA 1NJIW 1THZA 3WG7B 3FYEB 1EBOA 1SZTA 3W7UA 3QO8A 1S5HC 1R73A 1YHQV 3FKSG 2X6CA 3LSSA 4UVBA 3OAAG 2P7TC 4HYOA 5CA3A 1OHHG 2XASA 2R9IA 4FJCC 3K79A 2X7RB 3K06A 3AG2C 3LDDA 1W0JG 2H8PC 4PA6A 2IJHA 1FS0G 4FPPA 1QVFU 5BZBA 4EKWA 1BL8A 3HB3B 2ZD9A 5E1AC 3LSQA 5C93A 1FXKB 1WLEA 2X6BA 1SETA 1GKFA 2F43G 3F5WC 1K9MW 4WF9V 3HPLC 3CCUV 2XAQA 3OUSA 3W7SA 5EK0A 2WPDG 4U7NA 1RPOA 2DQ3A 4MS2A 2XAHA 4H33A 1S76D 3AG4B 1FXVA 3E8BA 3B8NA 3OEEG 3ABLB 1QR9A 4DO2A 1PNLA 3D36A 1NR1A 4FMTA 4GT1A 5B1OA 3E8FA 3CCEV 1VQOV 1MABG 2B1IA 2EBOA 5EBWC 3VOUA 3FB7C 1GM7A 3CMAV 1VQ9V 1BHAA 3CYOA 3GWOA 1AR1B 3TCUA 2HFEC 4MVQA 3X2QC 1QCEA 3K9AA 2DWDC 4JPRA 2WSSG 3P32A 4XDLA 4JTDB 4JF3A 2EIKC 1ROPA 1R3JC 2V1DA 4RQFA 3T4DA 3ABUA 1QVGU 1JJ2U 4QIWF 3RVYA 2WLNA 3ETGA 3CCLV 3B8MA 3CCQV 4QE9A 4N23A 4UV9A 1EFRG 3ASNC 3AG2B 3SYAA 3JD4A 3FB5C 3UKMA 3CP1A 5B1NA 1AI5A 1ZWIC 2IJKA 4G27B 4XDJA 4X88A 1GO3F 1PNMA 4E2LA 5LGNA 2JIZG 2ZR2A 1NH2B 1JCHA 2AHYA 3EFFK 2DW4A 3OR6C 4R8CA 3SJQC 3F7VC 4PA7A 2EINB 5IYCO 1QLNA 2P67A 3K3WA 1M56C 2ZDIC 4ZKIA 1Y4MA 1K73W 1ORQC 3ZMUA 3ZRXA 5CBHA 1SESA 4CZZA 2QEXV 3FB6C 3SYCA 2V7QG 3ZRSA 3OW2U 4PA3A 4RUFA 3LDEA 4CBCA 1G8MA 3T2MA 1MSWD 5L3DA 4UXNA 3SPJA 1KP2A 3MHHC 4HAMA 2QKSA 4RQEA 2EIKB 1YI2V 1H8HG 1PKXA 4TWKA 1QR8A 3CCVV 3FYIB 4BIZA 2IH3C 1V55B 4UVAA 2HG5C 3ASNB 1M57B 3JD0A 1YTFB 2YEVA 2HKOA 4I5SA 4R50A 1AI4A 3FB8C 1PL0A 3QNEA 4MTFA 1Q82W 5EC1C 3H01A 3W7WA 2Q68A 1S77D 4TSFG 3CC4V 4P2ZA 3OMIB 2UXXA 3ZRVA 4QE7A 3CCSV 1TUEB 2QE7G 4U7OA 3SYOA 3LNMB 3E35A 3SPCA 2W0FC 3GB7C 3STZC 2EIMC 4PA4A 2W6IG 1AROP 1AJPA 2JEXA 5EBLC 1M56B 1DF5A 5IYBO 2WLMA 1FFTB 3K08A 2GSMB 1P7BA 3JD2A 5LBQA 4WFEA 2PI5A 2ITDC 4PDRA 3ML0A 2JEUA 1F4NA 1RM1B 5H9CA 3OUFA 2LP7A 2EJRA 2A0LA 2ZR3A 3ETEA 3AEIA 1YJ9V 4FK5C 1NH2D 2QM7A 4JYBA 2WLLB 3CXCU 4JTAB 1AI6A 1B6QA 4JAUA 1P4RA 3ZRWB 4DXWA 3ETDA 3E8HA 4YXWG 1I5YA 3SYQA 3OMAB 4KUMA 3E83A 4WFFA 5EC2C 1OCCC 3I56V 4P9OA 4WFAV 3ZMVA 1M9NA 3UM7A 2WAMA 3SPGA 4MVZA 2MK3A 5CBFA 2K1EA 3E86A 2A79B 1GM9A 2IJIA 1BMFG 1YJNV 1NKDA 4WFGA 2WLKA 3CMEV 1NVPB 3E2EA 2HVKC 3LDCA 2HR3A 4KFMA 2DYSC 3G4SV 1VQ4V 4GCZA 1MG1A 3RVZA 1JOYA 3ABKC 5CMUA 3A0RA 2XAJA 1K34A 3ZMZA 2JK5C 4RAIA 1VQPV 2NLJC 2EIMB 1KKDA 1YTFD 4FIPC 4QPKA 3ABMC 2IH1C 5B1AC 1GTOA 2EIJC 1S72V 1MOFA 3M99B 2EZPA 3ASOC 5GW7A 1WPXA 1KD1W 1Y66A 5KUKA 2KB1A 2Q6AA 1AI7A 3JYCA 2Z3YA 1XL6A 4MW8A 3K03A 3OMNB 1GM8A 3W7XA 5L3EA 1RPRA 5EBMC 2NNUA 3P30A 3OGCC 1VQLV 4G2KA 1JX9A 2XNDG 1K5SA 2XAFA 2HLDG 2M7WA 2EZOA 4H37A 5KA6A 2ZQMA 3EHBB 1S3JA 4UVCA 3SPHA 2Q69A 4X89A 1DLBA 1F23A 4WFHA 1M1KW 1JQ0A 1W2BU 1OCCB 1R3IC 3CC2V 3CC7V 1FXKA 2JJ2G 2QM8A 5IY5C 3CCJV 4QJFB 3ZN0A 3E8GA 3ZIAG 4F4LA 2LFSA 5KUMA 3X2QB 1E1QG 1SRYA 3IGAC 3W7TA 3VBBA 4MVSA 2EILC 3B77A 1JPXA 2IU3A 1IXMA 1PD3A 4PDMA 3R65A 2DWEC 3ZMTA 3MD0A 4PELA 4JYCA 1K4DC 1H38A 1AJNA 3ABMB 5HFMA 4L87A 4MW3A 5B1AB 2EIJB 1OCRC 3DTUB 3ASOB 4QNHB 1CPYA 3RBZA 2ITCC 3T4ZA 2A9HA 3AG3C 3D3IA 4MTOA 1KQSU 1BHBA 1OCZC 1KECA 5HFLA 5IDJA 5L3CA 2R9RB 4KP4A 4R6ZA 3IC7A 3KG2A 1XL4A 4PA9A 1JVMA 3E89A 2H94A 3ZN1A 4R7CA 1K7DA 1AJQA 1VQ8V 1NR7A 4BW5A 4LP8A 4MVMA 1SERA 4PDLA 1K92A 3AG1C 3WFVA 5IY5B 5H6QA 1NQTA 1CP9A 4MTGA 1QLEC 2B5UA 3K04A 2IU0A 2WLIB 4ZBMA 1GMGA 1YJWV 4WFBV 4LCUC 2WWWA 4J9ZB 5DN6G 1QBZA 3SYPA 2EILB 2Y69C 4LC1A 2OCCC 4RUEA 1F4MA 4MSWC 4TT3G 5L3GA 3ABTA 1K3EA 3OFNG 2XAGA 3QO7A 2JJ1G 1VQ5V 4UUJC 2PI4A 4JAVA 4RO2A 4XDKA 3G71V 1COWG 2GHYA 4GX5A 2FTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4C C;  3ASO C;  3FB6 C;  3SYC A;  4X8A A;  3IFX A;  4G28 B;  3TET A;  5KUK A;  2KB1 A;  3K0D A;  3ZRS A;  2Q6A A;  3JYC A;  1XL6 A;  4MW8 A;  2WLJ A;  4PA3 A;  3K03 A;  3LDE A;  1S5H C;  4RUF A;  4CBC A;  5EBM C;  3T2M A;  3SPJ A;  3ZJZ A;  2X6C A;  5B3S C;  3OGC C;  3LUT B;  1V54 C;  2QKS A;  2P7T C;  2ATK C;  4HYO A;  4TWK A;  4H37 A;  2EIN C;  2IH3 C;  3K06 A;  3SPH A;  3AG2 C;  2Q69 A;  4HZ3 A;  2HG5 C;  4X89 A;  3LDD A;  4WFH A;  3T1C A;  2H8P C;  4PA6 A;  2YEV A;  2DYR C;  1R3I C;  5BZB A;  4R50 A;  4EKW A;  5IY5 C;  1BL8 A;  4OXS A;  1J95 A;  3FB8 C;  4PDV A;  2ZD9 A;  4MTF A;  3E8G A;  5EC1 C;  5E1A C;  4F4L A;  2X6B A;  5KUM A;  2Q68 A;  3IGA C;  3F5W C;  4JTC B;  3HPL C;  4MVS A;  4P2Z A;  5B1B C;  3OUS A;  1R3K C;  2EIL C;  4QE7 A;  1G4Y B;  2ZXW C;  5EK0 A;  3RW0 A;  4PDM A;  1OCO C;  2BOC C;  1V55 C;  3LNM B;  3R65 A;  4H33 A;  4MS2 A;  4MVO A;  3SYO A;  3SPC A;  2W0F C;  3GB7 C;  3SPI A;  3STL C;  2EIM C;  4PA4 A;  3STZ C;  1M57 C;  2DWE C;  3E8B A;  5EBL C;  1K4D C;  2WLM A;  3K0G A;  3K08 A;  4MW3 A;  1P7B A;  3E8F A;  1OCR C;  5EBW C;  3VOU A;  4WFE A;  2ITD C;  2WLI A;  3FB7 C;  4PDR A;  4QNH B;  2QTO A;  3OUF A;  2WLL A;  2A0L A;  2ITC C;  3RBZ A;  3T4Z A;  3WG7 C;  2A9H A;  3AG3 C;  3TCU A;  2HFE C;  4MVQ A;  3X2Q C;  3OR7 C;  4GX2 A;  4LBE C;  4MTO A;  1OCZ C;  2WLL B;  2DWD C;  4JTA B;  4XDL A;  4JTD B;  2EIK C;  2R9R B;  1R3J C;  4J9Y B;  4R6Z A;  2AHZ A;  2Q67 A;  1XL4 A;  3KG2 A;  2BOB C;  4PA9 A;  4MVR A;  3T4D A;  1JVM A;  2WLN A;  3E89 A;  3RVY A;  5J9P C;  4I9W A;  4DXW A;  3E8H A;  4QE9 A;  4R7C A;  3SYQ A;  3ASN C;  3SYA A;  3E83 A;  3FB5 C;  3UKM A;  2HJF C;  4GX0 A;  4BW5 A;  4WFF A;  4LP8 A;  1OCC C;  4MVM A;  5EC2 C;  4P9O A;  1ZWI C;  4PDL A;  3AG1 C;  4G27 B;  4XDJ A;  4P9P A;  3UM7 A;  3SPG A;  4MVZ A;  5CBF A;  2K1E A;  3E86 A;  4X88 A;  2A79 B;  4MTG A;  1QLE C;  4P30 A;  3K04 A;  2WLI B;  3F7Y C;  4ZBM A;  5CBG A;  2AHY A;  4LCU C;  1LNQ A;  2WLK A;  4J9Z B;  4WFG A;  4GX5 A;  3EFF K;  3OR6 C;  2HVK C;  4MVU A;  2X6A A;  3LDC A;  4R8C A;  4KFM A;  3SYP A;  2DYS C;  2Y69 C;  3PJS K;  4RUE A;  2OCC C;  3SJQ C;  4MSW C;  3RVZ A;  3ABK C;  3F7V C;  4PA7 A;  3AG4 C;  4GX1 A;  2JK5 C;  4RAI A;  2NLJ C;  3ABL C;  1KKD A;  4UUJ C;  1M56 C;  2HVJ C;  2WLH A;  4RO2 A;  3ABM C;  4XDK A;  2IH1 C;  1ORQ C;  3BEH A;  2EIJ C;  5B1A C;  5CBH A;  1R3L C; 
#chains in the Genus database with same CATH topology
 1OCR B;  2CK3 G;  1AP5 A;  3HKE B;  4UFZ A;  4J11 A;  1YIJ V;  4MTX A;  5GON A;  4KHP O;  4X1I A;  4FLX A;  1H2G A;  2JGD B;  4K0K O;  3UQ8 A;  1I5X A;  5KAI Z;  1GN2 A;  2LFR A;  4B08 A;  1VQK V;  2OT5 A;  3GWK C;  2IM9 A;  3BA9 A;  4DV0 O;  4OXS A;  2YEV B;  1E79 G;  4KHP B;  3I55 V;  3K9S A;  5IJ0 B;  1AR5 A;  3OE7 G;  4JTC B;  1ENV A;  5A2Q N;  3L70 H;  3JD3 A;  1G4Y B;  4GUN A;  5H6R A;  1N36 B;  4MVO A;  3B09 A;  2ETN A;  2CTW A;  5CA0 A;  3RWR D;  3UO3 A;  4D6T H;  3K0G A;  2QTS A;  3KCX A;  2Y0P A;  1GN3 A;  1N8R W;  4FLV A;  3VQY A;  4LF7 O;  2HHH B;  2UXN A;  4UCT A;  3DSQ A;  4ASU G;  3TGU H;  3ZMS A;  1XOU A;  4F6R A;  2UUA B;  1HNZ O;  3OTO O;  1S0V A;  4J9Y B;  2AHZ A;  1Y74 A;  1VF7 A;  4MVR A;  1AB3 A;  5J9P C;  3MHS C;  3ABK B;  1R6K A;  2RCV A;  4PD4 F;  3CPW U;  1RM1 C;  1Q6H A;  2Q8V A;  2X0L A;  4J7K A;  4EB6 A;  3CRM A;  2VRZ A;  1FXK C;  1H8E G;  1L1F A;  1GAX A;  1HNX B;  3OTF A;  4MVU A;  2X6A A;  5B1B B;  4ZHQ B;  1OCO B;  1K8A W;  3AG4 C;  3I5D A;  4HBN A;  4LFC O;  5LXT B;  3DXR B;  3WB0 A;  3IFX A;  4QPJ A;  3WG7 B;  1EBO A;  1WP8 A;  2F95 B;  1S5H C;  1B06 A;  3L73 H;  3RT3 C;  4UCO A;  1J5E B;  1NTZ H;  4X1K B;  2P4K A;  5CA3 A;  1SA0 A;  1OHH G;  2CTQ A;  2XAS A;  2A06 H;  4FJC C;  3K79 A;  4YIP A;  2X7R B;  5LP6 C;  4J7Z A;  3ZED A;  2H8P C;  4PA6 A;  1FS0 G;  1VMG A;  1QVF U;  1BL8 A;  3JAT A;  3HB3 B;  3BFR A;  5C93 A;  4JYY A;  1WLE A;  2BTQ A;  2X6B A;  5BXZ A;  2YC0 A;  3APQ A;  4U7N A;  4JI1 O;  2DQ3 A;  2ZIN A;  4WBN B;  4YHH O;  2XAH A;  1WPB A;  1NR1 A;  4FMT A;  4GT1 A;  3E8F A;  1IXB A;  1VQO V;  1MAB G;  1BHA A;  2OIG A;  1GM7 A;  3CMA V;  1M4U A;  1A32 A;  2DWD C;  4XDL A;  1Q90 D;  1TUB A;  4JTD B;  4JF3 A;  1R3J C;  4RQF A;  3ABU A;  1OJH A;  5KHI A;  3B8M A;  4C7U A;  3ASN C;  3FB5 C;  4B3M O;  2E5L B;  1AI5 A;  3TXS A;  3A2F A;  1ZWI C;  4G27 B;  4XDJ A;  3RYF A;  5F2V O;  4X88 A;  3HKD B;  2ZR2 A;  4GLX A;  5EZY B;  2Z0A A;  3EFF K;  2YUA A;  1HW7 A;  5C8Y A;  4PA7 A;  4B3M B;  1WB8 A;  1M56 C;  3HKE A;  1ORQ C;  4DV7 B;  5CBH A;  2WA3 A;  3SJC C;  4CZZ A;  3HKB B;  3SYC A;  2V7Q G;  4FZ1 A;  3SJA C;  1N34 B;  3LSU A;  2JGD A;  1IUR A;  4UXN A;  1KP2 A;  2QKS A;  2EIK B;  1H8H G;  3C3T A;  1BQ0 A;  3RN4 A;  2IH3 C;  4W4K A;  5LMU O;  2F4V O;  3JD0 A;  1QNM A;  3WU2 Z;  2YEV A;  1YTF B;  2HKO A;  1Q8I A;  1HDJ A;  4I5S A;  2DJV A;  4JI5 O;  1B3Q A;  5IJ0 A;  4OPA A;  1I94 O;  3QNE A;  4MTF A;  5EC1 C;  3H01 A;  1SQQ H;  2Q68 A;  2V4D A;  3CC4 V;  1FJG O;  4LFA O;  3ZRV A;  4DK1 A;  4QE7 A;  1Y76 A;  1TUE B;  2QE7 G;  4U7O A;  4CC5 A;  5LMU B;  2F4V B;  3AK1 A;  4JV5 O;  3SPC A;  1SKV A;  2JEX A;  4JI5 B;  1DF5 A;  5BY1 A;  1I94 B;  5LBQ A;  2W0X A;  4LF8 O;  3B40 A;  2LP7 A;  2EJR A;  3JAW B;  4LFB O;  3AEI A;  1NH2 D;  2QM7 A;  2B9Z A;  2WLL B;  2YIA A;  3G67 A;  4X66 O;  4JAU A;  1SS3 A;  3E8H A;  3ZBH A;  1I5Y A;  4I7Z B;  3OMA B;  4CC6 A;  4WFA V;  4LFB B;  4AIL C;  3UM7 A;  4CS4 A;  5CBF A;  3BA8 A;  1BMF G;  4ZHQ A;  1NKD A;  4DR6 B;  4WFG A;  3CME V;  3ZHU A;  4B3T O;  2Y0I A;  3G4S V;  1VQ4 V;  1MG1 A;  1SQV H;  5KHJ A;  1IVS A;  2ZE5 A;  3ZMZ A;  2EIM B;  4W4L A;  3DXR A;  4DUZ O;  4FIP C;  1S72 V;  1GTO A;  2QWO B;  1XUQ A;  1MOF A;  3M99 B;  3D36 C;  3ASO C;  4JZ2 A;  5GW7 A;  1WPX A;  2KB1 A;  2Z3Y A;  4I50 B;  1XL6 A;  4BR6 A;  3A0H Z;  1GM8 A;  4B3T B;  5ITZ B;  1WN7 A;  4U3F H;  3VQX A;  3OGC C;  4X9Q A;  1XMQ B;  3K5O A;  2F1M A;  2Q4P A;  5KA6 A;  2EZO A;  4H37 A;  4JI3 B;  4PHZ A;  4K8X A;  1XHZ A;  3H9V A;  1W2B U;  1R3I C;  3CHX A;  3AK3 A;  3CC7 V;  4NTW A;  2M6Y A;  2QSA A;  5H2F Z;  4QJF B;  4DR5 O;  3ZN0 A;  3ZHQ A;  3ZIA G;  3CEI A;  4GZR B;  4X62 O;  1SRY A;  3W7T A;  4DR7 B;  4MVS A;  4WBN A;  3N27 A;  4OX9 B;  1JA8 A;  4YY3 O;  2ZIO A;  5GON B;  1KKC A;  3MD0 A;  4PEL A;  1H38 A;  1AJN A;  2CE4 A;  3ABM B;  4MW3 A;  5B1A B;  2EIJ B;  4JI6 B;  5JWP A;  3FAV B;  2EX3 A;  2VQE B;  3T4Z A;  4H0L B;  2BSK B;  2CDY A;  4MTO A;  1KQS U;  1OCZ C;  4YY3 B;  1KEC A;  2G38 A;  4KP4 A;  4R6Z A;  3IC7 A;  1XL4 A;  2LO1 A;  3KKY A;  1K7D A;  1QQC A;  3JAL B;  3CRA A;  4LP8 A;  3HKD A;  1K92 A;  3WFV A;  1RFY A;  4OGQ B;  5EZY A;  5H6Q A;  1NQT A;  3RGB A;  3E22 B;  1QLE C;  1GMG A;  2CTP A;  4J41 A;  4J9Z B;  5IE9 A;  3K57 A;  4DUY O;  4RUE A;  3O65 A;  4IYI A;  4FLT A;  4JI4 O;  3KZI Z;  3QO7 A;  2JJ1 G;  1ZUQ A;  3AK2 A;  3HKB A;  4UB8 Z;  2PI4 A;  4XDK A;  4NR1 A;  4NXN B;  2FTK A;  2IJJ A;  1XI1 A;  5LHI A;  3K0D A;  3AG3 B;  4XBF A;  3BVO A;  2UXD O;  1ZLZ A;  1M5I A;  3EVK A;  4JI0 O;  5LGU A;  4JI4 B;  1URF A;  2GDS A;  2EIN C;  1PM9 A;  2W6J G;  4LWS B;  4HZ3 A;  2PZS A;  2OYQ A;  3T1C A;  1YIT V;  1KC8 W;  2UXD B;  1JFF B;  2OTL V;  5K1P A;  3OEH G;  3BY6 A;  4PV1 B;  4YJ3 B;  4H44 B;  2ZXW C;  4ICG A;  2Y69 B;  2P90 A;  2BOC C;  3K59 A;  2QGN A;  1Q6I A;  5L3B A;  2QA4 V;  1DF4 A;  1M57 C;  1FKA O;  2P6J A;  1SZX A;  2Z5U A;  2E74 B;  3JAW A;  3O9O A;  4Q6G A;  1UJW B;  4K3A A;  3JCZ A;  2QTO A;  2WLL A;  3C90 A;  4EFE A;  4GX2 A;  4O2A B;  3M8A A;  2BTQ B;  3CCR V;  1KBH A;  5IJ9 B;  2DYS B;  2Q67 A;  3TK1 A;  2PY5 A;  1FXH A;  3H1J H;  4LF9 O;  4AQY B;  1BQZ A;  1SF9 A;  2LGQ A;  3KCY A;  3B4S A;  1YVW A;  5J2U A;  2HJF C;  2JS3 A;  1VIB A;  1N33 O;  4P9P A;  3F7Y C;  5LHG A;  5CBG A;  4WCE V;  3RFR A;  3TJT A;  2VQF O;  3OM3 B;  1W0K G;  4X1Y B;  1GN4 A;  5CN0 A;  5LYJ B;  5GTH Z;  3CWB H;  4NVP A;  1VQ7 V;  1Q81 W;  4J10 A;  1BSM A;  2E3C A;  4CH4 A;  2ZT9 B;  4FZ0 A;  3T1Y O;  2PYJ A;  3M7M X;  4U3J B;  4JGS A;  1AP6 A;  2L35 A;  4I50 A;  3C3S A;  1THZ A;  5ITZ A;  3JAR B;  4NB5 A;  3QO8 A;  1R73 A;  3FKS G;  5CB4 B;  3LSS A;  4DV2 O;  3WB1 A;  3OAA G;  4JYA B;  3BCC H;  4HYO A;  2UXB O;  4O4L B;  2R9I A;  2DOS A;  3K06 A;  4DR1 B;  3AG2 C;  1XNR O;  3LDD A;  2IJH A;  2LW7 A;  4GKJ B;  2HEP A;  4EKW A;  3RYC B;  2FB5 A;  5E1A C;  4JI7 O;  1FXK B;  5IWA O;  1AVM A;  3JAS B;  1D5A A;  1IBL O;  3HPL C;  3CCU V;  5FNV B;  3OUS A;  2F66 C;  3W7S A;  1LR1 A;  1RPO A;  5KX5 B;  1XNR B;  4H33 A;  3AG4 B;  4JI8 O;  3E8B A;  1QR9 A;  1PNL A;  3FAV A;  5JCO A;  2ADP A;  3VOU A;  2EBO A;  2XT9 A;  2BSK A;  3ZS8 C;  1AR1 B;  1IBL B;  2RN9 A;  3TCU A;  2HFE C;  3X2Q C;  4KXR A;  4JPR A;  3P32 A;  2ODM A;  4K0K B;  2VWK A;  3T4D A;  4AHC A;  3QTC A;  1XEQ A;  3JAL A;  3RVY A;  3ETG A;  3CCL V;  2YI8 A;  1Y76 B;  5LP6 B;  3JD4 A;  3CP1 A;  4DV0 B;  3E22 A;  1NTM H;  5DED A;  4I9Q A;  4B3S O;  1PNM A;  4DV6 O;  2CTR A;  4NTY A;  4CS2 A;  2XTA A;  1IBK O;  3OR6 C;  1MZF A;  4R8C A;  1S5L Z;  4DW1 A;  1WA8 B;  4FM2 A;  5IYC O;  2QDO A;  1MZE A;  3H1K H;  2ZDI C;  1Y6X A;  3L72 H;  1K73 W;  2QEX V;  1SQG A;  4LF7 B;  5CA1 B;  3VQV A;  1WNS A;  3CE2 A;  4PA3 A;  3CXH F;  1Z5V A;  1HNZ B;  3OTO B;  3G80 A;  1JJO A;  2Q0O C;  1MSW D;  3R66 A;  5L3D A;  3SDL A;  1H2M A;  4HAM A;  4LWS A;  1YI2 V;  1PKX A;  4TWK A;  1H2N A;  1MA1 A;  4GKK O;  1V55 B;  4UVA A;  2HG5 C;  3GVM A;  3ASN B;  1I08 A;  1WJZ A;  1JFF A;  2YXL A;  1QU7 A;  5JH7 B;  3FB8 C;  1PL0 A;  2OCH A;  2RJZ A;  1Q82 W;  2GUZ B;  4YJ3 A;  3W7W A;  1G1X B;  4TSF G;  1BZK A;  3JSN A;  3SYO A;  3E35 A;  2W0F C;  3GB7 C;  1VAR A;  4LFC B;  2FL4 A;  2W6I G;  4O4I B;  1M56 B;  5IYB O;  2PYL A;  3K08 A;  4WFE A;  2ITD C;  2JEU A;  5H9C A;  1BS3 A;  4O2A A;  3CS5 A;  1YCI A;  4JYB A;  3CXC U;  5IJ9 A;  4JTA B;  3CRR A;  2ZE8 A;  2FKX A;  4YJ2 A;  2QKC A;  4DXW A;  4DR2 O;  5K1X A;  1Z5W A;  2L6L A;  1ZX3 A;  2DN9 A;  4DV4 O;  4OPH A;  1OCC C;  3I56 V;  4FM1 A;  3ZMV A;  3SPG A;  1GM9 A;  1YJN V;  3UT5 A;  4X1Y A;  5LYJ A;  5B66 Z;  2WLK A;  4JI1 B;  2HR3 A;  2A7W A;  4YHH B;  2ZE7 A;  1JOY A;  4GCZ A;  3ABK C;  1PPJ H;  2XAJ A;  2N04 A;  2JK5 C;  2P22 C;  4U3J A;  2NLJ C;  3IAY A;  5KLV H;  3JAR A;  1KD1 W;  1Y66 A;  1FPO A;  2Q7G A;  5KUK A;  1AI7 A;  1N0J A;  5CB4 A;  4MW8 A;  1AIL A;  1RPR A;  3HKC B;  4O4L A;  3P30 A;  4G2K A;  2XND G;  1K5S A;  2XAF A;  3JAM N;  3SPH A;  4X89 A;  1DLB A;  3RYC A;  4BIO A;  1FXK A;  5IY5 C;  3JAS A;  3J81 N;  2UUC O;  2LFS A;  3S3X A;  5FNV A;  4CS3 A;  5KUM A;  2Q7E A;  5KX5 A;  4UCR A;  3VBB A;  5KAF Z;  2IBZ H;  1IZ3 A;  1JPX A;  1PD3 A;  1D5N A;  2YIC A;  3T1H O;  4TOI A;  1F7Y A;  2UUB O;  5LMN O;  5IT9 N;  3ASO B;  1M93 A;  2ITC C;  2A9H A;  1VF6 C;  3DC6 A;  4LH6 A;  2ZE6 A;  5J2T B;  3KG2 A;  4JZG A;  5LP6 A;  3T1H B;  2PUS A;  1JVM A;  4X65 O;  2ZNJ A;  2UUB B;  1AJQ A;  1VQ8 V;  1NR7 A;  1DK1 A;  4QGP A;  1RP3 B;  1SER A;  3AG1 C;  4B7E A;  3U0Z A;  2KG7 B;  1CP9 A;  4YIO A;  4I55 B;  4ZBM A;  1YJW V;  1FJG B;  4LFA B;  2WWW A;  3ETQ A;  5DN6 G;  4FLU A;  1WA8 A;  2AW9 A;  3SYP A;  4X65 B;  2OCC C;  4JV5 B;  1F4M A;  4MSW C;  5L3G A;  1VQ5 V;  1Q3E A;  5EYP B;  3UCS C;  5FPO A;  3RYH B;  4UUJ C;  4JAV A;  5CA1 A;  1COW G;  4LF8 B;  2GHY A;  4UCS A;  1K4C C;  1KP3 A;  4X8A A;  4G28 B;  3TET A;  5J2U B;  1SQF A;  3G6B A;  1S5J A;  3BPZ A;  2WLJ A;  4BAY A;  2XHB A;  1N0N A;  1OCZ B;  1DTO A;  2Q7H A;  3ZJZ A;  5B3S C;  4X66 B;  1V54 C;  3DGE A;  1YSC A;  4RWU A;  2PTM A;  4LNU B;  4UV8 A;  2BTO A;  1XHX A;  2RNB A;  5JH7 A;  2DMX A;  4Z1M G;  2DYR C;  5DM6 V;  4TQD A;  1G6U A;  2GUZ A;  1J95 A;  4PJ0 Z;  4PDV A;  1K33 A;  2EUL A;  2XOK G;  1QLE B;  2YXH A;  5AG2 A;  3PN1 A;  3ZX6 A;  1I0H A;  1P7G A;  2VS0 A;  1VQM V;  1R3K C;  3RW0 A;  5KHH A;  3JSL A;  4O4I A;  1NBM G;  5KA5 A;  4Q20 A;  2VWJ A;  4DUZ B;  3SPI A;  3STL C;  1IX9 A;  1KYO F;  5JVD B;  3ZHV A;  2WLI A;  2FYU H;  3CSX A;  3L74 H;  1M90 W;  3OR7 C;  4LBE C;  1YEW A;  4CH5 A;  2JS5 A;  2UU9 O;  1EZJ A;  3K5M A;  3SJB C;  3FFQ A;  3CCM V;  4MT8 A;  4LF6 O;  2DE0 X;  2OTJ V;  4DR5 B;  3NXS A;  2IW5 A;  5LGT A;  1EM1 A;  4X62 B;  4I0X B;  4JI2 O;  4N21 A;  1NVP D;  2ZXW B;  2XUM A;  1EN6 A;  4GX1 A;  2MW2 B;  3ABL C;  2QWN B;  4FM0 A;  2QM4 A;  2HVJ C;  1UPG A;  2LGW A;  2YID A;  1NJI W;  3HKC A;  4JI2 B;  3FYE B;  2EJ7 A;  3DC5 A;  1HNW O;  3F5T A;  4UVB A;  1T5E A;  4IHJ B;  2AZ0 A;  2NR5 A;  4TQF A;  2GBO A;  1W0J G;  2ZM6 O;  4K8Z A;  4FPP A;  1RSO B;  2QWQ B;  1GKF A;  2QKA A;  3F5W C;  4DUY B;  1K9M W;  2XAQ A;  4IYH A;  2KSD A;  1XNQ O;  2BE3 A;  3BRC A;  1FXV A;  2ZM6 B;  3B8N A;  3OEE G;  5IYZ B;  4DO2 A;  3D36 A;  2YI9 A;  5TIS Z;  1Z2G A;  1EZV H;  5B1O A;  3CCE V;  3CRQ A;  5FPR A;  4NXM O;  1N4C A;  3GWO A;  4MVQ A;  4JI0 B;  1QCE A;  4K35 A;  5J2T A;  4DYL A;  1XNQ B;  1QVG U;  3U11 A;  4QIW F;  4CH3 A;  1R1B A;  4DV1 O;  1EFR G;  3AG2 B;  4KL1 A;  3OT7 A;  4O2B B;  2KG7 A;  5B1N A;  5KHG A;  1P84 F;  1O9G A;  2ZCE A;  4I55 A;  4LF5 O;  3MAQ A;  2GTS A;  1IBM O;  5LGN A;  3H1L H;  1NH2 B;  2AHY A;  2CAZ C;  1UFI A;  4I4T B;  5EYP A;  5LOV B;  3RYH A;  3QVN A;  2P67 A;  2YIB D;  3K3W A;  4YJ2 B;  4ZKI A;  1Y4M A;  5E79 Z;  1SES A;  2CGN A;  4B3R O;  1H2S B;  1NTK H;  4L8J A;  1OV9 A;  4TUY A;  1G8M A;  4FFB B;  3SPJ A;  4LNU A;  3MHH C;  3N2K B;  4RQE A;  4X64 O;  3UT5 B;  3SR2 C;  4LF9 B;  2CH7 B;  4IGG A;  1XBL A;  1N33 B;  4DV5 O;  2VQF B;  4X64 B;  1S77 D;  3OD4 A;  2UXX A;  1NS1 A;  3CCS V;  1Q5O A;  4AI8 A;  3UO2 A;  5A9G A;  3LNM B;  3T1Y B;  5JVD A;  1ZTE A;  4IIJ B;  1N32 O;  1AJP A;  3CJH B;  4LH7 A;  4DRX B;  2WLM A;  3ZHR A;  2GSM B;  3JD2 A;  1F4N A;  1HP8 A;  1X59 A;  1RM1 B;  4DR4 O;  2A0L A;  3ETE A;  4FK5 C;  4DV2 B;  1AI6 A;  2UXB B;  2P06 A;  1P4R A;  2F93 B;  3ZRW B;  4YXW G;  1VP7 A;  3E83 A;  2E75 B;  2Q73 A;  4BWA A;  2ZKO A;  4I0X A;  4JI7 B;  5IWA B;  4MVZ A;  2MK3 A;  3E86 A;  3J80 N;  3FX7 A;  2A79 B;  2Y4T A;  2N05 A;  2IJI A;  1NI8 A;  1NVP B;  3E2E A;  2HVK C;  2DYS C;  2ZIM A;  4JI8 B;  3RVZ A;  3A0R A;  1N36 O;  1KKD A;  4NYK A;  2PGG A;  1YTF D;  2Q0A A;  2IH1 C;  1TVK B;  1Y67 A;  2YXY A;  2EZP A;  1NZ6 A;  2JGU A;  3OMN B;  4FFK A;  1TGO A;  3W7X A;  2HHH O;  4IHJ A;  5EBM C;  2E76 B;  2NNU A;  1P49 A;  5EIB C;  3NR7 A;  3Q4H B;  5BMV B;  2UUA O;  1JX9 A;  4EFB A;  1XIL A;  2R9A A;  2KQX A;  1S3J A;  4UVC A;  3CRC A;  2Q69 A;  1F23 A;  4WFH A;  1M1K W;  3K5N A;  1OCC B;  1RSO A;  1U97 A;  4GYC B;  3CCJ V;  4B3S B;  4LR3 A;  4DV6 B;  3E8G A;  1PL4 A;  1IBK B;  3IGA C;  4UCV A;  2EIL C;  1HNX O;  4D7S A;  5IYZ A;  5JJN B;  4UCU A;  3ZMT A;  1KB9 F;  2KKW A;  1K4D C;  1QHT A;  5HFM A;  1OCR C;  3DTU B;  4H13 B;  5FLX N;  1XMO O;  3D3I A;  4UB6 Z;  1FFX B;  3A8T A;  4FLY A;  5HFL A;  5IDJ A;  5L3C A;  1YF2 A;  4TV8 B;  3HR0 A;  3A0B Z;  1J5E O;  4GKK B;  1FD9 A;  2ZNI A;  3E89 A;  4O2B A;  4R7C A;  4MVM A;  5B5E Z;  5LL6 Y;  3N2G B;  3P3P A;  5IY5 B;  1XMO B;  3BHP A;  3QG5 A;  4X20 B;  4MTG A;  2WLI B;  3ZHS A;  1ZAU A;  4I4T A;  5LOV A;  4FLW A;  4PI2 A;  5D5P A;  5JQG B;  2AZ2 A;  5KMG B;  4LC1 A;  4TT3 G;  1K3E A;  2XAG A;  3RYI B;  4TV9 B;  2R72 A;  3VQW A;  1BGY H;  4DK0 A;  4RO2 A;  3G71 V;  2GTA A;  4GX5 A;  2DQ0 A;  3ZCC A;  3QO5 A;  4FFB A;  2Q5Z A;  4BIU A;  3N2K A;  1VF5 B;  3G6E V;  1VQN V;  1H2K A;  4J42 A;  3LNN A;  4DV3 O;  1Q6U A;  3LUT B;  2ATK C;  2YSU B;  2CH7 A;  1GH6 A;  4DR2 B;  2H3O A;  1K5Q A;  4DV4 B;  2ARH A;  3JD1 A;  4JAS A;  2B1G A;  1HWY A;  2E5L O;  1SQB H;  3AG1 B;  5LHH A;  1ZL8 B;  3BAA A;  4DV3 B;  5IYD O;  5LA6 A;  1BCC H;  2JDI G;  1B04 A;  2D3O W;  5B1B C;  2OCC B;  1K97 A;  4IIJ A;  1OCO C;  1V55 C;  3IJ4 A;  2UXC O;  3CJH A;  2ZDI A;  1GN6 A;  4DRX A;  1OZ0 A;  2AXT Z;  2O57 A;  3D3Q A;  1R6N A;  4DV7 O;  4CH6 A;  1XRE A;  3WG7 C;  1TA8 A;  3P3N A;  3CD6 V;  1Q86 W;  4ZI7 A;  1US6 A;  1N34 O;  2HP8 A;  1H2L A;  5B3S B;  2UXC B;  1V54 B;  3ZRW A;  1DGS A;  2BOB C;  1NU1 H;  4I9W A;  4J7J A;  1FAF A;  4GX0 A;  1MSD A;  1SQX H;  5L3F A;  2DYR B;  3K58 A;  2UUC B;  1LUV A;  3J7A U;  1E1R G;  2Y48 A;  5JJE B;  1BE3 H;  4P30 A;  1Q7Y W;  1TAE A;  1LNQ A;  2C2A A;  1VQ6 V;  3SGI A;  5FL7 G;  3PJS K;  3B2E E;  1PNK A;  2PF4 E;  2QR4 A;  1IDS A;  4IT5 A;  4DR3 O;  2NN4 A;  1FYJ A;  1TVK A;  1CEZ A;  1F51 A;  5LMN B;  2WLH A;  3S3W A;  3FD9 A;  3BEH A;  1R3L C;  3EXA A;  1GK9 A;  1KU9 A;  1BT8 A;  1SZT A;  3W7U A;  3CX5 F;  3Q4H A;  1YHQ V;  5BMV A;  2D2C B;  2X6C A;  3L9D A;  4DR3 B;  2P7T C;  2OIE A;  2F23 A;  3H1I H;  4PI0 A;  4ZOL B;  1HR0 O;  3CB2 A;  5BZB A;  2CUG A;  2ZD9 A;  3LSQ A;  1U96 A;  1SET A;  2F43 G;  1L0L H;  4WF9 V;  4DR6 O;  5EK0 A;  2WPD G;  4TUY B;  3D8C A;  1HR0 B;  4MS2 A;  1Q43 A;  1S76 D;  2K9P A;  2ADQ B;  4O4J B;  3ABL B;  4J80 A;  3ICX A;  1VQ9 V;  2B1I A;  2RMK B;  5EBW C;  3FB7 C;  1FFX A;  3CYO A;  2QWR B;  3U10 A;  4F6E A;  3L71 H;  1CXZ B;  1WB7 A;  4FLZ A;  1R6T A;  4TV8 A;  3K9A A;  2WSS G;  2EIK C;  1ROP A;  5EIB D;  2V1D A;  1JJ2 U;  1XMQ O;  5LXT A;  2WLN A;  4BW9 A;  3CCQ V;  4QE9 A;  4N23 A;  4UV9 A;  3SYA A;  4JI3 O;  1I7F A;  3N2G A;  3UKM A;  1PP9 H;  1KMI Z;  4X20 A;  2IJK A;  3L75 H;  2GV9 A;  3JAK B;  4O4H B;  1GO3 F;  4E2L A;  4X1K A;  2BCC H;  5JQG A;  2JIZ G;  5KMG A;  1JCH A;  2DW4 A;  1L0N H;  4DR7 O;  4IL6 Z;  4HNA B;  3RYI A;  3SJQ C;  4TV9 A;  2YIB A;  4FVM A;  4OX9 O;  3F7V C;  1JR9 A;  4Z2W A;  2EIN B;  1QLN A;  4Z1V A;  1KUQ A;  3ZMU A;  3ZRX A;  4NTX A;  3FB6 C;  1SQP H;  3ZRS A;  1VF6 A;  4JI6 O;  3OW2 U;  4RUF A;  3LDE A;  4CBC A;  2VQE O;  1GRJ A;  3T2M A;  2Y4U A;  2UU9 B;  4X1I B;  1QR8 A;  3CCV V;  3FYI B;  4BIZ A;  3WB2 A;  4LF6 B;  1M57 B;  1ZL8 A;  4R50 A;  1AI4 A;  1PV0 A;  4DW0 A;  1AR4 A;  2JVD A;  4P2Z A;  3OMI B;  1EN5 A;  3STZ C;  4PA4 A;  2EIM C;  4JAA A;  4NKG B;  1ARO P;  5EBL C;  1XDC A;  1MNG A;  4D7T A;  1FFT B;  1P7B A;  5CA0 B;  3MDS A;  2PI5 A;  4PDR A;  3ML0 A;  1YDX A;  4NXN O;  3OUF A;  1L8D A;  3H1H H;  1HNW B;  2ZR3 A;  1YJ9 V;  1W59 A;  5D5Q A;  1D2D A;  1B6Q A;  3APO A;  4F6R B;  1O9H A;  3JCU Z;  3ETD A;  3SYQ A;  1Y74 B;  1XQ8 A;  4KUM A;  2YS8 A;  5DEC A;  2JRI A;  4WFF A;  5EC2 C;  4P9O A;  1M9N A;  5BR8 O;  2P5O A;  2WAM A;  2K1E A;  2N74 A;  2YDE A;  4EB6 B;  5KHK A;  3LDC A;  4KFM A;  2LW1 A;  2R70 A;  4A5U B;  2CGO A;  5CMU A;  1VQP V;  1K34 A;  4RAI A;  2LJ2 A;  1X4T A;  5BR8 B;  4QPK A;  3ABM C;  4B7K A;  5B1A C;  2EIJ C;  4NXM B;  5JCO C;  1ZSP A;  2Q6A A;  3JYC A;  4LF4 O;  3K03 A;  5L3E A;  1VQL V;  2AGA A;  2HJD A;  2HLD G;  4ZOL A;  2FML A;  3BAB A;  2M7W A;  2A3Q A;  4DV1 B;  2ZQM A;  3EHB B;  1SA0 B;  4AQY O;  1JQ0 A;  1YXB A;  4LF5 B;  3CC2 V;  2JJ2 G;  2QM8 A;  2ILM A;  1IBM B;  4LF4 B;  4ZIB A;  1WAZ A;  1EN4 A;  3TXQ A;  4F4L A;  1YZB A;  2WA4 A;  3JAT B;  3X2Q B;  1E1Q G;  5GTI Z;  2P4V A;  2QWP B;  3B77 A;  3QF7 A;  2IU3 A;  4O4J A;  5JJJ B;  1IXM A;  1VEW A;  4PDM A;  3R65 A;  3OGI B;  2DWE C;  2OWO A;  4JYC A;  1LUW A;  1NT2 B;  4L87 A;  4B3R B;  4QNH B;  1CPY A;  3RBZ A;  3AG3 C;  1BHB A;  1WP7 A;  2LQT A;  2RQ6 A;  3K5L A;  2R9R B;  3THO A;  2Q9L A;  5H5N A;  5LA6 B;  4PA9 A;  1TUB B;  4JYA O;  2H94 A;  3ZN1 A;  4ABM A;  4E4E A;  4DR1 O;  1V9P A;  4DV5 B;  3JAK A;  4BW5 A;  4EEQ A;  4PDL A;  4O4H A;  2QJ1 A;  4GKJ O;  3ZHT A;  3RYF B;  2B5U A;  3K04 A;  2IU0 A;  4WFB V;  4HNA A;  4LCU C;  3AG7 A;  1QBZ A;  2EIL B;  2Y69 C;  4ZI7 B;  1JMK C;  3ABT A;  3IC9 A;  3OFN G;  1N32 B;  2RDC A;  5C8Y B;  1MMM A;  1SC5 B;  4DR4 B; 
#chains in the Genus database with same CATH homology
 1K4C C;  1OCR B;  2CK3 G;  1KP3 A;  2DQ0 A;  2IJJ A;  4X8A A;  4G28 B;  3ZCC A;  3QO5 A;  3TET A;  5LHI A;  3K0D A;  4BIU A;  3AG3 B;  4XBF A;  2WLJ A;  3G6E V;  1VQN V;  4BAY A;  1YIJ V;  1OCZ B;  1DTO A;  4MTX A;  3ZJZ A;  5B3S C;  5LGU A;  3LUT B;  1V54 C;  1H2G A;  3DGE A;  1YSC A;  2ATK C;  2YSU B;  4UV8 A;  2EIN C;  2W6J G;  1I5X A;  4HZ3 A;  1K5Q A;  3T1C A;  2LFR A;  4Z1M G;  3JD1 A;  1VQK V;  1YIT V;  2DYR C;  2OT5 A;  5DM6 V;  4JAS A;  2B1G A;  1HWY A;  3AG1 B;  1KC8 W;  4OXS A;  2YEV B;  1J95 A;  4PDV A;  1E79 G;  1K33 A;  2OTL V;  5LHH A;  2XOK G;  3I55 V;  1QLE B;  5IYD O;  3OEH G;  3OE7 G;  4JTC B;  2JDI G;  1ENV A;  3BY6 A;  2D3O W;  5B1B C;  1VQM V;  3JD3 A;  1R3K C;  1G4Y B;  2ZXW C;  3RW0 A;  2Y69 B;  2OCC B;  1K97 A;  2P90 A;  5H6R A;  1OCO C;  2BOC C;  1V55 C;  1NBM G;  4MVO A;  2ZDI A;  4Q20 A;  5KA5 A;  3SPI A;  3STL C;  5L3B A;  1DF4 A;  2QA4 V;  1OZ0 A;  1M57 C;  2P6J A;  3K0G A;  1R6N A;  2Z5U A;  2WLI A;  1UJW B;  3JCZ A;  2QTO A;  1N8R W;  2WLL A;  3WG7 C;  2UXN A;  1M90 W;  3OR7 C;  3CD6 V;  1Q86 W;  4ASU G;  4GX2 A;  4LBE C;  3ZMS A;  5B3S B;  1S0V A;  1V54 B;  3CCR V;  3ZRW A;  2DYS B;  4J9Y B;  2AHZ A;  2Q67 A;  3TK1 A;  2BOB C;  4MVR A;  1FXH A;  5J9P C;  3MHS C;  3ABK B;  4I9W A;  1R6K A;  1EZJ A;  3CCM V;  2HJF C;  4GX0 A;  4MT8 A;  3CPW U;  5L3F A;  2OTJ V;  2DYR B;  1RM1 C;  3NXS A;  2X0L A;  4P9P A;  2IW5 A;  5LGT A;  1FXK C;  1H8E G;  1L1F A;  1E1R G;  2Y48 A;  1Q7Y W;  4P30 A;  3F7Y C;  5LHG A;  5CBG A;  4WCE V;  1LNQ A;  2C2A A;  4N21 A;  4MVU A;  1NVP D;  2X6A A;  3OM3 B;  1VQ6 V;  5B1B B;  1W0K G;  5FL7 G;  3PJS K;  2ZXW B;  1PNK A;  5CN0 A;  1VQ7 V;  1Q81 W;  1OCO B;  1K8A W;  3AG4 C;  4GX1 A;  3ABL C;  1CEZ A;  1F51 A;  2HVJ C;  2WLH A;  4JGS A;  3BEH A;  1R3L C;  1GK9 A;  3IFX A;  4QPJ A;  1NJI W;  1THZ A;  3WG7 B;  3FYE B;  1EBO A;  1SZT A;  3W7U A;  3QO8 A;  1S5H C;  1R73 A;  1YHQ V;  3FKS G;  2X6C A;  3LSS A;  4UVB A;  3OAA G;  2P7T C;  4HYO A;  5CA3 A;  1OHH G;  2XAS A;  2R9I A;  4FJC C;  3K79 A;  2X7R B;  3K06 A;  3AG2 C;  3LDD A;  1W0J G;  2H8P C;  4PA6 A;  2IJH A;  1FS0 G;  4FPP A;  1QVF U;  5BZB A;  4EKW A;  1BL8 A;  3HB3 B;  2ZD9 A;  5E1A C;  3LSQ A;  5C93 A;  1FXK B;  1WLE A;  2X6B A;  1SET A;  1GKF A;  2F43 G;  3F5W C;  1K9M W;  4WF9 V;  3HPL C;  3CCU V;  2XAQ A;  3OUS A;  3W7S A;  5EK0 A;  2WPD G;  4U7N A;  1RPO A;  2DQ3 A;  4MS2 A;  2XAH A;  4H33 A;  1S76 D;  3AG4 B;  1FXV A;  3E8B A;  3B8N A;  3OEE G;  3ABL B;  1QR9 A;  4DO2 A;  1PNL A;  3D36 A;  1NR1 A;  4FMT A;  4GT1 A;  5B1O A;  3E8F A;  3CCE V;  1VQO V;  1MAB G;  2B1I A;  2EBO A;  5EBW C;  3VOU A;  3FB7 C;  1GM7 A;  3CMA V;  1VQ9 V;  1BHA A;  3CYO A;  3GWO A;  1AR1 B;  3TCU A;  2HFE C;  4MVQ A;  3X2Q C;  1QCE A;  3K9A A;  2DWD C;  4JPR A;  2WSS G;  3P32 A;  4XDL A;  4JTD B;  4JF3 A;  2EIK C;  1ROP A;  1R3J C;  2V1D A;  4RQF A;  3T4D A;  3ABU A;  1QVG U;  1JJ2 U;  4QIW F;  3RVY A;  2WLN A;  3ETG A;  3CCL V;  3B8M A;  3CCQ V;  4QE9 A;  4N23 A;  4UV9 A;  1EFR G;  3ASN C;  3AG2 B;  3SYA A;  3JD4 A;  3FB5 C;  3UKM A;  3CP1 A;  5B1N A;  1AI5 A;  1ZWI C;  2IJK A;  4G27 B;  4XDJ A;  4X88 A;  1GO3 F;  1PNM A;  4E2L A;  5LGN A;  2JIZ G;  2ZR2 A;  1NH2 B;  1JCH A;  2AHY A;  3EFF K;  2DW4 A;  3OR6 C;  4R8C A;  3SJQ C;  3F7V C;  4PA7 A;  2EIN B;  5IYC O;  1QLN A;  2P67 A;  3K3W A;  1M56 C;  2ZDI C;  4ZKI A;  1Y4M A;  1K73 W;  1ORQ C;  3ZMU A;  3ZRX A;  5CBH A;  1SES A;  4CZZ A;  2QEX V;  3FB6 C;  3SYC A;  2V7Q G;  3ZRS A;  3OW2 U;  4PA3 A;  4RUF A;  3LDE A;  4CBC A;  1G8M A;  3T2M A;  1MSW D;  5L3D A;  4UXN A;  3SPJ A;  1KP2 A;  3MHH C;  4HAM A;  2QKS A;  4RQE A;  2EIK B;  1YI2 V;  1H8H G;  1PKX A;  4TWK A;  1QR8 A;  3CCV V;  3FYI B;  4BIZ A;  2IH3 C;  1V55 B;  4UVA A;  2HG5 C;  3ASN B;  1M57 B;  3JD0 A;  1YTF B;  2YEV A;  2HKO A;  4I5S A;  4R50 A;  1AI4 A;  3FB8 C;  1PL0 A;  3QNE A;  4MTF A;  1Q82 W;  5EC1 C;  3H01 A;  3W7W A;  2Q68 A;  1S77 D;  4TSF G;  3CC4 V;  4P2Z A;  3OMI B;  2UXX A;  3ZRV A;  4QE7 A;  3CCS V;  1TUE B;  2QE7 G;  4U7O A;  3SYO A;  3LNM B;  3E35 A;  3SPC A;  2W0F C;  3GB7 C;  3STZ C;  2EIM C;  4PA4 A;  2W6I G;  1ARO P;  1AJP A;  2JEX A;  5EBL C;  1M56 B;  1DF5 A;  5IYB O;  2WLM A;  1FFT B;  3K08 A;  2GSM B;  1P7B A;  3JD2 A;  5LBQ A;  4WFE A;  2PI5 A;  2ITD C;  4PDR A;  3ML0 A;  2JEU A;  1F4N A;  1RM1 B;  5H9C A;  3OUF A;  2LP7 A;  2EJR A;  2A0L A;  2ZR3 A;  3ETE A;  3AEI A;  1YJ9 V;  4FK5 C;  1NH2 D;  2QM7 A;  4JYB A;  2WLL B;  3CXC U;  4JTA B;  1AI6 A;  1B6Q A;  4JAU A;  1P4R A;  3ZRW B;  4DXW A;  3ETD A;  3E8H A;  4YXW G;  1I5Y A;  3SYQ A;  3OMA B;  4KUM A;  3E83 A;  4WFF A;  5EC2 C;  1OCC C;  3I56 V;  4P9O A;  4WFA V;  3ZMV A;  1M9N A;  3UM7 A;  2WAM A;  3SPG A;  4MVZ A;  2MK3 A;  5CBF A;  2K1E A;  3E86 A;  2A79 B;  1GM9 A;  2IJI A;  1BMF G;  1YJN V;  1NKD A;  4WFG A;  2WLK A;  3CME V;  1NVP B;  3E2E A;  2HVK C;  3LDC A;  2HR3 A;  4KFM A;  2DYS C;  3G4S V;  1VQ4 V;  4GCZ A;  1MG1 A;  3RVZ A;  1JOY A;  3ABK C;  5CMU A;  3A0R A;  2XAJ A;  1K34 A;  3ZMZ A;  2JK5 C;  4RAI A;  1VQP V;  2NLJ C;  2EIM B;  1KKD A;  1YTF D;  4FIP C;  4QPK A;  3ABM C;  2IH1 C;  5B1A C;  1GTO A;  2EIJ C;  1S72 V;  1MOF A;  3M99 B;  2EZP A;  3ASO C;  5GW7 A;  1WPX A;  1KD1 W;  1Y66 A;  5KUK A;  2KB1 A;  2Q6A A;  1AI7 A;  3JYC A;  2Z3Y A;  1XL6 A;  4MW8 A;  3K03 A;  3OMN B;  1GM8 A;  3W7X A;  5L3E A;  1RPR A;  5EBM C;  2NNU A;  3P30 A;  3OGC C;  1VQL V;  4G2K A;  1JX9 A;  2XND G;  1K5S A;  2XAF A;  2HLD G;  2M7W A;  2EZO A;  4H37 A;  5KA6 A;  2ZQM A;  3EHB B;  1S3J A;  4UVC A;  3SPH A;  2Q69 A;  4X89 A;  1DLB A;  1F23 A;  4WFH A;  1M1K W;  1JQ0 A;  1W2B U;  1OCC B;  1R3I C;  3CC2 V;  3CC7 V;  1FXK A;  2JJ2 G;  2QM8 A;  5IY5 C;  3CCJ V;  4QJF B;  3ZN0 A;  3E8G A;  3ZIA G;  4F4L A;  2LFS A;  5KUM A;  3X2Q B;  1E1Q G;  1SRY A;  3IGA C;  3W7T A;  3VBB A;  4MVS A;  2EIL C;  3B77 A;  1JPX A;  2IU3 A;  1IXM A;  1PD3 A;  4PDM A;  3R65 A;  2DWE C;  3ZMT A;  3MD0 A;  4PEL A;  4JYC A;  1K4D C;  1H38 A;  1AJN A;  3ABM B;  5HFM A;  4L87 A;  4MW3 A;  5B1A B;  2EIJ B;  1OCR C;  3DTU B;  3ASO B;  4QNH B;  1CPY A;  3RBZ A;  2ITC C;  3T4Z A;  2A9H A;  3AG3 C;  3D3I A;  4MTO A;  1KQS U;  1BHB A;  1OCZ C;  1KEC A;  5HFL A;  5IDJ A;  5L3C A;  2R9R B;  4KP4 A;  4R6Z A;  3IC7 A;  3KG2 A;  1XL4 A;  4PA9 A;  1JVM A;  3E89 A;  2H94 A;  3ZN1 A;  4R7C A;  1K7D A;  1AJQ A;  1VQ8 V;  1NR7 A;  4BW5 A;  4LP8 A;  4MVM A;  1SER A;  4PDL A;  1K92 A;  3AG1 C;  3WFV A;  5IY5 B;  5H6Q A;  1NQT A;  1CP9 A;  4MTG A;  1QLE C;  2B5U A;  3K04 A;  2IU0 A;  2WLI B;  4ZBM A;  1GMG A;  1YJW V;  4WFB V;  4LCU C;  2WWW A;  4J9Z B;  5DN6 G;  1QBZ A;  3SYP A;  2EIL B;  2Y69 C;  4LC1 A;  2OCC C;  4RUE A;  1F4M A;  4MSW C;  4TT3 G;  5L3G A;  3ABT A;  1K3E A;  3OFN G;  2XAG A;  3QO7 A;  2JJ1 G;  1VQ5 V;  4UUJ C;  2PI4 A;  4JAV A;  4RO2 A;  4XDK A;  3G71 V;  1COW G;  2GHY A;  4GX5 A;  2FTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...