2AHZA

K+ complex of the nak channel
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
105
structure length
105
Chain Sequence
MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Atomic structure of a Na+- and K+-conducting channel.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 42
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ahzA00
3T1CA 3X2QC 2AHZA 2QTOA 4QNHB 3LDDA 2WLLA 2WLHA 4P30A 1LNQA 1BL8A 2ITCC 3SPGA 4GX5A 4WFGA 2A9HA 4X89A 5B3SC 1K4CC 1OCRC 5CBGA 5EC1C 3VOUA 4MVMA 4MVZA 1XL4A 4MVRA 4RO2A 4ZBMA 3STLC 5CBHA 3ASNC 4J9YB 2YEVA 4RUEA 3F7YC 2HFEC 4R8CA 1R3IC 3SYPA 3LUTB 3SJQC 4H33A 3T4DA 4DXWA 1S5HC 1OCOC 4MVQA 4XDJA 3IGAC 4R7CA 3SPIA 1ZWIC 2Q6AA 3SYAA 2DWEC 2ITDC 4G27B 4GX0A 4H37A 3LNMB 4MS2A 3AG2C 3EFFK 4GX1A 4OXSA 4P2ZA 2X6CA 3IFXA 4GX2A 3FB8C 4MW3A 4QE7A 3ZJZA 1V55C 4PA4A 4EKWA 3K04A 1P7BA 1ORQC 3R65A 1JVMA 3AG1C 3K08A 3BEHA 2HG5C 3K0GA 3LDCA 4PDVA 3UKMA 5CBFA 2ZXWC 2X6BA 1R3LC 3E8FA 2BOCC 4MTOA 3SYQA 2BOBC 2EIKC 3T4ZA 2HVKC 1R3KC 4JTDB 1M56C 3KG2A 3SPCA 4R6ZA 2AHYA 2KB1A 2DYSC 4JTCB 5B1BC 2WLJA 2WLMA 2Q69A 4PA3A 3STZC 5IY5C 3E8GA 4PDRA 4PA6A 2QKSA 3K0DA 4PA7A 5EBLC 4I9WA 4QE9A 2K1EA 4XDLA 4UUJC 5EBWC 4MW8A 4PDLA 3UM7A 4WFEA 2WLNA 2ZD9A 4G28B 3ABMC 5KUKA 4LCUC 2A79B 1OCZC 4RUFA 4J9ZB 3GB7C 3SYCA 3OUSA 4PA9A 3E86A 3FB6C 2IH3C 4PDMA 4MVUA 4JTAB 3JYCA 3K03A 3E8HA 3PJSK 4MVSA 2WLIB 4MVOA 3F7VC 4XDKA 5E1AC 5EBMC 2IH1C 4HYOA 4CBCA 2OCCC 3OUFA 1KKDA 5EC2C 5EK0A 1QLEC 2JK5C 1M57C 2EIMC 2P7TC 4P9OA 4RAIA 4P9PA 4TWKA 3TCUA 4BW5A 4X88A 3TETA 2HJFC 2W0FC 4HZ3A 1G4YB 1J95A 2X6AA 2WLLB 3OR6C 3E8BA 1K4DC 3RVZA 1OCCC 3ABLC 4LBEC 1XL6A 3E89A 5KUMA 2R9RB 2DWDC 2EINC 2H8PC 2WLKA 2Y69C 4X8AA 3SYOA 3RW0A 2Q67A 3HPLC 1R3JC 3ASOC 2A0LA 2Q68A 3K06A 3RBZA 3F5WC 3OR7C 3RVYA 2DYRC 4F4LA 3SPJA 2EILC 4R50A 5J9PC 4MTGA 2ATKC 3ABKC 3E83A 2HVJC 4LP8A 4MSWC 5BZBA 3T2MA 1V54C 2NLJC 3AG4C 3FB7C 4KFMA 4WFFA 3LDEA 3OGCC 5B1AC 2WLIA 3ZRSA 3FB5C 3SPHA 2EIJC 4WFHA 4MTFA 3AG3C 3WG7C
chains in the Genus database with same CATH superfamily
3K9SA 4J41A 4B3SO 1OHHG 1IVSA 1H8HG 1IBMO 4P30A 1NVPD 3A0HZ 5B3SC 1SC5B 4KUMA 1L8DA 4TV8B 3N27A 3OTOB 3UO3A 4K3AA 1E79G 3ZHQA 5ITZA 4G27B 1N36O 3EFFK 4JI3O 3MDSA 1KYOF 5CB4A 2FL4A 1D5AA 4I0XA 2DOSA 4BAYA 4X65B 3RYFB 4LWSB 3T4ZA 1GH6A 3ZHTA 3U11A 5KHIA 1BHBA 2Z5UA 3L75H 2QM4A 4TV8A 4HAMA 2PI5A 1O9HA 4TV9A 1R6NA 1WAZA 3J7AU 4QPKA 3DC6A 3UM7A 1RM1C 2RQ6A 4RUFA 1RPOA 4RQFA 5B1BB 4NXMO 4PA9A 2YC0A 4DV4B 4DR5B 2RNBA 4MT8A 4MVSA 4F6RB 1YIJV 5J2TB 5JJNB 2F1MA 3ABUA 3H1JH 3P3PA 2LGQA 3JALB 2DW4A 4JZGA 4IYHA 3RYFA 5LHIA 4LF9O 4IT5A 1RSOB 4LWSA 4O4HB 3C90A 5CA3A 1X59A 4UVCA 2R9RB 4FLYA 4DR3O 4X8AA 1YF2A 1BQZA 3M99B 5B1NA 4LF8O 3FYEB 2JJ1G 3W7UA 1VQ6V 4LF4O 2X7RB 3CCVV 1KKCA 4QIWF 3CEIA 3VQVA 1M4UA 2N74A 3TK1A 3ZRSA 2ADQB 2BSKB 3SDLA 4WFHA 4DR4O 3JALA 1F4NA 1RSOA 3T1CA 1Q6IA 2UXBB 2CH7B 4JAAA 1IX9A 3BPZA 3WG7B 4RO2A 5K1PA 2YEVA 4BIZA 2AZ2A 5BR8B 1I94O 1BSMA 2HJDA 3U0ZA 2ZIMA 5D5QA 3QNEA 2ZE5A 3ZMVA 3ASNB 3WU2Z 4B7KA 2BSKA 2QDOA 1F51A 5CMUA 3AG1C 2FTKA 4PDVA 3CCEV 5IYBO 1MNGA 3JD0A 1IXBA 2CH7A 4FFBB 4YHHO 2OWOA 1VQ4V 2B1GA 1PM9A 2YXLA 1IBKO 4DR7B 4E4EA 3P32A 4X62O 4LF5O 4O4IA 5LMUO 2CUGA 4EFBA 2Y48A 1B6QA 2ZD9A 2EX3A 4FIPC 1XMQB 2OTLV 4TOIA 1SQPH 3SYCA 1YEWA 3HKDB 4D6TH 5FPOA 4K8XA 3Q4HB 4X1IB 3C3SA 4FJCC 1SETA 3T1HB 3K03A 3E8HA 5K1XA 3JD4A 2OTJV 2IH1C 3G80A 4H13B 2Y4TA 4P9OA 1JR9A 4FFBA 3OE7G 4HZ3A 2ZT9B 3RVZA 3E89A 1AI5A 3C3TA 1GN6A 5EIBD 2ZR2A 1MABG 2LFSA 3T1YO 1THZA 1QLNA 2QWNB 3Q4HA 2F4VB 1AI4A 1W0KG 2NLJC 3SR2C 1NR7A 2YXYA 1M9NA 2LW7A 2WWWA 4UVAA 2EILB 2WA4A 4UFZA 3CCQV 3SPGA 2R70A 4FZ1A 1PNMA 5CN0A 2QJ1A 1HW7A 3ZCCA 2FMLA 5DEDA 1K4CC 1IBMB 3MHSC 4I55A 4LH7A 4OPHA 5LA6B 1Q8IA 4U7NA 4H33A 5B5EZ 1ZTEA 3DC5A 4I9QA 4XDJA 5EZYB 2XAFA 4KP4A 1QCEA 3N2KA 2P90A 4JI2B 3TXQA 1AJPA 1L0LH 2O57A 3R65A 1ORQC 1JVMA 3K08A 4RQEA 2UUAO 5LHHA 4B3TB 2BCCH 1GM9A 1Z5WA 3K57A 4LFCO 2F43G 4Q6GA 4GUNA 1Q82W 3SPCA 2DQ0A 4JTCB 1KP2A 4FFKA 2W6JG 5IY5C 4XBFA 3WB1A 2P06A 5LA6A 1MSDA 5EBLC 3APOA 1HNZO 4DV3O 1V9PA 4O2BB 3CC2V 5FL7G 4GYCB 3JD2A 3B77A 4U3JA 3OUFA 4JV5B 2HJFC 3HKBB 1J95A 5LHGA 5H6RA 1TAEA 5C8YB 1NTZH 2OCCB 1XHXA 2ZINA 1VQKV 4FLZA 3CP1A 1DF5A 1JFFB 4LF8B 3KCYA 4DV0O 4O2BA 3E83A 3RYHB 3E22B 4FLTA 3CS5A 4BIOA 1Q6UA 5IE9A 3CXCU 1IDSA 1Q86W 1V54B 3KCXA 1DLBA 1A32A 1Y66A 1M93A 3THOA 1SRYA 2YIAA 5C8YA 1NT2B 1BCCH 1K73W 2Q7GA 3CXHF 2VS0A 3ZHUA 3AK1A 1E1RG 3SPIA 2Q5ZA 1ZSPA 4EEQA 4JI4B 1Q3EA 2GTSA 1EN4A 3O65A 1I94B 4GX2A 3CC4V 1HNWO 1PPJH 3K04A 1P4RA 1M90W 3F5TA 3J81N 3B8MA 3E8FA 1GN3A 1AR1B 2GBOA 2KQXA 1BGYH 1EBOA 3JSNA 2UXDB 1VQ8V 2HHHO 2RJZA 4DV2O 1P7GA 2YI9A 4IIJA 1E1QG 1VIBA 3CRMA 3HB3B 2QKSA 3VQWA 2K1EA 4C7UA 3BAAA 1NR1A 4LFAO 4J42A 4X62B 2ODMA 2QKCA 1MZFA 2ZR3A 5LMUB 1HNXO 2XUMA 1KKDA 1PKXA 2UU9B 1M57C 3SJBC 1F7YA 3TETA 5LBQA 4GKKB 1SQVH 3CX5F 2YUAA 1Q7YW 3JAWB 2PY5A 2L6LA 1QLEB 1AR5A 1YTFD 1KUQA 2A0LA 1Z2GA 4LF6B 4MSWC 4CH5A 3T1YB 5FPRA 1PL0A 2Q0OC 2QWPB 1RP3B 4K0KO 4K35A 1K34A 2YSUB 4AQYO 2W0XA 2ITCC 1WA8A 2OCHA 2WPDG 4JI7O 3ETEA 1GO3F 1CXZB 2A3QA 3AG3B 1ZX3A 1EN6A 4EB6B 1GN4A 4U7OA 1H2NA 2QR4A 3GVMA 4CC5A 1Y67A 4O4JB 4DXWA 4IYIA 1SQQH 3IGAC 4R7CA 4TQDA 1ZWIC 4JI0O 2ZNJA 4UV8A 2OIGA 1OCRB 5KMGB 2PTMA 5AG2A 3JD1A 3N2GB 4NR1A 4PA4A 3CSXA 3L70H 1DGSA 1N34O 4JASA 3WB0A 4UB8Z 1JCHA 1BHAA 2BOBC 5J2UB 4DUZO 2Z3YA 1AROP 5L3EA 4ZI7B 1K33A 2G38A 2WLJA 4DR1O 4LFBO 4O4JA 3K0DA 2EIKB 1GN2A 1Y74A 1NTMH 4HNAA 3H1LH 4OGQB 5KMGA 3OM3B 1QBZA 3N2GA 4B3MO 1TA8A 1VQMV 4X64O 2JK5C 2EIMC 4N21A 1G4YB 4ASUG 3GWKC 3K3WA 1P49A 2IJKA 4ZI7A 4LBEC 1R73A 4X1KB 1R1BA 3WB2A 3B8NA 1S5JA 1Z5VA 3RW0A 2AGAA 4PELA 2Q0AA 5H5NA 3OR7C 2E5LO 2A7WA 2E3CA 5KHKA 1FS0G 2CGOA 2XTAA 3K9AA 1NH2B 3AK2A 2XHBA 1FFXB 4FMTA 4JI5B 5LGTA 4J7ZA 3SGIA 5BY1A 2XAQA 4DV0B 3D3IA 5IYDO 3CMAV 5EIBC 3MD0A 2D2CB 1N33O 2UUCB 1MZEA 2GHYA 4X1KA 4CS3A 2PZSA 1GK9A 4MVRA 3STLC 4PV1B 3SJQC 5KHHA 1HWYA 2V7QG 1S77D 2QM8A 2ZQMA 4Z1MG 2ZE7A 3CCLV 3SYAA 4LF7O 3L74H 1FFXA 2R9IA 4NB5A 4QE7A 4DR2B 4DV6B 3OEEG 4G2KA 5KHJA 1JMKC 3OFNG 2ZXWC 1R3LC 3IAYA 4FLWA 2W6IG 1J5EO 1AJNA 3ABTA 3DXRB 3PN1A 4NXNO 1IBLO 5B1BC 1TVKB 2HHHB 4PDRA 4UCVA 5JWPA 4DV2B 1FD9A 2Q73A 1H2KA 4L8JA 5IYZB 5JCOC 1YJWV 5JJJB 4TT3G 3K79A 2OIEA 2P67A 5KAIZ 2CE4A 1OCCB 4DO2A 1TUBB 1DK1A 2XAJA 1YXBA 5EC2C 1YI2V 4GKJO 2IJHA 3DXRA 4X88A 2X6AA 2CDYA 1HDJA 3E8BA 5JVDB 1AVMA 2FB5A 3ZMSA 1FAFA 1L1FA 3F5WC 3BA8A 3OMIB 4FM1A 5IYZA 3TGUH 1W0JG 4X20B 3JARB 4ZOLB 3W7WA 3FB7C 4KFMA 3DGEA 1VQ9V 3FB5C 2EZPA 4BWAA 4UCRA 2AW9A 1EM1A 3WG7C 4K0KB 3GWOA 5JVDA 2A9HA 2RCVA 3BCCH 3H1KH 2EJRA 4DK0A 4AQYB 3ASNC 4JI7B 1O9GA 1PNLA 1T5EA 4X20A 3OD4A 4ZOLA 2ZE6A 4F6RA 3LNMB 1BMFG 2CTWA 5J2TA 5JCOA 4OXSA 3B2EE 4P2ZA 4JAVA 4D7TA 4UCSA 1HR0O 1Q90D 4O4HA 3QO8A 3K0GA 3JASB 2JDIG 1WPBA 1FJGO 3P30A 2KG7B 3SYQA 2HVKC 2P4KA 1N34B 1R3KC 4NTYA 4JYAB 5L3FA 5IJ0B 4DUZB 2IBZH 3RYCB 3CCUV 4DR1B 4QE9A 2ZM6B 5LGUA 4LFBB 5KUKA 4J11A 1NKDA 3GB7C 1Y76B 4O2AB 5JH7B 1NH2D 1SZTA 2IH3C 2P4VA 1QR9A 3JYCA 3PJSK 2WLIB 3JASA 3ABMB 4JAUA 1Q6HA 3QG5A 1FXHA 4RAIA 1D5NA 1SKVA 4CZZA 1BQ0A 5IT9N 3IC7A 1K4DC 1B04A 1GMGA 5DECA 4ZHQB 2YICA 2PF4E 2FYUH 4B3RB 3RN4A 2B1IA 2EILC 4DK1A 3JCZA 4WF9V 2RN9A 5JH7A 2MW2B 1NBMG 2E5LB 1N0NA 5H2FZ 3CRCA 1SERA 2WLIA 3ASOB 3OTFA 4J7KA 4PJ0Z 2DYRB 1L0NH 2ZDIC 4TQFA 2P5OA 2IJIA 1CEZA 5CA0B 4OX9B 1N33B 1NZ6A 5TISZ 1SZXA 5LMNO 2VQEB 5CBHA 3HKDA 4J9YB 4J7JA 4X1IA 3SYPA 1GTOA 2XAHA 1WN7A 1B3QA 1XEQA 4UVBA 3G71V 3APQA 1H2MA 2X6CA 2K9PA 2R72A 1R6KA 4LF7B 2NN4A 2HG5C 5CBFA 4B3SB 2OT5A 1VQPV 1SS3A 5CA0A 4GT1A 5LL6Y 1I7FA 1YTFB 1XDCA 2B5UA 1ZL8B 2F95B 2JGDB 3W7SA 3I5DA 4PA7A 3K58A 2DN9A 4JPRA 2JS5A 4G28B 1N36B 1I08A 4I7ZB 3CWBH 3K5MA 1GM7A 4JI3B 1IURA 3FX7A 3ZMTA 4FM2A 2OCCC 2WA3A 1JA8A 3OGIB 2ZDIA 2WLLB 3EHBB 2DWDC 5EZYA 1YJNV 4QJFB 1ZAUA 2UXCO 3CRAA 3A2FA 5A2QN 4UB6Z 1G8MA 4NXMB 1UJWB 1V54C 3RYIB 5L3GA 4UCUA 5HFMA 3OMAB 2HLDG 4LF9B 3CHXA 1ROPA 3ABKB 3H9VA 4QNHB 2WLLA 3S3WA 2E76B 4GX5A 1H2SB 1QNMA 2XNDG 1FYJA 4DR3B 5EC1C 3UQ8A 4FLVA 4CH6A 1SESA 4I50B 1WJZA 2UXXA 3LNNA 2N04A 4LF4B 1XHZA 3LSSA 1YSCA 4ZKIA 4MS2A 3RYIA 2YI8A 3ICXA 1V55C 3HKBA 1XOUA 2JRIA 2CTQA 4DR4B 3UKMA 1AI7A 1VQLV 1HR0B 3NXSA 4JI8O 3AG2B 4JYCA 4JTDB 3KG2A 4QGPA 1CPYA 2KB1A 1JFFA 5GTIZ 3W7XA 1SQBH 3RYHA 2VRZA 3CCRV 2H3OA 5H9CA 3E22A 2YS8A 1M56B 4JYYA 3VQYA 1AR4A 4DUYO 3AG7A 1WB8A 4FVMA 4JTAB 1DTOA 4DV7O 5EBMC 2LJ2A 4XDKA 3F7VC 1H8EG 3ZEDA 1ZUQA 1OCZB 1FFTB 1QLEC 4BW5A 3B40A 3JD3A 4YHHB 4FM0A 4IL6Z 2YXHA 1KECA 2QM7A 1TUEB 1IBKB 1R3JC 4LF5B 3OTOO 5LXTB 2UXNA 1KQSU 2P6JA 1VQNV 4Q20A 3HKEB 3K59A 3ABLB 3H1IH 3HR0A 5BZBA 3E2EA 1EZVH 3I55V 4BIUA 1PV0A 3JATB 4D7SA 4F6EA 2LQTA 3AG3C 4YY3O 1X4TA 3LDDA 3AG4B 1YZBA 1LUVA 1BS3A 1OCRC 4YJ3B 3K5LA 2EIJB 2CAZC 4ICGA 4DV5O 3VQXA 5LMNB 4GLXA 1SQXH 1WB7A 2KSDA 4FPPA 4UCTA 1PP9H 4GX1A 3FB8C 3IC9A 3JATA 3SJCC 1OCOB 1JPXA 1AP6A 2DE0X 3JAWA 4MTOA 2Y4UA 2EIKC 4IGGA 5L3BA 1UPGA 4YJ3A 4GZRB 4FK5C 2PYJA 2F93B 4PA3A 1I5YA 3ZBHA 5EBWC 2DJVA 1XBLA 4LCUC 4J9ZB 2OYQA 3OUSA 2WAMA 4H44B 4MVOA 2UUAB 3NR7A 3BABA 3K5NA 4DRXB 4GCZA 3QF7A 3BY6A 4LFCB 1G1XB 4EB6A 5KA5A 2UXBO 2F66C 4LH6A 1N32O 3J80N 1WLEA 2R9AA 1VARA 2H8PC 3OMNB 2Y69C 1F23A 4KXRA 1YITV 2Q67A 5A9GA 2M7WA 4PI0A 5L3CA 1OJHA 3B4SA 5BR8O 5GONB 1H38A 4R50A 1Q5OA 1HNZB 4DV3B 4LP8A 3G6EV 1TGOA 5LP6B 2UXCB 3SJAC 3OGCC 4I5SA 5B1OA 2JJ2G 5J2UA 3CC7V 4MTFA 1H2GA 5IDJA 4E2LA 3E35A 2VWJA 5B1AB 2V4DA 4MVMA 1WPXA 2LFRA 4EFEA 4K8ZA 4DR7O 1PL4A 3H1HH 3X2QB 2HFEC 2IJJA 5GONA 1K5SA 3OEHG 2DWEC 4WBNB 4N23A 3IFXA 3CCMV 2QE7G 4MW3A 4LNUB 4EKWA 3T1HO 4JI1O 3BEHA 2QKAA 2ILMA 3LDCA 2X6BA 1VQOV 4DV1O 1PNKA 5GTHZ 3ZIAG 1SQGA 3L71H 1FXKB 4R6ZA 4LR3A 1QVFU 3BFRA 3A0RA 2JVDA 1VF5B 2A06H 4I9WA 1XILA 2CTRA 4MW8A 2ZCEA 4AHCA 3H01A 2DYSB 1KB9F 2F4VO 3ZMZA 4LNUA 1NS1A 1OZ0A 3CPWU 1HNWB 1K97A 2ARHA 2QA4V 1DF4A 4CBCA 2QWRB 5D5PA 4DV7B 4TWKA 4P9PA 5CB4B 1W59A 1BZKA 1FXKA 1GKFA 1NQTA 2EJ7A 4LC1A 2WLKA 1FXVA 3BHPA 1VF6A 2LW1A 3D3QA 4X66O 2RMKB 2VWKA 1KP3A 2GUZB 2M6YA 3HKCB 4F4LA 4LFAB 3SPJA 4ZIBA 2UUBO 4IHJB 4TV9B 2EINB 2EULA 1HNXB 5KAFZ 3T2MA 4JI2O 3MHHC 4WFFA 1EZJA 2E74B 3I56V 1IZ3A 4JZ2A 1KC8W 4B3TO 2YIBA 1TVKA 3QVNA 2QTOA 3ETQA 4YY3B 3KZIZ 2YIDA 2DQ3A 1JJOA 1XL4A 4ZBMA 2GUZA 3F7YC 3T4DA 3HKCA 3KKYA 1S5HC 4IHJA 2ZXWB 1TUBA 4DYLA 1HP8A 5B3SB 4DV5B 2EZOA 4H37A 1S5LZ 5DM6V 2DMXA 4WFAV 1GRJA 1W2BU 4JV5O 1SA0B 2PYLA 3FAVB 2VQFO 3TXSA 1QVGU 2GV9A 2F23A 2PI4A 3ZRXA 2WSSG 4PHZA 3ZRWB 2MK3A 3JARA 3ZX6A 5LGNA 2CGNA 4KHPO 4AILC 3ABMC 4JI0B 1K92A 2YEVB 4PD4F 2QGNA 1RM1B 3D36C 4W4KA 1I5XA 5EK0A 1SA0A 5EYPB 2Q8VA 3AK3A 3TCUA 5HFLA 3BRCA 3FAVA 1S0VA 5LYJB 1AB3A 1XL6A 5KUMA 3FKSG 3ZRWA 1N32B 3QO7A 3ASOC 1RFYA 4JYBA 1Q43A 2L35A 1CP9A 2DYRC 5KHGA 4NVPA 1GM8A 4MTGA 3JSLA 1AP5A 4UV9A 4JI4O 1BE3H 4O4IB 2QSAA 1WP8A 2KG7A 4B3MB 4B7EA 3FD9A 5EYPA 4X64B 3ZHSA 1K5QA 5IJ0A 2XT9A 3DSQA 5DN6G 2WLHA 5LYJA 1NI8A 1K3EA 1ZLZA 3RYCA 2UXDO 3UCSC 4X89A 2ZNIA 1JQ0A 4QPJA 4MTXA 5GW7A 1Y76A 4I4TB 4O2AA 3OW2U 1R3IC 5BXZA 4YIPA 1N0JA 3RFRA 4MVQA 1F4MA 2FKXA 2Q6AA 2JEUA 1XNQO 1Y4MA 3D8CA 2H94A 3ZJZA 5C93A 3ZHVA 1XUQA 3G6BA 5IYCO 1YDXA 2UU9O 4ZHQA 2YIBD 3D36A 3CJHB 1XREA 3LSQA 4JI1B 1QQCA 4GKKO 1KU9A 3A0BZ 2Q7EA 4DV1B 2BTQB 3AG1B 4FLXA 5IJ9B 4I4TA 2PGGA 2HKOA 3L73H 3WFVA 4XDLA 1XQ8A 4UUJC 3M7MX 4H0LB 1OV9A 4I55B 4LF6O 3FFQA 5BMVB 1D2DA 1RPRA 1YHQV 4FZ0A 3N2KB 3G4SV 4HYOA 4TUYB 4DW0A 3CJHA 1N8RW 1J5EB 2XASA 5JJEB 5KA6A 3OR6C 4NXNB 4NTXA 2JIZG 2BTQA 1AILA 1IBLB 5IJ9A 1LUWA 3JAKB 4W4LA 3HPLC 1GAXA 2GSMB 3K06A 1PD3A 3RBZA 3S3XA 2QWQB 1MG1A 3M8AA 5B66Z 2IM9A 5BMVA 4X66B 3CB2A 3ABKC 2UUBB 1H2LA 2P22C 3ZN1A 4UXNA 4TUYA 5FNVB 4CH3A 1MOFA 2Q9LA 4CH4A 3CCSV 4DR6O 4GKJB 1ZL8A 1K7DA 2JGDA 1LNQA 1BL8A 4U3JB 2C2AA 4WFGA 1AJQA 1EFRG 2QWOB 4L87A 5CBGA 3JAKA 2V1DA 1U97A 5IWAO 1AI6A 4R8CA 1WP7A 3LSUA 2CK3G 2ITDC 2GDSA 4GX0A 3AG2C 3ML0A 3K5OA 2NNUA 1XI1A 5FNVA 3TJTA 1NTKH 1P7BA 4JI6O 1XMOO 3QO5A 4B08A 1NU1H 2BOCC 1VEWA 2QTSA 5H6QA 1M56C 2AHYA 3EXAA 1YCIA 3MAQA 2ZE8A 2VQFB 3STZC 2LO1A 3ZMUA 4PDLA 2WLNA 4UCOA 5F2VO 3IJ4A 2D3OW 1OCZC 1XNRO 3L72H 4BR6A 3FB6C 4KHPB 5IY5B 4JI5O 2ETNA 5E1AC 3B09A 1COWG 1KMIZ 1FJGB 2HR3A 3CCJV 4RWUA 4I50A 2W0FC 1VQ7V 2B9ZA 3A8TA 1UFIA 2UUCO 3ABLC 1IXMA 3ZS8C 2IW5A 4HBNA 4CC6A 5E79Z 2JS3A 1VMGA 3RVYA 4IIJB 3ZRVA 3CMEV 1JX9A 2ZIOA 5KLVH 1MMMA 2ATKC 3AG4C 4KL1A 3LDEA 4OPAA 4DR2O 2ZKOA 4DV6O 1ENVA 2EIJC 1S72V 1K9MW 1U96A 1FPOA 2JGUA 1VQ5V 1V55B 4RUEA 2JEXA 5L3DA 3LUTB 2BTOA 3P3NA 1OCOC 2AZ0A 3BA9A 3VBBA 4CS4A 1SF9A 2ADPA 2Q4PA 3CYOA 4YIOA 4J10A 1XNQB 3ZHRA 4X65O 1M5IA 3BVOA 1YVWA 2Q7HA 3CD6V 2E75B 2YDEA 1P84F 1NVPB 1FKAO 2NR5A 3DTUB 1QHTA 5LXTA 1YJ9V 2Q69A 3HKEA 2Y0PA 4U3FH 2Z0AA 5KX5B 3E8GA 3JCUZ 4JGSA 1WA8B 4CS2A 3CRQA 4FLUA 1N4CA 4O4LB 4WFEA 4DV4O 4DR5O 4YJ2B 1JJ2U 3AEIA 2LP7A 2RDCA 4PDMA 4MVUA 1VF7A 3R66A 2GTAA 1QR8A 2X0LA 3OT7A 3ETGA 2BE3A 2P7TC 4NTWA 2PUSA 2IU3A 5KX5A 5LP6C 3SYOA 1M57B 1VP7A 1MSWD 1WNSA 4O4LA 1S3JA 4BW9A 4YJ2A 3QTCA 2Y0IA 4ABMA 2HVJC 2XAGA 2AXTZ 5B1AC 1Y74B 2XOKG 4HNAB 2CTPA 3RWRD 1NJIW 3X2QC 3W7TA 2AHZA 1EN5A 4DR6B 2EBOA 3RGBA 4JYAO 1K8AW 4PI2A 3VOUA 3G67A 1R6TA 4MVZA 2IU0A 3UT5B 1Y6XA 1I0HA 4YXWG 1JOYA 4X9QA 2ZM6O 5IWAB 1QU7A 3L9DA 4WFBV 5LOVB 4DRXA 1BT8A 1FXKC 5JQGB 1SQFA 3ZN0A 3RT3C 4NYKA 4Z1VA 1KBHA 4JI6B 1VF6C 1XMOB 1Q81W 3ETDA 1MA1A 2DYSC 4NKGB 2WLMA 1US6A 4PA6A 2HEPA 1XMQO 3UT5A 4A5UB 5LP6A 4B3RO 1M1KW 4J80A 3O9OA 4TSFG 2A79B 5LOVA 4JF3A 5CA1B 3E86A 2N05A 3OAAG 4WCEV 1XNRB 5JQGA 2HP8A 2Y69B 4X1YB 1KD1W 1B06A 3FYIB 4DW1A 4JI8B 3U10A 1G6UA 1S76D 3CRRA 1OCCC 4OX9O 2EINC 2VQEO 4WBNA 2EIMB 5FLXN 2Q68A 1URFA 3JAMN 1LR1A 2KKWA 3UO2A 2LGWA 5J9PC 4DUYB 5CA1A 5ITZB 4Z2WA 3CE2A 4AI8A 2QEXV 3SPHA 4X1YA 3EVKA 4I0XB
chains in the Genus database with same CATH topology
1ROPA 3ABKB 1OHHG 1H8HG 4QNHB 5DN6G 2WLLA 2WLHA 4P30A 1NVPD 1K3EA 2ITCC 4GX5A 2WPDG 4X89A 2XNDG 5B3SC 4KUMA 1JQ0A 3ETEA 5EC1C 1GO3F 4QPJA 4MTXA 1SESA 3AG3B 5GW7A 2UXXA 4U7OA 3OW2U 1E79G 1R3IC 4DXWA 3LSSA 4MVQA 3IGAC 1F4MA 4R7CA 1ZWIC 1YSCA 2Q6AA 2JEUA 4G27B 4UV8A 1OCRB 4ZKIA 4MS2A 3EFFK 1Y4MA 2H94A 3ZJZA 1V55C 3JD1A 4PA4A 5C93A 3UKMA 5IYCO 4BAYA 1AI7A 4JASA 1VQLV 3NXSA 3D36A 3AG2B 3LSQA 1JCHA 1BHAA 2BOBC 4JYCA 3T4ZA 2Z3YA 1AROP 4JTDB 5L3EA 3KG2A 1CPYA 2KB1A 1BHBA 1K33A 2Z5UA 2WLJA 3AG1B 4HAMA 2PI5A 3W7XA 1R6NA 2HKOA 3K0DA 4QPKA 2EIKB 3CCRV 3WFVA 4XDLA 4UUJC 5H9CA 3UM7A 1RM1C 1M56B 4RUFA 1RPOA 4RQFA 5B1BB 1RPRA 4PA9A 1YHQV 3OM3B 4JTAB 1QBZA 1DTOA 4MT8A 4MVSA 5EBMC 4XDKA 3F7VC 3G4SV 1H8EG 4HYOA 1YIJV 1VQMV 1OCZB 1FFTB 1QLEC 2JK5C 2EIMC 3ABUA 2DW4A 4N21A 4BW5A 5LHIA 1N8RW 2XASA 1G4YB 4ASUG 3JD3A 3K3WA 5KA6A 3OR6C 2JIZG 5CA3A 2IJKA 1KECA 4LBEC 1R73A 2QM7A 4UVCA 2R9RB 4X8AA 1TUEB 3B8NA 3M99B 5B1NA 3RW0A 3FYEB 3HPLC 1R3JC 4PELA 2GSMB 3K06A 1PD3A 2JJ1G 3RBZA 3W7UA 2UXNA 3OR7C 2P6JA 1KQSU 1VQ6V 1VQNV 1MG1A 4Q20A 2X7RB 3ABLB 3CCVV 3ABKC 4QIWF 1FS0G 5BZBA 3K9AA 1NH2B 3E2EA 4FMTA 3I55V 3TK1A 3ZRSA 5LGTA 4BIUA 3ZN1A 2XAQA 4UXNA 3D3IA 5IYDO 4WFHA 1MOFA 3CMAV 3AG3C 3CCSV 1F4NA 3MD0A 1K7DA 3T1CA 3LDDA 3AG4B 1LNQA 1BL8A 2C2AA 4WFGA 1AJQA 2GHYA 1EFRG 4L87A 1OCRC 5CBGA 2EIJB 1GK9A 2V1DA 4MVRA 4RO2A 3STLC 3WG7B 2YEVA 4BIZA 1AI6A 4R8CA 3SJQC 1HWYA 2V7QG 1S77D 2CK3G 2QM8A 2ZQMA 4FPPA 4Z1MG 3CCLV 3SYAA 2ITDC 4GX0A 3QNEA 3AG2C 3ML0A 4GX1A 2R9IA 3ZMVA 3ASNB 3FB8C 2NNUA 4QE7A 1F51A 1P7BA 5CMUA 3OEEG 3AG1C 4G2KA 1OCOB 2FTKA 3QO5A 3OFNG 1JPXA 4PDVA 2ZXWC 5IYBO 3CCEV 3JD0A 1R3LC 2BOCC 4MTOA 2W6IG 1AJNA 2EIKC 3ABTA 5L3BA 5H6QA 1M56C 1VQ4V 2AHYA 2B1GA 4FK5C 5B1BC 4PA3A 3STZC 4PDRA 1I5YA 3P32A 5EBWC 3ZMUA 4PDLA 2Y48A 1B6QA 2WLNA 2ZD9A 2D3OW 4FIPC 4LCUC 1OCZC 1YJWV 2OTLV 4J9ZB 3SYCA 4TT3G 3K79A 3OUSA 2P67A 3FB6C 4FJCC 5IY5B 1SETA 1OCCB 4DO2A 2WAMA 3K03A 3E8HA 4MVOA 5E1AC 3JD4A 2OTJV 2IH1C 1COWG 2XAJA 5EC2C 2HR3A 1YI2V 3CCJV 4P9OA 4GCZA 2IJHA 3BY6A 4X88A 2W0FC 1VQ7V 3OE7G 4HZ3A 2X6AA 5KA5A 3E8BA 3RVZA 1WLEA 3ABLC 1IXMA 3E89A 2IW5A 1AI5A 2H8PC 3OMNB 2Y69C 1F23A 1YITV 3ZMSA 2Q67A 2M7WA 2ZR2A 1MABG 1L1FA 5L3CA 3F5WC 3OMIB 2LFSA 3RVYA 3ZRVA 1THZA 1H38A 3CMEV 1QLNA 1JX9A 4R50A 1W0JG 2ATKC 1AI4A 4LP8A 1W0KG 3G6EV 2NLJC 3AG4C 3FB7C 3W7WA 4KFMA 3DGEA 1VQ9V 3LDEA 1NR7A 3OGCC 4I5SA 5B1OA 3FB5C 2JJ2G 1M9NA 4UVAA 2WWWA 2EZPA 1ENVA 2EIJC 3CC7V 4MTFA 2EILB 3WG7C 1S72V 1H2GA 5IDJA 3CCQV 1K9MW 3GWOA 4E2LA 3SPGA 3E35A 5B1AB 2A9HA 1PNMA 5CN0A 1VQ5V 3ZCCA 1K4CC 2EJRA 3MHSC 4MVMA 1WPXA 2LFRA 3ASNC 3X2QB 1V55B 4RUEA 2HFEC 2IJJA 2JEXA 5L3DA 3LUTB 4U7NA 4H33A 1PNLA 1OCOC 4XDJA 1K5SA 2XAFA 4KP4A 1QCEA 3OEHG 2DWEC 3VBBA 3LNMB 2P90A 1BMFG 4N23A 1AJPA 4OXSA 4P2ZA 3CYOA 4JAVA 3IFXA 3CCMV 2QE7G 4MW3A 4EKWA 1ORQC 3QO8A 1JVMA 3K08A 3R65A 4RQEA 3BEHA 3K0GA 5LHHA 3LDCA 3CD6V 2JDIG 2X6BA 1GM9A 3P30A 1VQOV 3SYQA 1PNKA 2F43G 1NVPB 2HVKC 1R3KC 3ZIAG 3DTUB 1Q82W 3SPCA 1FXKB 4R6ZA 5L3FA 1YJ9V 2DQ0A 1QVFU 4JTCB 1KP2A 2Q69A 3A0RA 2W6JG 5IY5C 4XBFA 3E8GA 4JGSA 3CCUV 5EBLC 4I9WA 4QE9A 4MW8A 4WFEA 5LGUA 5KUKA 1JJ2U 1NKDA 3GB7C 3H01A 2DYSB 3AEIA 2LP7A 3ZMZA 1NH2D 1SZTA 2IH3C 4PDMA 4MVUA 3CC2V 5FL7G 1OZ0A 3CPWU 1QR9A 3JYCA 3PJSK 1K97A 2WLIB 3JD2A 1QR8A 2X0LA 3B77A 2QA4V 1DF4A 3ETGA 3OUFA 4CBCA 3ABMB 4JAUA 4TWKA 2P7TC 1FXHA 4RAIA 4P9PA 4CZZA 2HJFC 1J95A 3IC7A 1FXKA 1GKFA 1K4DC 5LHGA 1NQTA 1GMGA 5H6RA 4LC1A 2IU3A 2WLKA 2OCCB 1FXVA 3SYOA 1M57B 1MSWD 1VQKV 1S3JA 1KP3A 4F4LA 3CP1A 1DF5A 2B1IA 3SPJA 2EILC 3JCZA 4WF9V 2EINB 3E83A 2HVJC 2XAGA 1NBMG 3T2MA 3MHHC 1SERA 4WFFA 1EZJA 5B1AC 2WLIA 2XOKG 3ASOB 3CXCU 3I56V 2DYRB 1KC8W 2ZDIC 1NJIW 3X2QC 3W7TA 2AHZA 2QTOA 1Q86W 1V54B 1DLBA 2IJIA 1CEZA 1Y66A 1SRYA 2EBOA 1K8AW 2DQ3A 3VOUA 1K73W 4MVZA 1XL4A 4ZBMA 5CBHA 4J9YB 2IU0A 3F7YC 3SYPA 3T4DA 1GTOA 1E1RG 2XAHA 1S5HC 3SPIA 2ZXWB 4YXWG 1JOYA 5B3SB 4UVBA 2EZOA 3G71V 4H37A 4WFBV 5DM6V 2X6CA 4GX2A 3CC4V 1FXKC 1R6KA 3K04A 1P4RA 4WFAV 2HG5C 5CBFA 3ZN0A 1M90W 1W2BU 3B8MA 2OT5A 3E8FA 1AR1B 1EBOA 1VQPV 1Q81W 1VQ8V 4GT1A 3ETDA 1QVGU 1YTFB 2PI4A 2DYSC 2B5UA 1E1QG 2WLMA 3ZRXA 2WSSG 3ZRWB 3HB3B 2MK3A 2QKSA 4PA6A 3W7SA 4PA7A 2K1EA 1M1KW 5LGNA 4JPRA 1NR1A 4G28B 3ABMC 4TSFG 2A79B 4JF3A 1GM7A 1K92A 2YEVB 2ZR3A 3E86A 3OAAG 4WCEV 3ZMTA 2Y69B 1KD1W 1RM1B 3FYIB 2OCCC 1KKDA 1PKXA 1I5XA 5EK0A 1M57C 3TCUA 5HFLA 3TETA 5LBQA 1S0VA 2ZDIA 2WLLB 3EHBB 1S76D 1OCCC 1XL6A 1Q7YW 5KUMA 3FKSG 2DWDC 2EINC 3ZRWA 3QO7A 1QLEB 2EIMB 1YTFD 3ASOC 1YJNV 2A0LA 2Q68A 4QJFB 4JYBA 1CP9A 2DYRC 5J9PC 1GM8A 1G8MA 4MTGA 1UJWB 4MSWC 4UV9A 1V54C 2QEXV 5L3GA 1PL0A 3SPHA 5HFMA 1K34A 2YSUB 3OMAB 2HLDG 1K5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1C A;  3X2Q C;  2AHZ A;  2QTO A;  4QNH B;  3LDD A;  2WLL A;  2WLH A;  4P30 A;  1LNQ A;  1BL8 A;  2ITC C;  3SPG A;  4GX5 A;  4WFG A;  2A9H A;  4X89 A;  5B3S C;  1K4C C;  1OCR C;  5CBG A;  5EC1 C;  3VOU A;  4MVM A;  4MVZ A;  1XL4 A;  4MVR A;  4RO2 A;  4ZBM A;  3STL C;  5CBH A;  3ASN C;  4J9Y B;  2YEV A;  4RUE A;  3F7Y C;  2HFE C;  4R8C A;  1R3I C;  3SYP A;  3LUT B;  3SJQ C;  4H33 A;  3T4D A;  4DXW A;  1S5H C;  1OCO C;  4MVQ A;  4XDJ A;  3IGA C;  4R7C A;  3SPI A;  1ZWI C;  2Q6A A;  3SYA A;  2DWE C;  2ITD C;  4G27 B;  4GX0 A;  4H37 A;  3LNM B;  4MS2 A;  3AG2 C;  3EFF K;  4GX1 A;  4OXS A;  4P2Z A;  2X6C A;  3IFX A;  4GX2 A;  3FB8 C;  4MW3 A;  4QE7 A;  3ZJZ A;  1V55 C;  4PA4 A;  4EKW A;  3K04 A;  1P7B A;  1ORQ C;  3R65 A;  1JVM A;  3AG1 C;  3K08 A;  3BEH A;  2HG5 C;  3K0G A;  3LDC A;  4PDV A;  3UKM A;  5CBF A;  2ZXW C;  2X6B A;  1R3L C;  3E8F A;  2BOC C;  4MTO A;  3SYQ A;  2BOB C;  2EIK C;  3T4Z A;  2HVK C;  1R3K C;  4JTD B;  1M56 C;  3KG2 A;  3SPC A;  4R6Z A;  2AHY A;  2KB1 A;  2DYS C;  4JTC B;  5B1B C;  2WLJ A;  2WLM A;  2Q69 A;  4PA3 A;  3STZ C;  5IY5 C;  3E8G A;  4PDR A;  4PA6 A;  2QKS A;  3K0D A;  4PA7 A;  5EBL C;  4I9W A;  4QE9 A;  2K1E A;  4XDL A;  4UUJ C;  5EBW C;  4MW8 A;  4PDL A;  3UM7 A;  4WFE A;  2WLN A;  2ZD9 A;  4G28 B;  3ABM C;  5KUK A;  4LCU C;  2A79 B;  1OCZ C;  4RUF A;  4J9Z B;  3GB7 C;  3SYC A;  3OUS A;  4PA9 A;  3E86 A;  3FB6 C;  2IH3 C;  4PDM A;  4MVU A;  4JTA B;  3JYC A;  3K03 A;  3E8H A;  3PJS K;  4MVS A;  2WLI B;  4MVO A;  3F7V C;  4XDK A;  5E1A C;  5EBM C;  2IH1 C;  4HYO A;  4CBC A;  2OCC C;  3OUF A;  1KKD A;  5EC2 C;  5EK0 A;  1QLE C;  2JK5 C;  1M57 C;  2EIM C;  2P7T C;  4P9O A;  4RAI A;  4P9P A;  4TWK A;  3TCU A;  4BW5 A;  4X88 A;  3TET A;  2HJF C;  2W0F C;  4HZ3 A;  1G4Y B;  1J95 A;  2X6A A;  2WLL B;  3OR6 C;  3E8B A;  1K4D C;  3RVZ A;  1OCC C;  3ABL C;  4LBE C;  1XL6 A;  3E89 A;  5KUM A;  2R9R B;  2DWD C;  2EIN C;  2H8P C;  2WLK A;  2Y69 C;  4X8A A;  3SYO A;  3RW0 A;  2Q67 A;  3HPL C;  1R3J C;  3ASO C;  2A0L A;  2Q68 A;  3K06 A;  3RBZ A;  3F5W C;  3OR7 C;  3RVY A;  2DYR C;  4F4L A;  3SPJ A;  2EIL C;  4R50 A;  5J9P C;  4MTG A;  2ATK C;  3ABK C;  3E83 A;  2HVJ C;  4LP8 A;  4MSW C;  5BZB A;  3T2M A;  1V54 C;  2NLJ C;  3AG4 C;  3FB7 C;  4KFM A;  4WFF A;  3LDE A;  3OGC C;  5B1A C;  2WLI A;  3ZRS A;  3FB5 C;  3SPH A;  2EIJ C;  4WFH A;  4MTF A;  3AG3 C;  3WG7 C; 
#chains in the Genus database with same CATH topology
 3K9S A;  4J41 A;  4B3S O;  1OHH G;  1IVS A;  1H8H G;  1IBM O;  4P30 A;  1NVP D;  3A0H Z;  5B3S C;  1SC5 B;  4KUM A;  1L8D A;  4TV8 B;  3N27 A;  3OTO B;  3UO3 A;  4K3A A;  1E79 G;  3ZHQ A;  5ITZ A;  4G27 B;  1N36 O;  3EFF K;  4JI3 O;  3MDS A;  1KYO F;  5CB4 A;  2FL4 A;  1D5A A;  4I0X A;  2DOS A;  4BAY A;  4X65 B;  3RYF B;  4LWS B;  3T4Z A;  1GH6 A;  3ZHT A;  3U11 A;  5KHI A;  1BHB A;  2Z5U A;  3L75 H;  2QM4 A;  4TV8 A;  4HAM A;  2PI5 A;  1O9H A;  4TV9 A;  1R6N A;  1WAZ A;  3J7A U;  4QPK A;  3DC6 A;  3UM7 A;  1RM1 C;  2RQ6 A;  4RUF A;  1RPO A;  4RQF A;  5B1B B;  4NXM O;  4PA9 A;  2YC0 A;  4DV4 B;  4DR5 B;  2RNB A;  4MT8 A;  4MVS A;  4F6R B;  1YIJ V;  5J2T B;  5JJN B;  2F1M A;  3ABU A;  3H1J H;  3P3P A;  2LGQ A;  3JAL B;  2DW4 A;  4JZG A;  4IYH A;  3RYF A;  5LHI A;  4LF9 O;  4IT5 A;  1RSO B;  4LWS A;  4O4H B;  3C90 A;  5CA3 A;  1X59 A;  4UVC A;  2R9R B;  4FLY A;  4DR3 O;  4X8A A;  1YF2 A;  1BQZ A;  3M99 B;  5B1N A;  4LF8 O;  3FYE B;  2JJ1 G;  3W7U A;  1VQ6 V;  4LF4 O;  2X7R B;  3CCV V;  1KKC A;  4QIW F;  3CEI A;  3VQV A;  1M4U A;  2N74 A;  3TK1 A;  3ZRS A;  2ADQ B;  2BSK B;  3SDL A;  4WFH A;  4DR4 O;  3JAL A;  1F4N A;  1RSO A;  3T1C A;  1Q6I A;  2UXB B;  2CH7 B;  4JAA A;  1IX9 A;  3BPZ A;  3WG7 B;  4RO2 A;  5K1P A;  2YEV A;  4BIZ A;  2AZ2 A;  5BR8 B;  1I94 O;  1BSM A;  2HJD A;  3U0Z A;  2ZIM A;  5D5Q A;  3QNE A;  2ZE5 A;  3ZMV A;  3ASN B;  3WU2 Z;  4B7K A;  2BSK A;  2QDO A;  1F51 A;  5CMU A;  3AG1 C;  2FTK A;  4PDV A;  3CCE V;  5IYB O;  1MNG A;  3JD0 A;  1IXB A;  2CH7 A;  4FFB B;  4YHH O;  2OWO A;  1VQ4 V;  2B1G A;  1PM9 A;  2YXL A;  1IBK O;  4DR7 B;  4E4E A;  3P32 A;  4X62 O;  4LF5 O;  4O4I A;  5LMU O;  2CUG A;  4EFB A;  2Y48 A;  1B6Q A;  2ZD9 A;  2EX3 A;  4FIP C;  1XMQ B;  2OTL V;  4TOI A;  1SQP H;  3SYC A;  1YEW A;  3HKD B;  4D6T H;  5FPO A;  4K8X A;  3Q4H B;  4X1I B;  3C3S A;  4FJC C;  1SET A;  3T1H B;  3K03 A;  3E8H A;  5K1X A;  3JD4 A;  2OTJ V;  2IH1 C;  3G80 A;  4H13 B;  2Y4T A;  4P9O A;  1JR9 A;  4FFB A;  3OE7 G;  4HZ3 A;  2ZT9 B;  3RVZ A;  3E89 A;  1AI5 A;  3C3T A;  1GN6 A;  5EIB D;  2ZR2 A;  1MAB G;  2LFS A;  3T1Y O;  1THZ A;  1QLN A;  2QWN B;  3Q4H A;  2F4V B;  1AI4 A;  1W0K G;  2NLJ C;  3SR2 C;  1NR7 A;  2YXY A;  1M9N A;  2LW7 A;  2WWW A;  4UVA A;  2EIL B;  2WA4 A;  4UFZ A;  3CCQ V;  3SPG A;  2R70 A;  4FZ1 A;  1PNM A;  5CN0 A;  2QJ1 A;  1HW7 A;  3ZCC A;  2FML A;  5DED A;  1K4C C;  1IBM B;  3MHS C;  4I55 A;  4LH7 A;  4OPH A;  5LA6 B;  1Q8I A;  4U7N A;  4H33 A;  5B5E Z;  1ZTE A;  3DC5 A;  4I9Q A;  4XDJ A;  5EZY B;  2XAF A;  4KP4 A;  1QCE A;  3N2K A;  2P90 A;  4JI2 B;  3TXQ A;  1AJP A;  1L0L H;  2O57 A;  3R65 A;  1ORQ C;  1JVM A;  3K08 A;  4RQE A;  2UUA O;  5LHH A;  4B3T B;  2BCC H;  1GM9 A;  1Z5W A;  3K57 A;  4LFC O;  2F43 G;  4Q6G A;  4GUN A;  1Q82 W;  3SPC A;  2DQ0 A;  4JTC B;  1KP2 A;  4FFK A;  2W6J G;  5IY5 C;  4XBF A;  3WB1 A;  2P06 A;  5LA6 A;  1MSD A;  5EBL C;  3APO A;  1HNZ O;  4DV3 O;  1V9P A;  4O2B B;  3CC2 V;  5FL7 G;  4GYC B;  3JD2 A;  3B77 A;  4U3J A;  3OUF A;  4JV5 B;  2HJF C;  3HKB B;  1J95 A;  5LHG A;  5H6R A;  1TAE A;  5C8Y B;  1NTZ H;  2OCC B;  1XHX A;  2ZIN A;  1VQK V;  4FLZ A;  3CP1 A;  1DF5 A;  1JFF B;  4LF8 B;  3KCY A;  4DV0 O;  4O2B A;  3E83 A;  3RYH B;  3E22 B;  4FLT A;  3CS5 A;  4BIO A;  1Q6U A;  5IE9 A;  3CXC U;  1IDS A;  1Q86 W;  1V54 B;  3KCX A;  1DLB A;  1A32 A;  1Y66 A;  1M93 A;  3THO A;  1SRY A;  2YIA A;  5C8Y A;  1NT2 B;  1BCC H;  1K73 W;  2Q7G A;  3CXH F;  2VS0 A;  3ZHU A;  3AK1 A;  1E1R G;  3SPI A;  2Q5Z A;  1ZSP A;  4EEQ A;  4JI4 B;  1Q3E A;  2GTS A;  1EN4 A;  3O65 A;  1I94 B;  4GX2 A;  3CC4 V;  1HNW O;  1PPJ H;  3K04 A;  1P4R A;  1M90 W;  3F5T A;  3J81 N;  3B8M A;  3E8F A;  1GN3 A;  1AR1 B;  2GBO A;  2KQX A;  1BGY H;  1EBO A;  3JSN A;  2UXD B;  1VQ8 V;  2HHH O;  2RJZ A;  4DV2 O;  1P7G A;  2YI9 A;  4IIJ A;  1E1Q G;  1VIB A;  3CRM A;  3HB3 B;  2QKS A;  3VQW A;  2K1E A;  4C7U A;  3BAA A;  1NR1 A;  4LFA O;  4J42 A;  4X62 B;  2ODM A;  2QKC A;  1MZF A;  2ZR3 A;  5LMU B;  1HNX O;  2XUM A;  1KKD A;  1PKX A;  2UU9 B;  1M57 C;  3SJB C;  1F7Y A;  3TET A;  5LBQ A;  4GKK B;  1SQV H;  3CX5 F;  2YUA A;  1Q7Y W;  3JAW B;  2PY5 A;  2L6L A;  1QLE B;  1AR5 A;  1YTF D;  1KUQ A;  2A0L A;  1Z2G A;  4LF6 B;  4MSW C;  4CH5 A;  3T1Y B;  5FPR A;  1PL0 A;  2Q0O C;  2QWP B;  1RP3 B;  4K0K O;  4K35 A;  1K34 A;  2YSU B;  4AQY O;  2W0X A;  2ITC C;  1WA8 A;  2OCH A;  2WPD G;  4JI7 O;  3ETE A;  1GO3 F;  1CXZ B;  2A3Q A;  3AG3 B;  1ZX3 A;  1EN6 A;  4EB6 B;  1GN4 A;  4U7O A;  1H2N A;  2QR4 A;  3GVM A;  4CC5 A;  1Y67 A;  4O4J B;  4DXW A;  4IYI A;  1SQQ H;  3IGA C;  4R7C A;  4TQD A;  1ZWI C;  4JI0 O;  2ZNJ A;  4UV8 A;  2OIG A;  1OCR B;  5KMG B;  2PTM A;  5AG2 A;  3JD1 A;  3N2G B;  4NR1 A;  4PA4 A;  3CSX A;  3L70 H;  1DGS A;  1N34 O;  4JAS A;  3WB0 A;  4UB8 Z;  1JCH A;  1BHA A;  2BOB C;  5J2U B;  4DUZ O;  2Z3Y A;  1ARO P;  5L3E A;  4ZI7 B;  1K33 A;  2G38 A;  2WLJ A;  4DR1 O;  4LFB O;  4O4J A;  3K0D A;  2EIK B;  1GN2 A;  1Y74 A;  1NTM H;  4HNA A;  3H1L H;  4OGQ B;  5KMG A;  3OM3 B;  1QBZ A;  3N2G A;  4B3M O;  1TA8 A;  1VQM V;  4X64 O;  2JK5 C;  2EIM C;  4N21 A;  1G4Y B;  4ASU G;  3GWK C;  3K3W A;  1P49 A;  2IJK A;  4ZI7 A;  4LBE C;  1R73 A;  4X1K B;  1R1B A;  3WB2 A;  3B8N A;  1S5J A;  1Z5V A;  3RW0 A;  2AGA A;  4PEL A;  2Q0A A;  5H5N A;  3OR7 C;  2E5L O;  2A7W A;  2E3C A;  5KHK A;  1FS0 G;  2CGO A;  2XTA A;  3K9A A;  1NH2 B;  3AK2 A;  2XHB A;  1FFX B;  4FMT A;  4JI5 B;  5LGT A;  4J7Z A;  3SGI A;  5BY1 A;  2XAQ A;  4DV0 B;  3D3I A;  5IYD O;  3CMA V;  5EIB C;  3MD0 A;  2D2C B;  1N33 O;  2UUC B;  1MZE A;  2GHY A;  4X1K A;  4CS3 A;  2PZS A;  1GK9 A;  4MVR A;  3STL C;  4PV1 B;  3SJQ C;  5KHH A;  1HWY A;  2V7Q G;  1S77 D;  2QM8 A;  2ZQM A;  4Z1M G;  2ZE7 A;  3CCL V;  3SYA A;  4LF7 O;  3L74 H;  1FFX A;  2R9I A;  4NB5 A;  4QE7 A;  4DR2 B;  4DV6 B;  3OEE G;  4G2K A;  5KHJ A;  1JMK C;  3OFN G;  2ZXW C;  1R3L C;  3IAY A;  4FLW A;  2W6I G;  1J5E O;  1AJN A;  3ABT A;  3DXR B;  3PN1 A;  4NXN O;  1IBL O;  5B1B C;  1TVK B;  2HHH B;  4PDR A;  4UCV A;  5JWP A;  4DV2 B;  1FD9 A;  2Q73 A;  1H2K A;  4L8J A;  5IYZ B;  5JCO C;  1YJW V;  5JJJ B;  4TT3 G;  3K79 A;  2OIE A;  2P67 A;  5KAI Z;  2CE4 A;  1OCC B;  4DO2 A;  1TUB B;  1DK1 A;  2XAJ A;  1YXB A;  5EC2 C;  1YI2 V;  4GKJ O;  2IJH A;  3DXR A;  4X88 A;  2X6A A;  2CDY A;  1HDJ A;  3E8B A;  5JVD B;  1AVM A;  2FB5 A;  3ZMS A;  1FAF A;  1L1F A;  3F5W C;  3BA8 A;  3OMI B;  4FM1 A;  5IYZ A;  3TGU H;  1W0J G;  4X20 B;  3JAR B;  4ZOL B;  3W7W A;  3FB7 C;  4KFM A;  3DGE A;  1VQ9 V;  3FB5 C;  2EZP A;  4BWA A;  4UCR A;  2AW9 A;  1EM1 A;  3WG7 C;  4K0K B;  3GWO A;  5JVD A;  2A9H A;  2RCV A;  3BCC H;  3H1K H;  2EJR A;  4DK0 A;  4AQY B;  3ASN C;  4JI7 B;  1O9G A;  1PNL A;  1T5E A;  4X20 A;  3OD4 A;  4ZOL A;  2ZE6 A;  4F6R A;  3LNM B;  1BMF G;  2CTW A;  5J2T A;  5JCO A;  4OXS A;  3B2E E;  4P2Z A;  4JAV A;  4D7T A;  4UCS A;  1HR0 O;  1Q90 D;  4O4H A;  3QO8 A;  3K0G A;  3JAS B;  2JDI G;  1WPB A;  1FJG O;  3P30 A;  2KG7 B;  3SYQ A;  2HVK C;  2P4K A;  1N34 B;  1R3K C;  4NTY A;  4JYA B;  5L3F A;  5IJ0 B;  4DUZ B;  2IBZ H;  3RYC B;  3CCU V;  4DR1 B;  4QE9 A;  2ZM6 B;  5LGU A;  4LFB B;  5KUK A;  4J11 A;  1NKD A;  3GB7 C;  1Y76 B;  4O2A B;  5JH7 B;  1NH2 D;  1SZT A;  2IH3 C;  2P4V A;  1QR9 A;  3JYC A;  3PJS K;  2WLI B;  3JAS A;  3ABM B;  4JAU A;  1Q6H A;  3QG5 A;  1FXH A;  4RAI A;  1D5N A;  1SKV A;  4CZZ A;  1BQ0 A;  5IT9 N;  3IC7 A;  1K4D C;  1B04 A;  1GMG A;  5DEC A;  4ZHQ B;  2YIC A;  2PF4 E;  2FYU H;  4B3R B;  3RN4 A;  2B1I A;  2EIL C;  4DK1 A;  3JCZ A;  4WF9 V;  2RN9 A;  5JH7 A;  2MW2 B;  1NBM G;  2E5L B;  1N0N A;  5H2F Z;  3CRC A;  1SER A;  2WLI A;  3ASO B;  3OTF A;  4J7K A;  4PJ0 Z;  2DYR B;  1L0N H;  2ZDI C;  4TQF A;  2P5O A;  2IJI A;  1CEZ A;  5CA0 B;  4OX9 B;  1N33 B;  1NZ6 A;  5TIS Z;  1SZX A;  5LMN O;  2VQE B;  5CBH A;  3HKD A;  4J9Y B;  4J7J A;  4X1I A;  3SYP A;  1GTO A;  2XAH A;  1WN7 A;  1B3Q A;  1XEQ A;  4UVB A;  3G71 V;  3APQ A;  1H2M A;  2X6C A;  2K9P A;  2R72 A;  1R6K A;  4LF7 B;  2NN4 A;  2HG5 C;  5CBF A;  4B3S B;  2OT5 A;  1VQP V;  1SS3 A;  5CA0 A;  4GT1 A;  5LL6 Y;  1I7F A;  1YTF B;  1XDC A;  2B5U A;  1ZL8 B;  2F95 B;  2JGD B;  3W7S A;  3I5D A;  4PA7 A;  3K58 A;  2DN9 A;  4JPR A;  2JS5 A;  4G28 B;  1N36 B;  1I08 A;  4I7Z B;  3CWB H;  3K5M A;  1GM7 A;  4JI3 B;  1IUR A;  3FX7 A;  3ZMT A;  4FM2 A;  2OCC C;  2WA3 A;  1JA8 A;  3OGI B;  2ZDI A;  2WLL B;  3EHB B;  2DWD C;  5EZY A;  1YJN V;  4QJF B;  1ZAU A;  2UXC O;  3CRA A;  3A2F A;  5A2Q N;  4UB6 Z;  1G8M A;  4NXM B;  1UJW B;  1V54 C;  3RYI B;  5L3G A;  4UCU A;  5HFM A;  3OMA B;  2HLD G;  4LF9 B;  3CHX A;  1ROP A;  3ABK B;  3H9V A;  4QNH B;  2WLL A;  3S3W A;  2E76 B;  4GX5 A;  1H2S B;  1QNM A;  2XND G;  1FYJ A;  4DR3 B;  5EC1 C;  3UQ8 A;  4FLV A;  4CH6 A;  1SES A;  4I50 B;  1WJZ A;  2UXX A;  3LNN A;  2N04 A;  4LF4 B;  1XHZ A;  3LSS A;  1YSC A;  4ZKI A;  4MS2 A;  3RYI A;  2YI8 A;  3ICX A;  1V55 C;  3HKB A;  1XOU A;  2JRI A;  2CTQ A;  4DR4 B;  3UKM A;  1AI7 A;  1VQL V;  1HR0 B;  3NXS A;  4JI8 O;  3AG2 B;  4JYC A;  4JTD B;  3KG2 A;  4QGP A;  1CPY A;  2KB1 A;  1JFF A;  5GTI Z;  3W7X A;  1SQB H;  3RYH A;  2VRZ A;  3CCR V;  2H3O A;  5H9C A;  3E22 A;  2YS8 A;  1M56 B;  4JYY A;  3VQY A;  1AR4 A;  4DUY O;  3AG7 A;  1WB8 A;  4FVM A;  4JTA B;  1DTO A;  4DV7 O;  5EBM C;  2LJ2 A;  4XDK A;  3F7V C;  1H8E G;  3ZED A;  1ZUQ A;  1OCZ B;  1FFT B;  1QLE C;  4BW5 A;  3B40 A;  3JD3 A;  4YHH B;  4FM0 A;  4IL6 Z;  2YXH A;  1KEC A;  2QM7 A;  1TUE B;  1IBK B;  1R3J C;  4LF5 B;  3OTO O;  5LXT B;  2UXN A;  1KQS U;  2P6J A;  1VQN V;  4Q20 A;  3HKE B;  3K59 A;  3ABL B;  3H1I H;  3HR0 A;  5BZB A;  3E2E A;  1EZV H;  3I55 V;  4BIU A;  1PV0 A;  3JAT B;  4D7S A;  4F6E A;  2LQT A;  3AG3 C;  4YY3 O;  1X4T A;  3LDD A;  3AG4 B;  1YZB A;  1LUV A;  1BS3 A;  1OCR C;  4YJ3 B;  3K5L A;  2EIJ B;  2CAZ C;  4ICG A;  4DV5 O;  3VQX A;  5LMN B;  4GLX A;  1SQX H;  1WB7 A;  2KSD A;  4FPP A;  4UCT A;  1PP9 H;  4GX1 A;  3FB8 C;  3IC9 A;  3JAT A;  3SJC C;  1OCO B;  1JPX A;  1AP6 A;  2DE0 X;  3JAW A;  4MTO A;  2Y4U A;  2EIK C;  4IGG A;  5L3B A;  1UPG A;  4YJ3 A;  4GZR B;  4FK5 C;  2PYJ A;  2F93 B;  4PA3 A;  1I5Y A;  3ZBH A;  5EBW C;  2DJV A;  1XBL A;  4LCU C;  4J9Z B;  2OYQ A;  3OUS A;  2WAM A;  4H44 B;  4MVO A;  2UUA B;  3NR7 A;  3BAB A;  3K5N A;  4DRX B;  4GCZ A;  3QF7 A;  3BY6 A;  4LFC B;  1G1X B;  4EB6 A;  5KA5 A;  2UXB O;  2F66 C;  4LH6 A;  1N32 O;  3J80 N;  1WLE A;  2R9A A;  1VAR A;  2H8P C;  3OMN B;  2Y69 C;  1F23 A;  4KXR A;  1YIT V;  2Q67 A;  5A9G A;  2M7W A;  4PI0 A;  5L3C A;  1OJH A;  3B4S A;  5BR8 O;  5GON B;  1H38 A;  4R50 A;  1Q5O A;  1HNZ B;  4DV3 B;  4LP8 A;  3G6E V;  1TGO A;  5LP6 B;  2UXC B;  3SJA C;  3OGC C;  4I5S A;  5B1O A;  2JJ2 G;  5J2U A;  3CC7 V;  4MTF A;  1H2G A;  5IDJ A;  4E2L A;  3E35 A;  2VWJ A;  5B1A B;  2V4D A;  4MVM A;  1WPX A;  2LFR A;  4EFE A;  4K8Z A;  4DR7 O;  1PL4 A;  3H1H H;  3X2Q B;  2HFE C;  2IJJ A;  5GON A;  1K5S A;  3OEH G;  2DWE C;  4WBN B;  4N23 A;  3IFX A;  3CCM V;  2QE7 G;  4MW3 A;  4LNU B;  4EKW A;  3T1H O;  4JI1 O;  3BEH A;  2QKA A;  2ILM A;  3LDC A;  2X6B A;  1VQO V;  4DV1 O;  1PNK A;  5GTH Z;  3ZIA G;  1SQG A;  3L71 H;  1FXK B;  4R6Z A;  4LR3 A;  1QVF U;  3BFR A;  3A0R A;  2JVD A;  1VF5 B;  2A06 H;  4I9W A;  1XIL A;  2CTR A;  4MW8 A;  2ZCE A;  4AHC A;  3H01 A;  2DYS B;  1KB9 F;  2F4V O;  3ZMZ A;  4LNU A;  1NS1 A;  1OZ0 A;  3CPW U;  1HNW B;  1K97 A;  2ARH A;  2QA4 V;  1DF4 A;  4CBC A;  2QWR B;  5D5P A;  4DV7 B;  4TWK A;  4P9P A;  5CB4 B;  1W59 A;  1BZK A;  1FXK A;  1GKF A;  1NQT A;  2EJ7 A;  4LC1 A;  2WLK A;  1FXV A;  3BHP A;  1VF6 A;  2LW1 A;  3D3Q A;  4X66 O;  2RMK B;  2VWK A;  1KP3 A;  2GUZ B;  2M6Y A;  3HKC B;  4F4L A;  4LFA B;  3SPJ A;  4ZIB A;  2UUB O;  4IHJ B;  4TV9 B;  2EIN B;  2EUL A;  1HNX B;  5KAF Z;  3T2M A;  4JI2 O;  3MHH C;  4WFF A;  1EZJ A;  2E74 B;  3I56 V;  1IZ3 A;  4JZ2 A;  1KC8 W;  4B3T O;  2YIB A;  1TVK A;  3QVN A;  2QTO A;  3ETQ A;  4YY3 B;  3KZI Z;  2YID A;  2DQ3 A;  1JJO A;  1XL4 A;  4ZBM A;  2GUZ A;  3F7Y C;  3T4D A;  3HKC A;  3KKY A;  1S5H C;  4IHJ A;  2ZXW B;  1TUB A;  4DYL A;  1HP8 A;  5B3S B;  4DV5 B;  2EZO A;  4H37 A;  1S5L Z;  5DM6 V;  2DMX A;  4WFA V;  1GRJ A;  1W2B U;  4JV5 O;  1SA0 B;  2PYL A;  3FAV B;  2VQF O;  3TXS A;  1QVG U;  2GV9 A;  2F23 A;  2PI4 A;  3ZRX A;  2WSS G;  4PHZ A;  3ZRW B;  2MK3 A;  3JAR A;  3ZX6 A;  5LGN A;  2CGN A;  4KHP O;  4AIL C;  3ABM C;  4JI0 B;  1K92 A;  2YEV B;  4PD4 F;  2QGN A;  1RM1 B;  3D36 C;  4W4K A;  1I5X A;  5EK0 A;  1SA0 A;  5EYP B;  2Q8V A;  3AK3 A;  3TCU A;  5HFL A;  3BRC A;  3FAV A;  1S0V A;  5LYJ B;  1AB3 A;  1XL6 A;  5KUM A;  3FKS G;  3ZRW A;  1N32 B;  3QO7 A;  3ASO C;  1RFY A;  4JYB A;  1Q43 A;  2L35 A;  1CP9 A;  2DYR C;  5KHG A;  4NVP A;  1GM8 A;  4MTG A;  3JSL A;  1AP5 A;  4UV9 A;  4JI4 O;  1BE3 H;  4O4I B;  2QSA A;  1WP8 A;  2KG7 A;  4B3M B;  4B7E A;  3FD9 A;  5EYP A;  4X64 B;  3ZHS A;  1K5Q A;  5IJ0 A;  2XT9 A;  3DSQ A;  5DN6 G;  2WLH A;  5LYJ A;  1NI8 A;  1K3E A;  1ZLZ A;  3RYC A;  2UXD O;  3UCS C;  4X89 A;  2ZNI A;  1JQ0 A;  4QPJ A;  4MTX A;  5GW7 A;  1Y76 A;  4I4T B;  4O2A A;  3OW2 U;  1R3I C;  5BXZ A;  4YIP A;  1N0J A;  3RFR A;  4MVQ A;  1F4M A;  2FKX A;  2Q6A A;  2JEU A;  1XNQ O;  1Y4M A;  3D8C A;  2H94 A;  3ZJZ A;  5C93 A;  3ZHV A;  1XUQ A;  3G6B A;  5IYC O;  1YDX A;  2UU9 O;  4ZHQ A;  2YIB D;  3D36 A;  3CJH B;  1XRE A;  3LSQ A;  4JI1 B;  1QQC A;  4GKK O;  1KU9 A;  3A0B Z;  2Q7E A;  4DV1 B;  2BTQ B;  3AG1 B;  4FLX A;  5IJ9 B;  4I4T A;  2PGG A;  2HKO A;  3L73 H;  3WFV A;  4XDL A;  1XQ8 A;  4UUJ C;  3M7M X;  4H0L B;  1OV9 A;  4I55 B;  4LF6 O;  3FFQ A;  5BMV B;  1D2D A;  1RPR A;  1YHQ V;  4FZ0 A;  3N2K B;  3G4S V;  4HYO A;  4TUY B;  4DW0 A;  3CJH A;  1N8R W;  1J5E B;  2XAS A;  5JJE B;  5KA6 A;  3OR6 C;  4NXN B;  4NTX A;  2JIZ G;  2BTQ A;  1AIL A;  1IBL B;  5IJ9 A;  1LUW A;  3JAK B;  4W4L A;  3HPL C;  1GAX A;  2GSM B;  3K06 A;  1PD3 A;  3RBZ A;  3S3X A;  2QWQ B;  1MG1 A;  3M8A A;  5B66 Z;  2IM9 A;  5BMV A;  4X66 B;  3CB2 A;  3ABK C;  2UUB B;  1H2L A;  2P22 C;  3ZN1 A;  4UXN A;  4TUY A;  5FNV B;  4CH3 A;  1MOF A;  2Q9L A;  4CH4 A;  3CCS V;  4DR6 O;  4GKJ B;  1ZL8 A;  1K7D A;  2JGD A;  1LNQ A;  1BL8 A;  4U3J B;  2C2A A;  4WFG A;  1AJQ A;  1EFR G;  2QWO B;  4L87 A;  5CBG A;  3JAK A;  2V1D A;  1U97 A;  5IWA O;  1AI6 A;  4R8C A;  1WP7 A;  3LSU A;  2CK3 G;  2ITD C;  2GDS A;  4GX0 A;  3AG2 C;  3ML0 A;  3K5O A;  2NNU A;  1XI1 A;  5FNV A;  3TJT A;  1NTK H;  1P7B A;  4JI6 O;  1XMO O;  3QO5 A;  4B08 A;  1NU1 H;  2BOC C;  1VEW A;  2QTS A;  5H6Q A;  1M56 C;  2AHY A;  3EXA A;  1YCI A;  3MAQ A;  2ZE8 A;  2VQF B;  3STZ C;  2LO1 A;  3ZMU A;  4PDL A;  2WLN A;  4UCO A;  5F2V O;  3IJ4 A;  2D3O W;  1OCZ C;  1XNR O;  3L72 H;  4BR6 A;  3FB6 C;  4KHP B;  5IY5 B;  4JI5 O;  2ETN A;  5E1A C;  3B09 A;  1COW G;  1KMI Z;  1FJG B;  2HR3 A;  3CCJ V;  4RWU A;  4I50 A;  2W0F C;  1VQ7 V;  2B9Z A;  3A8T A;  1UFI A;  2UUC O;  3ABL C;  1IXM A;  3ZS8 C;  2IW5 A;  4HBN A;  4CC6 A;  5E79 Z;  2JS3 A;  1VMG A;  3RVY A;  4IIJ B;  3ZRV A;  3CME V;  1JX9 A;  2ZIO A;  5KLV H;  1MMM A;  2ATK C;  3AG4 C;  4KL1 A;  3LDE A;  4OPA A;  4DR2 O;  2ZKO A;  4DV6 O;  1ENV A;  2EIJ C;  1S72 V;  1K9M W;  1U96 A;  1FPO A;  2JGU A;  1VQ5 V;  1V55 B;  4RUE A;  2JEX A;  5L3D A;  3LUT B;  2BTO A;  3P3N A;  1OCO C;  2AZ0 A;  3BA9 A;  3VBB A;  4CS4 A;  1SF9 A;  2ADP A;  2Q4P A;  3CYO A;  4YIO A;  4J10 A;  1XNQ B;  3ZHR A;  4X65 O;  1M5I A;  3BVO A;  1YVW A;  2Q7H A;  3CD6 V;  2E75 B;  2YDE A;  1P84 F;  1NVP B;  1FKA O;  2NR5 A;  3DTU B;  1QHT A;  5LXT A;  1YJ9 V;  2Q69 A;  3HKE A;  2Y0P A;  4U3F H;  2Z0A A;  5KX5 B;  3E8G A;  3JCU Z;  4JGS A;  1WA8 B;  4CS2 A;  3CRQ A;  4FLU A;  1N4C A;  4O4L B;  4WFE A;  4DV4 O;  4DR5 O;  4YJ2 B;  1JJ2 U;  3AEI A;  2LP7 A;  2RDC A;  4PDM A;  4MVU A;  1VF7 A;  3R66 A;  2GTA A;  1QR8 A;  2X0L A;  3OT7 A;  3ETG A;  2BE3 A;  2P7T C;  4NTW A;  2PUS A;  2IU3 A;  5KX5 A;  5LP6 C;  3SYO A;  1M57 B;  1VP7 A;  1MSW D;  1WNS A;  4O4L A;  1S3J A;  4BW9 A;  4YJ2 A;  3QTC A;  2Y0I A;  4ABM A;  2HVJ C;  2XAG A;  2AXT Z;  5B1A C;  1Y74 B;  2XOK G;  4HNA B;  2CTP A;  3RWR D;  1NJI W;  3X2Q C;  3W7T A;  2AHZ A;  1EN5 A;  4DR6 B;  2EBO A;  3RGB A;  4JYA O;  1K8A W;  4PI2 A;  3VOU A;  3G67 A;  1R6T A;  4MVZ A;  2IU0 A;  3UT5 B;  1Y6X A;  1I0H A;  4YXW G;  1JOY A;  4X9Q A;  2ZM6 O;  5IWA B;  1QU7 A;  3L9D A;  4WFB V;  5LOV B;  4DRX A;  1BT8 A;  1FXK C;  5JQG B;  1SQF A;  3ZN0 A;  3RT3 C;  4NYK A;  4Z1V A;  1KBH A;  4JI6 B;  1VF6 C;  1XMO B;  1Q81 W;  3ETD A;  1MA1 A;  2DYS C;  4NKG B;  2WLM A;  1US6 A;  4PA6 A;  2HEP A;  1XMQ O;  3UT5 A;  4A5U B;  5LP6 A;  4B3R O;  1M1K W;  4J80 A;  3O9O A;  4TSF G;  2A79 B;  5LOV A;  4JF3 A;  5CA1 B;  3E86 A;  2N05 A;  3OAA G;  4WCE V;  1XNR B;  5JQG A;  2HP8 A;  2Y69 B;  4X1Y B;  1KD1 W;  1B06 A;  3FYI B;  4DW1 A;  4JI8 B;  3U10 A;  1G6U A;  1S76 D;  3CRR A;  1OCC C;  4OX9 O;  2EIN C;  2VQE O;  4WBN A;  2EIM B;  5FLX N;  2Q68 A;  1URF A;  3JAM N;  1LR1 A;  2KKW A;  3UO2 A;  2LGW A;  5J9P C;  4DUY B;  5CA1 A;  5ITZ B;  4Z2W A;  3CE2 A;  4AI8 A;  2QEX V;  3SPH A;  4X1Y A;  3EVK A;  4I0X B; 
#chains in the Genus database with same CATH homology
 1ROP A;  3ABK B;  1OHH G;  1H8H G;  4QNH B;  5DN6 G;  2WLL A;  2WLH A;  4P30 A;  1NVP D;  1K3E A;  2ITC C;  4GX5 A;  2WPD G;  4X89 A;  2XND G;  5B3S C;  4KUM A;  1JQ0 A;  3ETE A;  5EC1 C;  1GO3 F;  4QPJ A;  4MTX A;  1SES A;  3AG3 B;  5GW7 A;  2UXX A;  4U7O A;  3OW2 U;  1E79 G;  1R3I C;  4DXW A;  3LSS A;  4MVQ A;  3IGA C;  1F4M A;  4R7C A;  1ZWI C;  1YSC A;  2Q6A A;  2JEU A;  4G27 B;  4UV8 A;  1OCR B;  4ZKI A;  4MS2 A;  3EFF K;  1Y4M A;  2H94 A;  3ZJZ A;  1V55 C;  3JD1 A;  4PA4 A;  5C93 A;  3UKM A;  5IYC O;  4BAY A;  1AI7 A;  4JAS A;  1VQL V;  3NXS A;  3D36 A;  3AG2 B;  3LSQ A;  1JCH A;  1BHA A;  2BOB C;  4JYC A;  3T4Z A;  2Z3Y A;  1ARO P;  4JTD B;  5L3E A;  3KG2 A;  1CPY A;  2KB1 A;  1BHB A;  1K33 A;  2Z5U A;  2WLJ A;  3AG1 B;  4HAM A;  2PI5 A;  3W7X A;  1R6N A;  2HKO A;  3K0D A;  4QPK A;  2EIK B;  3CCR V;  3WFV A;  4XDL A;  4UUJ C;  5H9C A;  3UM7 A;  1RM1 C;  1M56 B;  4RUF A;  1RPO A;  4RQF A;  5B1B B;  1RPR A;  4PA9 A;  1YHQ V;  3OM3 B;  4JTA B;  1QBZ A;  1DTO A;  4MT8 A;  4MVS A;  5EBM C;  4XDK A;  3F7V C;  3G4S V;  1H8E G;  4HYO A;  1YIJ V;  1VQM V;  1OCZ B;  1FFT B;  1QLE C;  2JK5 C;  2EIM C;  3ABU A;  2DW4 A;  4N21 A;  4BW5 A;  5LHI A;  1N8R W;  2XAS A;  1G4Y B;  4ASU G;  3JD3 A;  3K3W A;  5KA6 A;  3OR6 C;  2JIZ G;  5CA3 A;  2IJK A;  1KEC A;  4LBE C;  1R73 A;  2QM7 A;  4UVC A;  2R9R B;  4X8A A;  1TUE B;  3B8N A;  3M99 B;  5B1N A;  3RW0 A;  3FYE B;  3HPL C;  1R3J C;  4PEL A;  2GSM B;  3K06 A;  1PD3 A;  2JJ1 G;  3RBZ A;  3W7U A;  2UXN A;  3OR7 C;  2P6J A;  1KQS U;  1VQ6 V;  1VQN V;  1MG1 A;  4Q20 A;  2X7R B;  3ABL B;  3CCV V;  3ABK C;  4QIW F;  1FS0 G;  5BZB A;  3K9A A;  1NH2 B;  3E2E A;  4FMT A;  3I55 V;  3TK1 A;  3ZRS A;  5LGT A;  4BIU A;  3ZN1 A;  2XAQ A;  4UXN A;  3D3I A;  5IYD O;  4WFH A;  1MOF A;  3CMA V;  3AG3 C;  3CCS V;  1F4N A;  3MD0 A;  1K7D A;  3T1C A;  3LDD A;  3AG4 B;  1LNQ A;  1BL8 A;  2C2A A;  4WFG A;  1AJQ A;  2GHY A;  1EFR G;  4L87 A;  1OCR C;  5CBG A;  2EIJ B;  1GK9 A;  2V1D A;  4MVR A;  4RO2 A;  3STL C;  3WG7 B;  2YEV A;  4BIZ A;  1AI6 A;  4R8C A;  3SJQ C;  1HWY A;  2V7Q G;  1S77 D;  2CK3 G;  2QM8 A;  2ZQM A;  4FPP A;  4Z1M G;  3CCL V;  3SYA A;  2ITD C;  4GX0 A;  3QNE A;  3AG2 C;  3ML0 A;  4GX1 A;  2R9I A;  3ZMV A;  3ASN B;  3FB8 C;  2NNU A;  4QE7 A;  1F51 A;  1P7B A;  5CMU A;  3OEE G;  3AG1 C;  4G2K A;  1OCO B;  2FTK A;  3QO5 A;  3OFN G;  1JPX A;  4PDV A;  2ZXW C;  5IYB O;  3CCE V;  3JD0 A;  1R3L C;  2BOC C;  4MTO A;  2W6I G;  1AJN A;  2EIK C;  3ABT A;  5L3B A;  5H6Q A;  1M56 C;  1VQ4 V;  2AHY A;  2B1G A;  4FK5 C;  5B1B C;  4PA3 A;  3STZ C;  4PDR A;  1I5Y A;  3P32 A;  5EBW C;  3ZMU A;  4PDL A;  2Y48 A;  1B6Q A;  2WLN A;  2ZD9 A;  2D3O W;  4FIP C;  4LCU C;  1OCZ C;  1YJW V;  2OTL V;  4J9Z B;  3SYC A;  4TT3 G;  3K79 A;  3OUS A;  2P67 A;  3FB6 C;  4FJC C;  5IY5 B;  1SET A;  1OCC B;  4DO2 A;  2WAM A;  3K03 A;  3E8H A;  4MVO A;  5E1A C;  3JD4 A;  2OTJ V;  2IH1 C;  1COW G;  2XAJ A;  5EC2 C;  2HR3 A;  1YI2 V;  3CCJ V;  4P9O A;  4GCZ A;  2IJH A;  3BY6 A;  4X88 A;  2W0F C;  1VQ7 V;  3OE7 G;  4HZ3 A;  2X6A A;  5KA5 A;  3E8B A;  3RVZ A;  1WLE A;  3ABL C;  1IXM A;  3E89 A;  2IW5 A;  1AI5 A;  2H8P C;  3OMN B;  2Y69 C;  1F23 A;  1YIT V;  3ZMS A;  2Q67 A;  2M7W A;  2ZR2 A;  1MAB G;  1L1F A;  5L3C A;  3F5W C;  3OMI B;  2LFS A;  3RVY A;  3ZRV A;  1THZ A;  1H38 A;  3CME V;  1QLN A;  1JX9 A;  4R50 A;  1W0J G;  2ATK C;  1AI4 A;  4LP8 A;  1W0K G;  3G6E V;  2NLJ C;  3AG4 C;  3FB7 C;  3W7W A;  4KFM A;  3DGE A;  1VQ9 V;  3LDE A;  1NR7 A;  3OGC C;  4I5S A;  5B1O A;  3FB5 C;  2JJ2 G;  1M9N A;  4UVA A;  2WWW A;  2EZP A;  1ENV A;  2EIJ C;  3CC7 V;  4MTF A;  2EIL B;  3WG7 C;  1S72 V;  1H2G A;  5IDJ A;  3CCQ V;  1K9M W;  3GWO A;  4E2L A;  3SPG A;  3E35 A;  5B1A B;  2A9H A;  1PNM A;  5CN0 A;  1VQ5 V;  3ZCC A;  1K4C C;  2EJR A;  3MHS C;  4MVM A;  1WPX A;  2LFR A;  3ASN C;  3X2Q B;  1V55 B;  4RUE A;  2HFE C;  2IJJ A;  2JEX A;  5L3D A;  3LUT B;  4U7N A;  4H33 A;  1PNL A;  1OCO C;  4XDJ A;  1K5S A;  2XAF A;  4KP4 A;  1QCE A;  3OEH G;  2DWE C;  3VBB A;  3LNM B;  2P90 A;  1BMF G;  4N23 A;  1AJP A;  4OXS A;  4P2Z A;  3CYO A;  4JAV A;  3IFX A;  3CCM V;  2QE7 G;  4MW3 A;  4EKW A;  1ORQ C;  3QO8 A;  1JVM A;  3K08 A;  3R65 A;  4RQE A;  3BEH A;  3K0G A;  5LHH A;  3LDC A;  3CD6 V;  2JDI G;  2X6B A;  1GM9 A;  3P30 A;  1VQO V;  3SYQ A;  1PNK A;  2F43 G;  1NVP B;  2HVK C;  1R3K C;  3ZIA G;  3DTU B;  1Q82 W;  3SPC A;  1FXK B;  4R6Z A;  5L3F A;  1YJ9 V;  2DQ0 A;  1QVF U;  4JTC B;  1KP2 A;  2Q69 A;  3A0R A;  2W6J G;  5IY5 C;  4XBF A;  3E8G A;  4JGS A;  3CCU V;  5EBL C;  4I9W A;  4QE9 A;  4MW8 A;  4WFE A;  5LGU A;  5KUK A;  1JJ2 U;  1NKD A;  3GB7 C;  3H01 A;  2DYS B;  3AEI A;  2LP7 A;  3ZMZ A;  1NH2 D;  1SZT A;  2IH3 C;  4PDM A;  4MVU A;  3CC2 V;  5FL7 G;  1OZ0 A;  3CPW U;  1QR9 A;  3JYC A;  3PJS K;  1K97 A;  2WLI B;  3JD2 A;  1QR8 A;  2X0L A;  3B77 A;  2QA4 V;  1DF4 A;  3ETG A;  3OUF A;  4CBC A;  3ABM B;  4JAU A;  4TWK A;  2P7T C;  1FXH A;  4RAI A;  4P9P A;  4CZZ A;  2HJF C;  1J95 A;  3IC7 A;  1FXK A;  1GKF A;  1K4D C;  5LHG A;  1NQT A;  1GMG A;  5H6R A;  4LC1 A;  2IU3 A;  2WLK A;  2OCC B;  1FXV A;  3SYO A;  1M57 B;  1MSW D;  1VQK V;  1S3J A;  1KP3 A;  4F4L A;  3CP1 A;  1DF5 A;  2B1I A;  3SPJ A;  2EIL C;  3JCZ A;  4WF9 V;  2EIN B;  3E83 A;  2HVJ C;  2XAG A;  1NBM G;  3T2M A;  3MHH C;  1SER A;  4WFF A;  1EZJ A;  5B1A C;  2WLI A;  2XOK G;  3ASO B;  3CXC U;  3I56 V;  2DYR B;  1KC8 W;  2ZDI C;  1NJI W;  3X2Q C;  3W7T A;  2AHZ A;  2QTO A;  1Q86 W;  1V54 B;  1DLB A;  2IJI A;  1CEZ A;  1Y66 A;  1SRY A;  2EBO A;  1K8A W;  2DQ3 A;  3VOU A;  1K73 W;  4MVZ A;  1XL4 A;  4ZBM A;  5CBH A;  4J9Y B;  2IU0 A;  3F7Y C;  3SYP A;  3T4D A;  1GTO A;  1E1R G;  2XAH A;  1S5H C;  3SPI A;  2ZXW B;  4YXW G;  1JOY A;  5B3S B;  4UVB A;  2EZO A;  3G71 V;  4H37 A;  4WFB V;  5DM6 V;  2X6C A;  4GX2 A;  3CC4 V;  1FXK C;  1R6K A;  3K04 A;  1P4R A;  4WFA V;  2HG5 C;  5CBF A;  3ZN0 A;  1M90 W;  1W2B U;  3B8M A;  2OT5 A;  3E8F A;  1AR1 B;  1EBO A;  1VQP V;  1Q81 W;  1VQ8 V;  4GT1 A;  3ETD A;  1QVG U;  1YTF B;  2PI4 A;  2DYS C;  2B5U A;  1E1Q G;  2WLM A;  3ZRX A;  2WSS G;  3ZRW B;  3HB3 B;  2MK3 A;  2QKS A;  4PA6 A;  3W7S A;  4PA7 A;  2K1E A;  1M1K W;  5LGN A;  4JPR A;  1NR1 A;  4G28 B;  3ABM C;  4TSF G;  2A79 B;  4JF3 A;  1GM7 A;  1K92 A;  2YEV B;  2ZR3 A;  3E86 A;  3OAA G;  4WCE V;  3ZMT A;  2Y69 B;  1KD1 W;  1RM1 B;  3FYI B;  2OCC C;  1KKD A;  1PKX A;  1I5X A;  5EK0 A;  1M57 C;  3TCU A;  5HFL A;  3TET A;  5LBQ A;  1S0V A;  2ZDI A;  2WLL B;  3EHB B;  1S76 D;  1OCC C;  1XL6 A;  1Q7Y W;  5KUM A;  3FKS G;  2DWD C;  2EIN C;  3ZRW A;  3QO7 A;  1QLE B;  2EIM B;  1YTF D;  3ASO C;  1YJN V;  2A0L A;  2Q68 A;  4QJF B;  4JYB A;  1CP9 A;  2DYR C;  5J9P C;  1GM8 A;  1G8M A;  4MTG A;  1UJW B;  4MSW C;  4UV9 A;  1V54 C;  2QEX V;  5L3G A;  1PL0 A;  3SPH A;  5HFM A;  1K34 A;  2YSU B;  3OMA B;  2HLD G;  1K5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...