2AI3A

Purine nucleoside phosphorylase from calf spleen
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
282
structure length
272
Chain Sequence
b'NGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYKANHEEVLEAGKQAAQKLEQFVSLLMASIPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
molecule tags Transferase
publication title Novel multisubstrate inhibitors of mammalian purine nucleoside phosphorylase.
pubmed doi rcsb
total genus 81
structure length 272
sequence length 282
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ai3A00
1JDUA 3C74A 5F7OA 1NC3A 2AI3A 4LKRA 1OV6A 5I3CA 5C80A 1PR0A 1RCTE 3QPBA 1OU4A 4KN5A 1YBFA 4L0MA 3E9RA 1OUMA 1QE5A 3LBAA 1PKEA 3E0QA 4WKOA 1JP7A 4TXHA 1Z38A 1YRYE 4QAQA 1ULBA 1U1FA 1CB0A 4DANA 1JYSA 4G41A 1T8WA 4G89A 3EUEA 1PBNA 5F7XA 3OCCA 2QPLA 1YR3A 1N3IA 3P0EA 1PK7A 3FUCA 1K3FA 1U1CA 4UC0A 1TCUA 5B7PA 1OTXA 2A0WA 2HWUA 1Z37A 4M1EA 4QATA 2A8YA 4M3NA 3GGSA 4D98A 1V4NA 3K8OE 3MB8A 4TYMA 2QSUA 3KVVA 4P54A 3OOEA 1V45E 1Z33A 2B94A 3TL6A 1JDZA 1PR2A 1K9SA 4L5AA 4IP0A 1PR4A 3MMSA 2AI2A 1RXYA 3P0FA 5JPCA 4TXNA 3KVYA 4TXJA 5B7GA 4BMYA 3DP9A 3KUKA 2QTGA 3OZDA 3OZBA 5B7QA 3ENZA 5K1ZA 5CCDA 3KVRA 1PR1A 3UT6A 3F8WA 3PNSA 3UAYA 1T0UA 1Z5PA 5EFOA 3FOWA 4GLJA 5KB3A 4L5YA 5F77A 1Y1RA 1OVGA 4F2PA 2AC7A 3PHBE 3NM6B 3EMVA 1ULAA 5EPUA 1TCVA 1RT9A 1LV8A 4DARA 1V41E 4L6IA 1A9QA 4F3CA 1SQ6A 1JDVA 4BMXA 1SJ9A 1LX7A 4DA6A 4BN0A 5CYGA 1ODJA 1Z36A 3E9ZA 3OF3A 1ZL2A 1TGVA 2ISCA 1Y6QA 3ONVA 1A9OA 1Z39A 4H1TA 1XE3A 4JP5A 4MCIA 5CXQA 4GMHA 4WKCA 1A9SA 1T8YA 4QEZA 2OECA 1RYZA 1JPVA 3EUFA 4RJ2A 4I2VA 1G2OA 1YQUA 4YJKA 3INYA 4LNAA 3LGSA 3DPSA 3OPVA 1PW7A 3IEXA 2XRFA 3NBQA 4JOSA 3PNPA 5CYFA 4OGLA 1WTAA 2P4SA 1Z35A 1V2HE 1TD1A 1RXUA 4DAEA 4TS3A 4GKAA 3O6VA 1ODKA 4ECEA 5IFKA 4LNHA 4D8VA 1FXUA 4TTJA 2QDKA 1RFGE 2ON6A 4TXMA 1CG6A 1RXSA 1B8NA 1PF7E 4D9HA 1NC1A 1PK9A 2A0XA 5F78A 1ECPA 4D8XA 5F73A 3T94A 3DDOA 3UAXA 1TGYA 3KU4A 3PHCA 3GB9A 3OOHA 4TXLA 1U1EA 4OY3A 3BSFA 1ZOSA 4DAOA 4NY1A 1VHWA 4PR3A 2HN9A 1RXCA 4WKNA 3EEIA 1RR6A 3UAWA 1YQQA 1V48A 3SCZA 2A0YA 1JDSA 1Y1TA 5CCEA 4OF4A 1K27A 4FFSA 3DJFA 4DA7A 5DK6A 2PGAA 1OTYA 5B7NA 1ODLA 4OEHA 3KHSA 2I4TA 3U40A 4PNPA 4NSNA 2I8AA 2RJ3A 3ODGA 1U1GA 1B8OA 4QASA 4G8JA 5F7ZA 4F3KA 4U2KA 1PWYE 3LA8A 1I80A 2Q7OE 1V3QE 1Z5NA 4MARA 1A9PA 4GLFA 3BL6A 1RSZA 1VHJA 3FB1A 4EARA 1SD1A 1T8RA 1M73E 1Q1GA 3O4VA 3OZCA 4OJTA 1T8SA 1A9TA 1JE1A 3D1VA 3UAZA 1NW4A 1C3XA 4BMZA 4DABA 4MCHA 4YO8A 1Z5OA 2OC4A 4K6OA 1VMKA 1VFNA 3OZEA 1PR5A 3BJEA 3FWPA 4X24A 1A9RA 4L5CA 4LDNA 1LVUA 4DA8A 4E1VA 3NM4A 2HSWA 1JE0A 2HRDA 4NS1A 3UAVA 2GUWA 2AI1A 1Y1SA 4QFBA 5IU6A 2OC9A 1JDTA 2IQ5A 3FAZA 4YMLA 5CXSA 4DA0A 1A69A 1ODIA 2OXFA 4QARA 5FAKA 3NM5A 5ETJA 4M7WA 1U1DA 4F1WA 2BSXA 4R31A 4JWTA 4OGKA 3FNQA 1PR6A 4EB8A 3DF9A 1Y1QA 2QTTA 3IOMA 4R2WA 4WKPA 4WKBA 4LZWA 1Y6RA 1Z34A 4D8YA 5F76A 4TS9A 4F2WA 5F7JA 5EUBA 4YNBA 1SD2A 3BGSA 4TTIA 2H8GA 4TTAA 4R2XA 3K8QA
chains in the Genus database with same CATH superfamily
3N05A 2MINA 3OPYB 1G41A 2QP9X 4G0XA 5F4ZA 4CTKA 3FZNA 4D0GA 2XDYA 3OICA 3TRDA 1XRPA 4I50B 1E4OA 4AUMA 3DVQX 3FYTA 2VP2A 2WSBA 4KV7A 4E0BA 1G60A 3HQ4O 4M1SA 5AP9A 1LX6A 4BBPA 5ICGA 4KJXA 3G0HA 3S8MA 4LHSA 1WLYA 1EZ1A 1RRMA 3ILHA 4EJ2A 2CJWB 2R5NA 1CFJA 2W2TA 4DLUA 1PR0A 3CUYA 4BCBA 1NNSA 3QPBA 1SCBA 3BXPA 2Z6QA 5JXJA 3GNLA 4KO8A 2PUBA 2H1SA 4KFUA 3O31A 4HGPA 1SUWA 3A05A 1TM2A 4FHCA 2VXOA 4M0DA 1U3GA 4PHCA 2ZT6A 3A7EA 5DSXA 2PKRA 1QORA 1U2TA 2JCGA 3ROKA 3QE9Y 5DRTA 3U4QA 4Q3AA 3RRNA 3AF6A 2IOFK 5BQFA 3IUYA 4DR7B 5CGQB 4B2LA 2QD5A 3MELA 4FFWA 1EGMB 3BK7A 3RBVA 4RLQA 3SZRA 2UXCB 1Z38A 4RVCA 3OPYA 3ZDXB 5THKA 1Q0QA 2OVFA 5K8JB 4F8EA 1QGYA 2HPAA 3BL8A 3V55A 4UEOA 5F1YA 4HNUA 4BQSA 4XASA 2GEKA 2X8BA 1QKJA 1OLOA 2WMOB 2VQSA 1PQUA 2WSSD 4XFJA 4F60A 1YAHA 2Y66A 3QEBZ 5FWXB 1Z56C 4OQ4A 1QAOA 1YKSA 5PGMA 4MUNA 1KO1A 2WJWA 2H6EA 4J16A 2Q0SA 1KK2A 4N0QA 4WXRA 3UBTA 4CMGA 1TADA 3HBAA 1YB2A 8AT1A 4YUVA 3W0LB 4U8GA 3A2KA 3JD2A 821PA 5TIIA 1SEPA 1ZJ6A 3KRTA 1CZNA 3RADC 1U8UA 4RY9A 2VZ0A 1QV7A 1U4OA 3JXEA 4LMPA 3SR3A 2QGFA 5EIXA 1KAOA 2VNJA 4FINA 4CI9A 1T25A 2CLSA 2Z9DA 4DCUA 4DDKA 2W8BA 3HN2A 1Y5NA 3AHEA 1M10A 5FBWB 2NPOA 1KERA 1ISIA 1DBVO 1D2RA 1VJDA 4P3YA 4NOKA 2L18A 1ADYA 3W5IA 2ZBVA 3W2FA 5D6NA 4Z4GA 3GEGA 3KWMA 2YJ6A 3NRCA 4QATA 2QRVB 5KVQA 1FDOA 2H08A 3T1YB 2QR3A 2I7TA 3ROQA 2YWDA 1G66A 2DRIA 1ZMBA 3K09C 3TRIA 3GQBA 3WK8A 3FDIA 4R8LA 4D41A 3IKMB 1T1GA 5IJ0A 5L7YA 4C4XA 1DQSA 2NO0A 2A35A 3D4IA 3K8OE 1M6VB 2B9EA 2J0UB 2OGZA 3Q40A 3PGVA 4FFNA 4TYMA 4U02A 3T1QA 3AI1A 8ADHA 1H9CA 2BFMA 4EYKA 5BSHA 1MAAA 3AVUA 3LG2A 4NG4A 4QPJC 3WGGA 1YVRA 3OOEA 2W71A 4A5OA 2ISQA 2HXSA 3C3BA 3KKNA 3NVKI 3DEKA 1CDOA 3HN7A 3B2NA 4QT0A 1HDRA 2Q3HA 4DNPA 4CIVA 3AB3A 4G24A 2MYTA 3ORFA 5JSYA 3AESB 1L5GB 3TNDA 2ZK7A 2X0RA 1AQUA 1U2PA 2ZBUA 3LDAA 3OOWA 1P6UA 1NNI1 4ZEOA 3PCXA 4HT3B 5HK9A 3WGMA 4HRVA 3BWCA 3DBOB 2HFJA 3EWAA 2CW5A 4GF5A 1RWBA 1SO8A 2YN0A 4LZPA 2NO9A 2GHIA 1A9YA 5HILA 3V8BA 1CR4A 4RWEA 1DJPA 4EO7A 2PRKA 4MS4A 1I6MA 1O3YA 1S2OA 3BBLA 4GAEA 4WW0A 4WNAA 4REQA 3UQZA 4I1OA 2KB0A 4R2JA 3WK9A 1C9EA 4FFMA 2D1YA 5DRYA 1EP1B 3ZXUB 3UWOA 4IDHA 3MGBA 4RETA 1Z2AA 3IAXA 1V1MB 1KJZA 4ZP1A 4XWAA 2ZQZA 3CBGA 3KEQA 3GVCA 1R50A 2NVOA 5KUTA 1LPNA 1PJQA 3I9OA 1EE1A 4L16A 3S2EA 5KTRA 2UUBB 3F3YA 5HIKA 5IJXA 5BRJA 1BH6A 4WZZA 1FA9A 3WFZA 4G5OA 4EO4A 4L72A 2G63A 3ROFA 1OKKD 1VYVA 1ZSNA 1T0BA 4EGAA 3KVRA 1WQ1R 3NFRA 2IHNA 2YNMA 2CJYA 5LOVB 5B3JC 2OZKA 3PTZA 3S40A 3WLQA 2OMKA 4HDCA 2C2BA 2J85A 3LCJA 4G25A 4Q21A 5HQTA 2FPXA 3HRHA 1FFHA 4C88A 1E2FA 3GZNA 2ZJ3A 2QMZA 2Q1UA 1T26A 2WUWE 3FPHA 4X9XA 2UYCA 2VYQA 4ZYLA 2QUAA 3CLSC 4PZPA 3P4YA 1VC2A 4KQWA 4Y0AA 2FUKA 5P21A 2PZFA 4F2PA 5AW6A 5KTKA 4H1UA 1Y9ZA 1B0UA 2C58A 3MS4A 3PHBE 3QEOA 3BD6A 5ALDA 5HZGA 3QLUC 4PZ0A 4BNKA 4YRGA 2JLRA 1U02A 1QV6A 4I4TA 5AKZA 1M7BA 4QUJA 4N54A 3TZ6A 1AQYA 1L7OA 5KTNA 1F8XA 3CE6A 1D2NA 1I4WA 2GT1A 2PQMA 2GNPA 3SF8B 4N8DA 5IHXA 2JLCA 4JC4A 3CB4A 2J07A 2IZ6A 2OAGA 2GNAA 4ZAZA 1TAHA 5FQOA 4F3CA 2PJRA 1XLTA 4BMXA 5LZ8A 3QKWA 4PC2A 2ID4A 4O3FA 1Y4AE 3LPMA 1W5EA 3U4HA 5KC9A 3RC8A 5CM2Z 3TRJA 1MHTA 3EWNA 5EWLB 4JYAB 3F6PA 1FP6A 5CDFA 2XUOA 4WK0B 3RYTC 3MERA 1TVKB 5KO2A 1O94D 3WWCA 5KJ6A 4YHHB 2AOUA 3OZIA 4GKVA 4KWIA 6AT1A 1J97A 4TWJA 3B9QA 5FRDA 4CEJA 3I73A 1IVYA 4HH3C 4QNRA 1E1RD 2DR2A 2B1IA 1JHUA 1QAMA 3H2BA 4POAA 1A9OA 1M3SA 4RABA 4WSOA 3VNQA 2Y0CA 1IN5A 2VJAA 3BTUA 1OFUX 3R7FA 2XVXA 5MFPA 1LZLA 5EQFA 5HKAA 4PO8A 4MCIA 1ZGZA 3R7BA 1DAKA 1LTQA 4KIFA 5HFJA 3AUYA 1AXEA 4I46A 2M2IA 1QDEA 3CKLA 4PW0A 1KYQA 5C4GB 1TF7A 1UOQA 1MAVA 2OKCA 2YQ4A 2RB4A 4MKIA 1FTYA 4NULA 1P1BA 1XTZA 1Y34E 4NV0A 4DWJA 3JATA 2GZRA 2DE0X 1H0SA 2K2QB 1H4QA 4E6PA 2AOUB 1VIAA 1WUKS 1Z0FA 3TECE 4INAA 2OP0A 2C2XA 3HKCB 4JU8A 4BX3A 1L5KA 3CUKA 1RRVA 1YCHA 1UMBB 3E9NA 2O8DA 3NOXA 1E8MA 2IU0A 1EM6A 2DSTA 3M5DA 5FI1B 1PW7A 5I7VA 3G2NA 2Q2NA 3K6SB 3ILXA 2XIJA 5BQ3A 4PYJA 4PYQA 4W4TA 4ZGBA 1S2GA 3DHWC 4MGEA 1MQ9A 2MOKA 3HYLA 3ZJTA 2DERA 4NCHA 3NCTA 1WTAA 5JPIA 4CPDA 1UOEA 3RGGA 3B82A 3ZZUA 2FPLA 4B4VA 4YXWD 1FDSA 5AKLA 1DCMA 1XA3A 4BFTA 2QQEA 4YUAA 3FDJA 1IOLA 5EXTA 5FHRA 3O6VA 1F6BA 2KMLA 3F97A 5I9LA 3O92A 3L46A 4OHYA 3KZVA 2WZBA 4CKBB 3EIOA 2YYYA 1UM8A 2CXQA 1U0OC 2CF5A 3I01M 3L9XA 4GPZA 4AL4A 3UH0A 4X3CA 1PF7E 2R6R1 1E3LA 5CVCA 4E15A 2PD6A 3QF4A 2VDMB 3SKYA 1EVQA 1NGSA 1W4LA 1F2TA 2X8JA 1A5SB 3K0KA 4K0KB 3TCXB 4A2PA 3IEKA 3DFFA 3HHPA 4EB6B 2PYZA 4IMJB 5IHPA 3U37A 1E3QA 5EKUA 2IPMA 5K09A 4FC7A 2B0CA 3RS7A 4AX4A 3FCEA 4QG7A 2JLSA 3L8HA 2FFHA 2XT9A 3T3DA 1HMPA 1KEEA 3E58A 5BNZA 5KMGA 2Y71A 4AP9A 4COKA 1AUPA 5EESA 1BA3A 1BRMA 2RGAA 1THZA 1YGPA 2LCFA 2X6QA 3IPLA 3OC6A 4O4JB 4PZDA 4WLVA 3GPCA 4ZC1A 3GMTA 1PFVA 3ZGYA 3KLMX 1DG1G 3H6KA 3KKMA 3GEIA 4QPNA 5AHWA 4KEAA 3I23A 4K87A 1OI3A 4UBLA 1XDZA 2A0KA 3TNLA 3IJRA 1YL5A 2M1XA 4MR9B 5CVJA 2MWMA 3MUOA 3JQPA 3W5SA 3WDKA 2A6PA 3ZHVA 3VA7A 3K1AB 3T5MA 1UPUA 3PLNA 4LJ9A 3HBMA 4MW4A 3CCBA 5AW9A 4DLBA 1ZOIA 3AINA 1EDBA 4UNSA 5MN5A 2O6HA 1TJ3A 3A6LA 3Q8WA 3ETNA 3S7TA 5KDOA 2QUJA 3UK2A 4JLBA 1I2DA 1N9GA 3KXPA 1AUXA 1KFCB 4WWHA 3BRSA 3OLCX 2YHUA 3QTBA 5KYVA 1F3OA 1S8OA 4I2NA 4AULA 2ZDHA 4QBFA 4RLSA 2XQJA 5IANA 2IPXA 4HAWA 3VAZA 2I33A 4NJMA 4Q9NA 4ZO7A 2GJSA 4D97A 4EG8A 5JCPA 1Q7GA 4M22A 3K4HA 1VRWA 4KQKA 5GGXA 2P9HA 4F06A 1GGFA 2M6SA 4RVDA 4C4PA 4CFYA 1N2CB 3JX9A 5E4FA 3H9EO 1NDQA 2LGJA 4ZMRA 1BCRA 2BZSA 4X84A 1SCKA 1CD5A 2P2NA 5DK6A 1AZSC 4JENA 4Y6OA 5K01A 4B73A 2I34A 2XUFA 3CURA 5DNWA 3O75A 5E6SA 3UJHA 3P0JA 4B84A 2QRHA 4EEZA 5C3UA 1FQJA 1RVDA 5KJEA 3UVEA 4I3GA 3QF4B 4GLBA 2PXHA 4JNCA 2V7QA 3LIIA 1OLXA 4X62B 4WERA 5CA1B 1H3NA 4BP3A 3IDSA 4OYRA 4Q93A 4XWYA 1B8OA 2X1VA 4K05A 2FN8A 2W2KB 4WLOA 5JFGA 1ISFA 1KO7A 2JI7A 2P1DA 4MDYA 1BFUA 3DMFA 1DC5A 3PJGA 5LIRA 2OMEA 3VO9A 2G9QA 1K63A 1XZCA 1RQPA 3Q9NA 1NVVR 3IR5A 3OPQA 1I80A 4KFSA 3NWBA 4MYHA 4GPD1 5M29A 1E62A 3COPA 1EWRA 1VHDA 2W6QA 2WTEA 3AG5A 4X93A 4XLLA 3WO1A 1QU3A 2Q4RA 5IUKC 1D8AA 2ZYRA 4KFCA 3KTAA 5C7IO 1RZ3A 1I7NA 3LQRA 4M86A 2C4WA 5DHFA 4CHTA 2IH2A 2C88A 2QW1A 3M89A 3QUBA 4TYPA 5LYJA 4MQEB 2YZ2A 4UMEA 1B0AA 1BE8A 5A1JA 4EVRA 3VKGA 3WRXC 1F2UB 1UMCA 4G07A 1DAOA 1E7SA 4GYJA 1DQZA 1D2MA 4AJ4A 4E5YA 1JAXA 1AMNA 2IZ7A 2OC4A 2UZ1A 4W1SA 2CL0X 1PJ4A 2V5AA 3AP2A 3OMLA 4K6OA 1XZMA 3AUSA 4LJ4A 5JMPA 3ZS9A 4YT5A 3IPCA 1C50A 2PUGA 3T0GA 2H17A 3H0EA 1D4AA 4CM7A 3LI2A 1PTKA 1XJ0A 1NP7A 4MICA 3S29A 4EQZA 3K30A 1Q3HA 3E8SA 3I0MA 2W4QA 2XVAA 4LVCA 4JYZA 4OMUA 2ZJ7A 3NM4A 3KSAC 3AVWA 4BZWA 4JN6B 3N3AC 3PFHA 4C20A 5BW8A 4FN4A 2OORA 1X7DA 3FWHA 4WRRA 2KLBA 3R7NA 1Q3KA 3UAVA 3VPCA 1E7QA 1GCGA 1Z63A 4YTEA 3I45A 4WOCA 2GBPA 1USVA 2XMGA 1HWYA 3K35A 3B8EA 1NXWA 2NG1A 5C1OA 3BZBA 2O2JA 3FAZA 2IYLD 3HN6A 5ALZA 4FT4A 4QC2A 5FPSA 7MHTA 3S28A 2UVPA 2XCLA 2ZYWX 4XFKA 5BURA 2PY6A 1IHYA 1WCWA 3DDUA 3JARB 2QJRA 5E7JA 5JNSA 1RJ9B 2AZDA 5IMSA 2R1TA 1QC5B 1JAHA 4TROA 3T5CA 1ABEA 3MG9A 5E8RA 3H11B 3L6DA 5CA0F 2D6FA 1E1YA 4YMTA 3PDCA 1KI6B 1FX0A 4KAXA 3HK2A 5HR5A 4UHHA 3FNBA 4J0DA 4RD1A 5DYIA 4TRNA 1F06A 2C5HA 3LGAA 1OASA 2NSJA 4I4IA 2FUNB 5KTYA 3KQNA 1DINA 1QGUB 2GCPA 3KUCA 5TQ2B 1RS0A 3FM9A 4EYSA 4YCSA 2J08A 2Q3LA 2VEDA 2X3YA 4PQGA 4UQOA 2VHVA 1AA6A 3O3CA 1TO2E 1U7HA 1Y1QA 2C3UA 2QTTA 1X0VA 1RIFA 5HVNA 2D7JA 1HLFA 3RF6A 2GYYA 3DO6A 3PXXA 3SICE 5JAIA 2YWGA 4HAOA 2JH3A 4RNCA 4BV3A 1WHTA 2FPWA 1XTQA 3PHLA 4PGHA 1KEUA 1TI7A 2VRCD 3ZW9A 1OE0A 1IFXA 2AG8A 3OC0A 5EUBA 1R0WA 3TSOA 2ZRFA 5KYXB 3KEMA 1M0SA 1UKVY 1Y4DE 4TSKA 2RGWA 3KZCA 4QTTB 1K6JA 3UC5A 3BGSA 1NV9A 5BOSA 4HDRA 2Z56A 3WGYA 3N8NA 2YOHA 2XZOA 3W7BA 1E77A 1IPEA 3IOCA 1B74A 4ZO6A 1YDEA 4BO4A 4WOKA 2J5XA 3AJDA 3G0IA 2B4YA 2GZAA 2NUTA 1CUAA 2ZWMA 3C5WP 1JSCA 2OWDA 1RRPA 3VH1A 3Q10A 3V9AA 1LLFA 4DS3A 3WIDA 2BJVA 4ZAVA 2GH1A 4ZV4A 2ZRIA 5LYYA 3KQQA 4TUYF 3RAGA 1TK9A 3G23A 3VMFA 4RF5A 3CN9A 5FTMA 2EGGA 4D9IA 5C80A 1DDIA 4DWVA 3DVAB 3EZNA 3L82B 3OY7A 3P94A 4YRKA 4X7BA 5ADHA 3B3GA 1EFRD 1KGSA 4N49A 4K2HA 4YAJA 5CFNA 1FZQA 2FPSA 2QZJA 2WSIA 3AXTA 1JV2B 2UV8A 1TUBB 3HM9A 4A2CA 2O6LA 1XT6A 2YY6A 2VT6A 4Z54A 3U3JA 2OYSA 1CYDA 1SRQA 4FBGA 2CXNA 4KLNA 4MOWA 4EHJA 1C8KA 1P4GA 1Z45A 1ZXBA 3H9UA 4FYVA 3GLIB 1SVLA 4E5UA 1BU5A 1QTIA 2GKOA 5ALLA 4PG7A 3Q0IA 1CB0A 1Y9JA 4MRVA 3R7SA 3WSVA 3DE2X 4BO1A 1PN3A 1E4VA 3HLYA 3LC7O 2QRVA 3R3ZA 3THRA 5HKOA 2HNBA 4DUZB 2SBTA 4JQZA 1UBUS 1L7VC 2FRXA 3RRJA 3GJ3A 1PFUA 3U19A 1ISPA 4GQBA 3AGPA 3C3EA 1E4YA 4HGRA 3V80A 1IBSA 3C3XA 1XA0A 3LUDA 3C8DA 1TYDE 3O8OB 5EVJA 5GONF 3EHDA 3LP8A 2QPLA 1LSOA 4BKPA 3A27A 4B7ZA 3VR6A 4GICA 4XJXA 4D4JA 3PX7A 1TRKA 2VAWA 2GPYA 1OH8A 3KZXA 4B6QA 3CNQS 5GIPE 1VHLA 2GPAA 4GZMA 3RT1A 5LMZA 4ARCA 5HM6A 4EI2A 3WGIA 1C9KA 4JQYA 1QB8A 2XD9A 3GLHB 1BJKA 2OV4A 3I1YA 5FKJA 3T06B 1GG8A 5D5PA 1N1MA 5AI5A 4PRYA 3A37A 2ZEJA 3EY9A 2G28A 3PPXA 1GUAA 3SR0A 3FW1A 2X9QA 1HFWA 4KYTA 1H0KA 4ZREA 1JA0A 1IOZA 4DR6B 2C4UA 2R6AA 3OKAA 3HYCA 3NKFA 4LNUB 4J29A 4KYIB 3TRKA 5CDHA 1ACJA 1K0FA 4UXIA 4D98A 4YJDA 4F38A 1UBNA 3HI4A 2CKMA 2HHCA 4BWFB 5E1DA 4HPWA 1GHTA 1GFSA 2DWOA 5KQSA 4MV6A 4MWEA 5IM4F 2FGJA 3KQOA 4XPIA 1E3WA 3E22A 1TT5A 4IDFA 1SCQA 4IY1A 4TOIA 2A1UA 2YINC 5CHEA 1G5PA 5IF3A 3SX0A 1UBMS 1KIFA 4B31A 3VR5A 5C53B 4JOQA 2REQA 2A5YB 4EPVA 1G4HA 1H2RS 3SBOA 3JWEA 3BGOS 4BGVA 3AIMA 4MAFA 3AEKB 3QVKA 2DUMA 3GU3A 4TV9F 1YF3A 4QDUA 5JATA 2VP0A 4ZV9A 2QIOA 3RRBA 1C80A 3BB1A 3RYFB 1NZFA 4HX9A 4A91A 2TS1A 1OILA 3DE0X 4JJAA 1DTEA 2BGNA 4LRQA 5I47A 2XX3A 2Z3VA 3L8GA 2NO5A 4B3JA 2PJZA 1FMTA 3F1KA 4BPRA 2QSJA 4FE4A 4BMYA 5KVAA 3RARA 3SI7A 1Z6PA 3KEGA 4IWNA 4K81B 4DMRA 1C1DB 3BK2A 4LV5B 2WYHA 3LYLA 2NXNA 1RLOA 3ZJ5A 1CJKC 4CLOB 3GR6A 1J9ZA 1JLKA 2IL1A 4UUAA 4ERXA 3PJRA 5BMVA 3FNIA 3GJXC 2Y9PB 3LK6A 1B76A 2XMRA 3MMNA 4BNGA 2BLLA 4BNZA 4XVRA 1CEEA 4GXTA 1U0NA 2VO1A 5EMMA 4BGUA 4PNEA 3KU1A 4UUPA 4ZT4A 2HA6A 3WLHA 2Y8EA 1X1QA 3UG6A 1YUMA 3DPUA 3KAJA 4LMBA 4CTOA 2XAAA 5JEEA 1OWMA 1RHJA 1ECLA 4DR5B 2R79A 4PG4A 3VQTA 4B6SA 1US8B 1TZKA 5IH7A 2WE8A 3CR8A 5FUBA 3TQSA 4JQOA 4COOA 2RCNA 5CBKA 2J0SA 4AROA 1EWYA 1BXZA 1MU0A 4XB6B 1OVMA 1TJ4A 2IIPA 4OUDA 3IHTA 4IWYA 5C3MA 2QTAA 3W3ZB 3TSCA 5F5XA 2YWHA 2HJHA 5AI4A 3VPAA 1ZDMA 2VUTA 2XY4A 4JNKA 3CMMA 1E6MA 2E48A 1J7JA 1MRNA 2BAGA 3A6PC 4R01A 1FNDA 2WHPA 4K86A 4ZALA 2CVOA 1L5RA 3OTIA 3AFIA 1P73A 4EZBA 2PTHA 2HWYA 4P58A 5BW6B 2HWKA 3A9RA 2IZ0A 4IJQA 2CNOA 4ZVTA 3AK4A 4ZI5A 1CQJB 4P35A 3VPDA 1H66A 1Q1AA 3E1SA 4GSLA 4IFTA 1QHHA 1TJNA 1HT1E 1JLSA 1VI5A 1H6BA 2PM8A 2ZDGA 3OJLA 1ADBA 4JYPA 4MPJA 3OA2A 4LV8B 3SFVA 4BKOA 1ZI9A 3NGXA 4MVJD 2PUJA 1KS9A 4I9FA 5LA6A 3H5RA 1GFZA 3BFJA 3H86A 4DC9A 4F3NA 3IT1A 1D8TA 4FGWA 4LXGA 1TUGA 5BV7A 4QJBA 1PGOA 1QZTA 2VF7A 3OIYA 3KQMA 3D5QA 3MTGA 2D1FA 3SOPA 4B7UA 4X1YB 2Z9BA 2WFLB 4EJ0A 5JXIA 2B4AA 1YV9A 1Q20A 1N6KA 2Q6IA 2JH9A 3UJAA 1NUTA 2XTNA 4HDMA 2OUIA 3LVFO 3KDPA 4NOMA 2GUGA 1Q44A 5D5HA 1YK1A 3C5HA 2FDRA 5JDCC 4XWGA 1DXQA 4R1MA 4CODB 1U7WA 1DOHA 4BRZA 2XUAA 3FMFA 4IIBA 1GZ6A 3O1HB 3P71T 4HO1X 2ZIVB 5MGBA 5JBIA 4QICA 2EDAA 5A0VA 2XSZD 4WCFC 2EATA 1TUIA 5AI0A 4WNAB 4PZEA 3PU6A 2X8AA 1PS8A 4B47A 4IH9A 5EHNA 3REGA 2XKAA 4UHBA 3EGVA 3JQ7A 4L3WA 5A06A 3LXUX 4W8GA 4AT1A 5K8LA 2R6GA 5IKMA 1WMSA 2FMFA 1VIYA 3R3JA 1L4GA 3UANA 1X13A 1NLFA 3DM9B 4GEGA 4L4XA 2NO6A 2JHGA 1J5XA 2A1TR 1RQNA 1T0HB 4BE4A 4DNFA 2FV8A 4NAHA 1V11A 3VYUB 4E31A 2EJVA 2XDWA 4Q00A 3H2KA 5CNIA 3EBLA 3MGAA 4CMHA 3LGXA 4E13A 1Z0ZA 1EFRA 3M6VA 4IRMA 4LOAA 3I05A 3EQZA 1QVRA 5BWMA 3ONEA 3TVYA 2AF3C 3AW8A 1USUA 2M1ZA 2QU8A 3DE4X 4ZRMA 4L5BA 2JLUA 4PONA 5JVDF 4EECA 4LGCA 5I7UA 1HDCA 3RVKA 4BMSA 4WASA 4UUNA 1G8JA 1YBHA 2QRUA 3P5BA 2PT6A 3A2MA 3PS9A 3RWOA 5C81A 2E85A 4DJJA 5AD1A 3T7AA 2TECE 3HWRA 3KZMA 3KPWA 1A1SA 1UL1X 4PICA 2Q99A 2Z8ZA 4MS1A 1RXSA 4GXRA 1MRSA 2NT4A 5TPWA 1BYIA 1EPUA 3ZE0B 1SUBA 4LGVA 4PX3A 1XLVA 2F1HA 2WEKA 3U31A 5K8CA 3LC1O 5DSTA 1RAGA 2WWIA 3F4BA 2V7GA 1N8NA 5BN3A 1UDRA 3TGPA 1FVOA 3JQFC 1W2GA 5AOBA 1KAMA 4JLUA 1ECPA 4BLOA 3ZK7A 5BWLA 1GVNB 3BGDA 3SJ7A 4EHKA 4NU6A 1IDN1 5FOTA 3ZDYB 4AKHA 3GLIE 2QRLA 1FNSA 3TO5A 2X23A 3WC4A 4DJ5X 1U3VA 2H3EA 4MH0R 2B30A 3RC2A 1C7ZA 4NBKA 4TV9B 5EIWA 1JH8A 3ZCUA 3QHAA 2XWJI 2WG0A 2ZJYA 3DMTC 2GLUA 3AJ9A 4BNJA 4X7PA 1BS2A 1LZKA 2C0PA 2J3EA 1CZOA 2JHFA 4IMPA 4ON9A 5KTOA 3T3NA 1FTSA 4KVZA 3KQVA 1JZQA 3ET5A 2AXPA 5LLTA 3NTXA 3SC2B 1W1IA 2VHXA 1VHWA 3R8XA 2PZAA 3L4JA 3D3WA 3GJ8A 4CKZA 1L4HA 3QKRA 4Q1BA 1XZBA 3VJRA 5JJCA 2LE0A 4TZ6A 2R68A 5E6SB 1SB9A 1MH1A 4X61A 4H60A 2A7QA 1TTPB 2IYQA 3LRPA 2BBSA 4FPXA 4RMIA 4EBBA 5KHLB 4DMKA 3PPIA 3PXUA 4HLCA 4N7BA 2I66A 4HFJA 2X0IA 3OHMA 4FONA 4LHEA 4ZTZB 2XOXA 1TQ4A 1OLUA 1W8DA 2OCIA 4G2TA 4L6AA 2VOEA 2ZE5A 4EKNB 5KU7A 3EC1A 4DIEA 1ISGA 1UBSB 4Q1CA 3RU2A 3OP1A 3UV7A 1QTRA 3H8VA 5KNDH 3HEAA 1E3DA 1D7OA 3GC6A 3UB4A 1Z5GA 3UK7A 3HTXA 5L3RA 3AM3A 2EXXA 1POXA 1TX4B 2WUGA 4JJ8A 3C6XA 4QYMA 3QUTA 4P86A 1DEHA 3QBTA 1ORVA 3V00A 4CTJA 1UMBA 3A4YA 4RQTA 1PNTA 4HLDA 4QO7A 2BFDA 1W1UA 2NZ8A 3BG5A 3Q1LA 1W73A 2ZAGA 3I6IA 1BE0A 1H6DA 5AVJA 5DXFA 3DEJA 1N2ZA 2CMDA 2ID7A 1U0LA 1U2RA 3EQ9A 1EFPA 3JVVA 5EE5B 1D5CA 3IP7A 5BN3B 2EX1A 1P6QA 1R4AA 2Q45A 3LT2A 4RZSA 4C30A 1Z62A 4M37A 4GLOA 2R6FA 2IP1A 3VR4A 1NM5A 2JB9A 4PXSA 4UNPA 4TM7A 1H0RA 2VG8A 3CT6A 1P5HA 4MRMB 4BZXA 5I7RA 2WTBA 2EFGA 4EOGA 2H57A 3UWSA 5ICMA 1RABA 1L5HB 2RG7A 4D1YA 1YVUA 4S1PA 5F1PA 4GLFA 4JX8A 2W2OA 4EG1A 4E2XA 2DFNA 3PF8A 4L78A 1IBCA 2BOVA 4UM8B 3SHVA 4FDVA 1LF5A 3TR6A 2BR5A 5L9AA 1W0CA 5IWAB 2JEOA 1GOTA 2Q0XA 4IJUA 4KWCA 5H70A 4B1FA 1SVMA 3MS2A 3UAZA 3CVXA 2RHTA 1NW4A 2NACA 5HJ2A 3LUGA 3RRMA 5ALPA 1E1QA 3WL6A 4DABA 2IEAA 3B89A 4YO8A 5BYKA 1DG9A 2Q4BA 3QVGB 3RT7A 4Z3DA 4AJPA 4EK9A 2EEPA 1PR3A 1U7OA 4KO3S 3P9IA 5JECA 2P9QA 1YJAA 3JAKA 3V7YA 2GPJA 1PR5A 1TA4A 4PZCA 4ARBA 1JQLB 3J80A 3K71B 4MUGA 1IVSA 1XCMA 3D7SA 4OB7A 1DHRA 2VDUE 4V0MA 1N75A 3LY7A 1ORTA 2JGMA 3DZGA 2IS1A 3UA4A 2C4VA 2C04A 5K0EA 4PTZA 1A82A 1X7YB 4Q1FA 1P0PA 2A3RA 1Y9DA 2ET6A 2R1ZA 1DKUA 3PC3A 5CNKA 3V9PA 5BSUA 6CHYA 5CNMA 3W2IA 2PUCA 2CUNA 2PMCA 4CV0A 1MX9A 1P9LA 3IMGA 3BRWA 5ARCA 1R6UA 3THXA 1UEXC 1D7AA 1XSEA 1XPJA 3L0ZA 4HH4A 3OQOA 4PLPA 3CZQA 4AY3A 4QFBA 1RQXA 1ZWLA 1EA7A 2B8WA 2BEVB 2O1EA 1G8SA 2WKPA 4PHHA 4U6NA 1JDTA 3HKDA 2DUUA 2H59A 4S04A 1T2NA 1XHLA 2FP4B 2R6CA 3KT8A 4Y6LA 1LNQA 2CZQA 5EKSA 4KTVE 4AO7A 1L9KA 4M9RA 5I9MA 2JFUA 5FO0A 4IDOA 1TZ2A 1KVTA 1M8FA 1MFPA 4PCLA 2PU5A 1DAMA 5BR1A 2CYCA 2GEVA 4TKUA 4V0NA 2JI6A 3N2KB 1N0HA 4R0VA 4JWKA 1IEXA 3O94A 4J03A 1QYXA 4HG2A 1K4KA 1YA8A 1TC1A 1GUZA 2IXAA 3NI2A 5EWJA 4CTNA 5KTMA 2FW9A 3ZEIA 2PFSA 4MRMA 2ZJBA 1YFKA 1JAIA 3C3JA 4IJ6A 1U94A 1FJ2A 4JWTA 4OGKA 4R7ZA 2PXCA 2EIHA 2PZMA 5BP7A 2PBFA 2H92A 2LNDA 2XOKD 5KZMB 3VR4D 3EODA 1O95C 3FPKA 3IOMA 5IBRA 3PWSA 5LL6P 1PJTA 3DAPA 5DM60 2O3RA 1XZNA 2I29A 3IUSA 3IH5A 2VTEA 3NX4A 4W6ZA 3SBDA 5JH7B 1IJBA 1QIGA 1UKYA 3EXEA 3EZ6A 1GNQA 1Y6RA 3VYTB 1P72A 1SKAA 2MHCA 3OKFA 4MUKA 1QFSA 1TMKA 1RLTA 3PFBA 4AJLA 2D2EA 3CFYA 1VL8A 2WMNB 4R2HA 2VSYA 3U49A 3BDVA 4TTIA 5TDHA 5HM8A 3HZZA 1E4EA 1TQ6A 5K6AC 3ZWVA 5BPHA 1BXGB 1UPFA 4MV5A 4CMKA 3W9UA 4Z8XA 2FGKA 5DV9A 4FU0A 1CUCA 1P9OA 1JIKA 1SPXA 4HS9A 2GAFA 4PLWA 3T9FA 2VJNA 4DV1B 4BDTA 1CJMA 1DC6A 1EJ0A 4TTPA 4YO7A 1GQSA 1ZLYA 3D5EA 3FTDA 1X7GA 1CB7A 4OL0A 1RE1A 2H07A 3HZOA 1YJBA 3R0JA 4EUNA 2JCXA 3S27A 3VHXA 1N5KA 4IFBA 1ZCZA 1D6SA 2NX2A 2QRQA 1KDPA 3BTSA 3OFKA 2QP3A 4Z0TA 2P2ZA 3SXUB 4R7GA 1Y98A 5FP0A 4PN7A 2ZP1A 5ARBA 3UICA 1EJBA 5B37A 1SBYA 4UVIA 4ZEMA 1ZK2A 5CB0A 1YQWA 2O1XA 2C8VA 1PKEA 1JEAA 1ODFA 4PAWA 3VVBA 5L95A 3CRVA 4M6WA 1O2DA 2QUHA 3TLGB 2F8TA 3T3OA 1Y6JA 1BXGA 1NXXA 1B6SA 2GWRA 2YS6A 2I6UA 3DVSX 3ECCA 3X1YA 2WNSA 1Y1PA 1NT2A 2WP8J 1I1OA 3D3QA 4JBGA 2ASVA 3T3GA 4A6PA 2BCJQ 1HT2E 1I4TD 5JW6A 2HF9A 2V8BA 3Q7TA 4QUHA 1RWQA 4UU1A 3B6EA 3TTXA 3F6RA 1SK8A 3IB3A 2GARA 2VA8A 1ADFA 1OGYA 1T8WA 2DWCA 2FPGA 4DCGA 3DKKA 1O5TA 1GYPA 3HZHA 4UAVA 5DHSA 4K9KA 3UUWA 5JCOC 3R9XB 3ND9A 1UJ6A 2PRIA 1XYYA 1DCKA 2I7DA 2NW6A 2ZM5A 1AD2A 2O20A 1RPJA 1UMDA 1JAZA 3HI6A 4P7FA 1I7DA 3AUUA 1VE6A 2HK9A 1N3IA 1W6UA 2YCBA 3LUAA 3V42A 5KX5B 3D0QA 1LK0A 1S8FA 3PG5A 4WBXC 1EDZA 2PMFA 5H8WA 2V58A 1X7XB 4MI1A 5DCYA 3ZTTA 3VTFA 2WIKA 4LECA 2GTHA 2VWGA 1E1RA 1G21A 3B1FA 2G0NA 1IPHA 1FRQA 2QZ4A 3R09A 2YHIA 2ACWA 2DUJA 4S1TA 1PUJA 1EWTA 4BRWA 2AWOA 2AE1A 2CBZA 3PNLA 2HWUA 3WIEA 3QUQA 4LVOA 3VM6A 1WIWA 3NHKA 3SSNA 1J06A 4NYIQ 2AMVA 2Q6KA 4LXUA 1Y5LA 1TM5E 4YAWA 4KITB 2WYUA 2PXAA 3OY2A 5JAPA 1WPXA 3UEOA 3UW3A 5JR3A 2REXB 3EULA 4RACA 3PUJA 2PJUA 4YCJA 3TQCA 4PGFA 1R4NA 3NAQA 1TEXA 4CL0A 1U8CB 2YIVX 1UUFA 4NZYA 5DO9A 1GUDA 1WBJB 4R16A 3ANMA 3GN2A 3FCOA 1Z7GA 3AV0B 5BNWA 3FB4A 1LPOA 4FDTA 2I7VA 2ZR8A 5JXWA 2IS6A 3PQ7A 4NYIR 2OV8A 3LT4A 4QRDA 1FF9A 5F35A 2D2VA 3G9UA 2VEOA 1MQSA 4J0FA 4WN3A 5FULA 1SNYA 1ENPA 4C0LA 1DJMA 2O8EB 1NG9A 1JVNA 4UEWA 1N2JA 1ETHA 3Q6IA 3HXMA 4D26A 4GL2A 2FUCA 4Q4JB 1PR2A 5D85A 2WAOA 3TEFA 4BN4A 3PJFA 2ENUA 4JA0A 2ZIZA 3B6MA 2YJ5A 4QQ8A 2CDNA 3DEFA 2WYWA 2LDBA 2G67A 1NZJA 3MQ4A 2I6GA 4OL9A 1THTA 1BVRA 4CMIB 3LP6A 3ERCA 4XDZA 3IO3A 4PPYA 1TL7C 2DP4E 3WWZA 4IMRA 4M88A 5AR1A 1RXYA 2AS0A 3M4ZA 3P0FA 4WDRA 3ACCA 3SYNA 5JADA 3BN3A 5CURA 1ICIA 2B8NA 2XTZA 1EM8B 3JWJA 4MX8A 5HKBA 5BO5A 4CLRB 1JG6A 2FWRA 4Y8VA 1QFXA 2AN3A 2QE7D 2A5FA 5A7HA 1K66A 1NI4A 3A0RB 1G63A 1GL7A 2VC2B 2CLCX 3L7JA 4JMPA 4PPNA 1XQVA 721PA 4XR4A 4G09A 1EJ2A 1HT3A 4PLVA 3ZTYA 2J5RA 5K8TA 1XTPA 5K1ZA 2YQZA 3VGPA 1L1RA 2PGJA 2ZZKA 4HZUA 1N6PA 3VSBA 1H2BA 1LSSA 5LDHA 1NF9A 4C0JA 4B7XA 4IF4A 5CEEA 1L4EA 1U28C 1Q16A 1YB6A 4PPQA 4OAPA 1WXEA 3UT6A 4JR0A 1LPPA 3UQYS 4HUTA 4F6LA 1NAHA 3PDHA 3WB1A 3QVXA 1EXVA 2VPWA 5K9ZA 1I0LA 2W22A 5KIAA 4UMVA 4RX1A 1L1FA 3R9KA 1FQWA 4OQFA 4EX6A 4KV9A 5AVWA 2AZXA 3I01A 4IW3B 3CNLA 3ZS8A 2UYYA 2V6BA 2VHYA 1R4NB 2Q9UA 3I6MA 3FBTA 4YS6A 4Q82A 4HQRA 4B3XA 6NULA 2XBMA 2IYEA 2AC7A 2J9YB 4OP1A 1OH5A 1Q91A 4IVQA 1C8LA 2JD1A 1HLDA 4NX2A 4O0MA 1IZ0A 1O4VA 2BKEA 4PQEA 3WK4A 3KWFA 3UOWA 1ND6A 1Z4JA 2GJ4A 2J31A 3A6GA 4O4IA 2QQ0A 5ELLA 3T5DA 3M4XA 4WX2B 4ENQA 3IOEA 3CE9A 3GJSA 5AK0A 5H81A 1N1EA 2X9GA 2QTWB 1VOTA 4CV3A 1H0HA 3KQKA 2Z1MA 1N36B 3G17A 4X6UA 1D2GA 4E70A 4ER6A 3LK7A 3CUUA 1NAIA 1ZGCA 3A9WA 1VPDA 4DYVA 4NZZA 4DLZA 1Z6ZA 4INJA 1V37A 1PKXA 3PC6A 1KE2A 5CYGA 3DBRA 5KQRA 3A28A 1G64A 1Y4SA 3C43A 3PSHA 3ASUA 4FWIB 2WTXA 4EI9A 1U2EA 2I3GA 3FR7A 3NWPA 3OLVA 4OMCA 1HR0B 2NOAA 3HJBA 1QFJA 4CM9D 2BFNA 3ILVA 1YFLA 1RPZA 1EVZA 3AY6A 1CQXA 1NASA 1NT4A 2Q21A 4WOJA 5FLKA 1O0SA 1YDGA 3R41A 1X9IA 2JFXA 3OWHA 1KIMA 2PGOA 3PC4A 5E9AA 1O0BA 4YP9A 3U4AA 4HYEA 4NENB 4RQAA 2Z8YA 1VA5A 4YRBA 2OFFA 4MS3A 4NBTA 3ZG6A 4DM7A 1XXHA 1XD9A 3ADCA 1UWLA 1KU6A 3EMDA 1XJCA 1Z39A 2XWSA 4JASB 2X0NA 4OSEA 1DL5A 1GG9A 2OBFA 3FXAA 2E4WA 3TGWA 3EW7A 3AVVA 4XUGB 1QTNA 5AVTA 3M9XA 5H80A 1I7QB 3BGIA 4RK6A 2OV1A 1EFDN 4CN9A 4MB0A 3IIKA 2C2MA 4KR2A 4KFRA 1BE6A 2R97A 1T8YA 3BSWA 3TK1A 2NIPA 1PDOA 1KMHB 1ENOA 2ZSJA 3DULA 3M82A 4OYLA 1XKTA 1QFYA 4MUMA 1YHYA 1W59A 3EZ2A 4MCAA 4P38A 3I1JA 1DBPA 4IPTA 4IKOA 8GPBA 4ZQEA 4J0HA 4JB3A 1VYUA 4PEVA 4N03A 5B1DA 1YE3A 3K32A 3E53A 1X1CA 1UC8A 1R1DA 3HUTA 2R1VB 2W0SA 1MOQA 3OPVA 4B2YA 1PJCA 4ANFA 4ZMBA 1MB9A 1VG8A 3Q7PA 1CV2A 2Y9MB 5TPWB 4MPDA 4M1OA 2FMXA 4JOSA 3HMKA 5F1KA 5LXTF 2Q2VA 1IEWA 3X2FA 6ADHA 2YV1A 1LUAA 3HDHA 2JDID 5EIHA 3N86A 4ICIA 1NRWA 5LM3A 4INPA 2R62A 4LX0A 3SIRA 1EFKA 1H8ED 4CT5A 3U48A 1EGQA 1M1UA 3MRTA 4G1EB 3LVRE 4TMXA 1UKBA 1Z88A 4KCGA 4GKAA 2QMHA 2G7ZA 4EZIA 1G8FA 5I5GA 5AESA 2QJTA 1A8HA 4RXUA 4KQIA 3SYRA 1AGRA 1AE1A 5G0TA 4LMAA 1HF3A 1QYRA 3B3JA 1PV1A 1KH1A 3IE0A 2ZI7A 3EG5A 3LQFA 5EJ4A 5F4BA 3ABIA 4BO5A 3ICCA 2BFFA 2BFBB 5EZSA 3LWDA 1E9AA 1TF2A 2IELA 2M98A 3CUSA 4KLCA 4XFDA 5DGDA 2AN4A 4IG9A 5G1NA 5LQRA 3N76A 4IDCA 5F3WB 1NV8A 2X4GA 1OH6A 3TZQA 3NALA 3OZAA 1NRJB 3PCTA 1VCHA 2XE8A 2ZVQX 2DSNA 2XYPA 4GX1A 1RWPA 3BHMA 1RRGA 3D8BA 4DUGA 4OI0A 3ZCQA 1N25A 4MQ6A 4CLOA 1ZONA 1O5IA 1H6CA 1CTQA 1YDFA 3K20A 2A1TS 4D82A 5BNFA 1TGYA 4FHZA 4M9CA 3GUHA 5AM5A 1ZH8A 2P6NA 1X7ZA 4E09A 5JO0A 2QMUA 4N8EA 4QUAA 4JLVA 3IP6A 5CT9A 3CTPA 3GLQA 2IYFA 2XI4A 1WEKA 2EKLA 4MB6A 4BBZA 3AHIA 2V4ZA 4JLDA 5HBRA 3P8ZA 4DIFA 1LPMA 5I4BA 4RADA 5A4FS 1PEAA 2H0QA 2ZRQA 4PR3A 2QN2A 5AVVA 3C1TA 3UXHA 3D6UA 4H59A 3S55A 2XXAA 2Y1LA 5BWBA 4ER7A 4H7JA 4YMIA 3SSOA 2PUTA 1NVWQ 3F98A 1D6JA 1ENZA 1NSYA 1Z4QA 3IUPA 5FYQA 4EQ6B 1ZAKA 2YL2A 2FN7A 1W4BA 3B3QA 3WRYA 1BEZA 5G0VA 5KQGA 3GYBA 3C41J 6REQB 1ZS9A 4MQUA 1ORRA 4MI3A 5K5EA 1U9ZA 4PBSA 3EY4A 2F9MA 4P4SB 3B3FA 4EHAA 4QWWA 2BY4A 1E3EA 4RIFA 4CIBA 3JYOA 4C7VA 2ZULA 2J1LA 4L4ZA 2P9TA 1MT0A 3NDBB 2EZ9A 2Q62A 3VPXA 1QH1B 1TK2A 1W8IA 2DWPA 1WSDA 2XNSA 4Q3OA 5CUQA 2JGJA 3JPWA 2R6HA 3NBAA 1Z47A 4KOEC 4P3XA 4WACA 4U1RA 3CG0A 3QVLA 4MW0A 3C2QA 1HYBA 3CZ5A 3GT0A 3LT0A 4HR7A 3W4IA 4DKJA 3A9CA 3PHJA 1EMDA 3O47A 3P9PA 3P2KA 3FCXA 4MEJA 4V3BA 3HJGA 3T9BA 2PZEA 1R74A 3FTFA 3R9WA 4QFDA 3LKZA 4HEA1 2F3RA 1O89A 3KKEA 3QXGA 2HCRA 2C2KA 3D54D 4KNWA 4BCCA 4E21A 1UANA 5EINA 3UYKA 1L3IA 5SYNA 2FSGA 5AVRA 1BS1A 1GU0A 3T1VA 4W5RA 1SURA 1WMFA 4O2BF 3KELA 4JR2A 2IYSA 2ZJ4A 5HQ3B 3K0CA 5JD4A 1KC1A 1Z4PX 2YFHA 2DXIA 1DHTA 4YREA 5HYVA 4RCYA 2GNOA 3EAFA 1IQPA 5KBYA 2DKOA 1SIWA 3BCHA 4L15A 4UASA 3OFJA 4YAFA 3WR5A 4D81A 1CY2A 1P9NA 1QE3A 5BVHB 5CBPA 2AVDA 1RYDA 1SG9A 4BFXA 2GKGA 4DV3B 4XWKA 1RSZA 3T7TA 1AGNA 2I1QA 3WNQA 1AKYA 1FFDA 4GM4A 5GM2A 1NW8A 3WAKA 3QOWA 3T15A 5AIBA 5C52B 4DB4A 4P7BA 1VE3A 3BWYA 2PGIA 4CU2A 4RUKA 1PQWA 3PPYA 4HD8A 4NFSA 4EHFA 3W5UA 4RA9A 1KI3A 4D0LB 1NJ2A 1K86A 1TTHA 2EKQA 4JVMA 4S35A 4BNUA 3CF4A 2FPPB 3O4RA 4DTIA 2BTQB 3R5FA 5KNCA 2QKYA 3ZW7A 2G0AA 1GILA 2HIGA 4GI7A 4TLMB 3QFTA 2GMWA 4BLPA 1E0KA 3W2HA 1IHDA 1QH8B 3A1UA 5K3BA 4GOXA 1AB5A 3AWDA 3EIWA 4NZPA 4Y2HA 4YRSA 1OWOA 1TLFA 1FNNA 3H5VA 5KYKA 4ZQHA 4ZVNA 3ZJVA 3UK1A 2WT4A 3TOZA 1WNFA 2N42A 4QQFA 1XOIA 3UJPA 2QBYB 1KC3A 3OIUA 4G67A 4AKIA 2BEWA 2G40A 3MW8A 4JL8A 5K3AA 4R1NA 4MLCA 1QQTA 1G55A 2BCGY 3D3WB 3R5TA 2IYWA 5EP4A 5IK2A 5IABA 3UMJA 3GJZA 3LF1A 2RGNC 1XNJA 2IHZA 1GA1A 3B7GA 2IXEA 1NUQA 3DTYA 1SU6A 1L8OA 1VE5A 1XQWA 4NICA 1BCRB 1D07A 4PF1A 3PITA 4GE3A 1VQ1A 1FW8A 1OX4A 1T2CA 1UMCB 3OE5A 4CV1A 4Q19A 2D54A 4F46A 5KSWB 1ZBDA 4L8FA 1L4KA 4NBVA 3ISJA 4BV2A 2BTQA 4X95A 1VLVA 1EFVB 3KOXA 4OTZA 3ZIUA 4CJXA 4CKCB 3FRHA 2F3QA 3HB4X 4R0NA 3SR4A 3CPHA 4JBXA 1IM5A 4PAGA 4DMGA 2HQRA 2YC2C 3NXKA 3W5HA 5FI5A 3H9CA 2Z3ZA 1CUVA 3OZSA 4JD5A 3S70A 3X1ZA 2GOYA 1T3HA 1X1SA 1IBKB 1T9BA 4A2WA 1ZWKA 3AERB 3B7WA 2JPDA 4MQ4A 4F1WA 3A8TA 3EIUA 3V2GA 2A5GA 1XCBA 1IM2A 1V39A 2W4MA 2Q27A 2VUIB 5L3QB 4EPRA 2XE7A 1Q6ZA 3LCCA 4BFYA 1Z73A 4WBNA 4V2UA 3W8DA 2AFHE 1CYEA 5B12A 4D45A 2W11A 4AY6A 4BVEA 2O57A 2Q9CA 2W9XA 1IJFA 2OHXA 2YV5A 4W5OA 3U3MA 2J7KA 4I9NA 3K6JA 5DYNA 2QLMA 3BMCB 4BIMA 2Q49A 1RZRA 1IY9A 2B7LA 1RAAA 4WKBA 2Q46A 1ZEMA 2PX4A 3HP7A 5G02A 4WA7A 1H8HD 4WXYB 1RXVA 1WDWB 4JLSA 2V7QD 1FE8A 1XZDA 2FW7A 2ODTX 5KWIA 1P3Y1 3F7TA 2IEIA 3NYWA 3FCUB 2OD2A 3K73O 4JC0A 3I28A 3OM0A 2UZ1B 1IN4A 1BD3A 2J41A 3C4JA 4G1VA 4ZOLF 5E3IA 5CDGA 4TTVA 4PAMA 4QJ5A 4QDZA 3KLPX 3KJZA 3RR2A 4GKBA 1JWLA 3NW9A 3P9CA 3CZ4A 4OIMA 5BN4B 1TM3E 3R7LA 1U8AA 4C78A 3GZ4A 3DMPA 5AW0A 2W6OA 5L4LA 2GO7A 3QYJA 3G0BA 3MVEA 3EA4A 1USWA 4G4GA 5F12A 1WKVA 5IC5A 4QNNA 4BWGA 2FQQA 3OCUA 4G5XA 4MDHA 1TYAE 5IN4A 1EU1A 4KXLA 1TCBA 4ZZ0A 4IJWA 3I4FA 2E4AA 1A95A 1DADA 3TD9A 4BB5A 1U4SA 2AQHA 2HJRA 4O4LB 4US1R 4JI1B 1IWOA 2EJUA 3A26A 3ZW8A 4JBIA 2CFTA 3MCAA 3HJFA 2NVUA 1GP2A 1Y8ZA 1JDBC 1XF1A 5EIFA 4X00A 5F2OA 1JP7A 1ZVQA 2DTEA 4FYHA 4LRXA 4UE2A 4BKQA 5C8XA 2IF2A 3IR7A 1G8GA 2XUHA 4IIEA 5EJ9A 2XMZA 3MF4A 1P4RA 5BT9A 1U1FA 2CT8A 3WLMA 2BL4A 4AXXA 4FYYA 1R0XA 2HDNB 4LE2A 2K6GA 1ST3A 3A11A 3H1EA 3CX3A 1NYTA 3AR7A 3AI2A 2P5UA 1OBCA 3PDUA 4JBHA 1FXWA 3OG9A 3OU7A 1NHGA 4RHTA 1HA3A 4UDXX 2V5VA 3DVAA 1MB2A 4BEVA 4QTYA 6YASA 2PVSA 1HQCA 3FTPA 3TMYA 3DAYA 2EBFX 2FJUA 2G4CA 3BKXA 3X3HA 4TMKA 2B82A 1Q1NA 3WE7A 3P0EA 1YZUA 2Y1EA 1XZGA 2FG6C 4ARUA 4MVJE 1B26A 3C1OA 4TKVA 4LY3A 3IP3A 5JDIA 1NJ5A 3VOBA 5JNLA 4UNIA 2EIXA 1OXKB 4A26A 2A0WA 3KDAA 5IJWA 2M9MA 3RK4A 1IUOA 1VYHA 3MT7A 1KQFA 2CLFB 4G3XA 1F3LA 3BWVA 1YB1A 4Q7EA 5HDBB 5AI8A 4YAIA 1OF1A 1XL0A 3OQBA 5EQTA 5JYDA 2K2WA 2PLRA 3Q3VA 4RNDB 4IOMA 5TARA 3QBEA 3WXBA 4M36A 2R8ZA 1ZNWA 4IXNA 3R3VA 4W7IA 4CIDA 2AFHB 3PX3A 2XPCA 2ICAA 3D31A 5JH7F 3K5HA 3RRYA 4DMHA 5ALHA 2BGWA 2JCBA 1X1AA 3KVVA 4OPMA 1E1QD 5FLXA 3QQPA 3P2IA 3W6ZA 3OQMA 3HUUA 1FNMA 1XCLA 2ANCA 2NQ2C 3NV7A 1XDBA 2R11A 3NYQA 4Y6QA 3SIPA 2A92A 2CNLA 4R2MA 3NHMA 3TL6A 1GFWA 4B3SB 4RDXA 4YAGA 5HPYB 1UBRS 3M3PA 3GL9A 5EFZA 4G0VA 3GHYA 3HV2A 1PI3A 1XF9A 3OJEA 4NBNA 4LZJA 2D2FA 2KBEA 5AJUA 4C0BA 1U3UA 1EJ6A 4C0HA 4IDQA 2OHJA 1IUNA 1G9TA 5JYBA 4CI0B 2DH6A 3F8TA 1KMMA 1NMEA 2PNFA 2RHWA 5CIWA 5AW5A 3T5GA 1B3RA 3E2PA 4CEHA 2Z4SA 1LPAB 4XEHA 4ZODA 1YZGA 3X2EA 1C3JA 3FN4A 3RE1A 5EPEA 1YMQA 4MUYA 4N9QA 3VUEA 5BR8B 3H2GA 1P1HA 4TRMA 4AZTA 5BRAA 4FB4A 3GA7A 5B1HA 3RVJA 3GLFE 3A1CA 2QTGA 1WZCA 4RS4A 3SFZA 1PX2A 1GPYA 3PQFA 2ZUCA 4AJNA 5JH7A 4PYKA 1SC9A 2B37A 3AQIA 3EGIA 3M6IA 4KVFA 3ENZA 2WSLA 4LXIA 1WMBA 3OBBA 1S8AA 3BVPA 5JSFA 4M0KA 2AIRA 3L4BC 2P4QA 3H6HA 3HWSA 5KKAA 5KDLA 5BSEA 5J4LA 1NI5A 3EA0A 3LIPA 2YUIA 4B9AA 2DT5A 1B8VA 1I4OA 2HRQA 4E33A 3L0DA 1EK1A 2X4IA 2JL1A 1PYGA 4XD2A 4ZHQB 2CB0A 5FXMA 2B78A 1E4EB 3P2EA 4G85A 4NBWA 4RTPA 2ZFUA 2G09A 3GGCA 3HGQA 3WBKA 4C7XA 2LV8A 3BRCA 5F64A 5DNDA 3PJEA 1U2ZA 2EX0A 3DLIA 1AXRA 3EZXA 1EVLA 1V16A 1YDHA 1FUYB 3LCVB 3PQ5A 4ILEA 1T3TA 1J00A 3PQEA 4RXMA 1T5HX 5DM1A 1E9VA 2HT1A 4FBLA 5IEJA 1KY5A 1I0ZA 4AWXA 2P9BA 3N2LA 5LN1A 1NMYA 1X42A 1BVHA 4CG2A 4X97A 5K6TA 1T9GR 2XB6A 1ZOOA 2CFOA 4XLZA 1VLQA 4X94A 2QW0X 2XDQA 5AW3A 3PWTA 5DTEA 3PTAA 1DV2A 4FE3A 3UKJA 3VVMA 1AU9A 1QHSA 1KOFA 3L93A 1RT9A 3IOBA 1O9HA 1M7HA 1BMQA 1A9QA 4OXQA 4M9ZA 1ACLA 2NZWA 1SQ6A 2ANBA 1HYGA 1RI3A 1C7QA 5HKKD 2AX3A 3SQDA 1N1DA 2QUIA 3PUKA 1Z12A 1U2QA 3ETDA 3QVOA 1FUEA 1FTGA 3IALA 1ODJA 4UCFA 4F7WA 1CLEA 2PEYA 4IX9A 2HU8A 2JAPA 1JX6A 3E9ZA 2R4QA 4AN1A 1U99A 3L43A 3V2IA 1Q95A 5T4HA 3WMRA 3ADBA 1G8KA 4H4EA 3IURA 2EEZA 1CIPA 1CP2A 2V7PA 1AGPA 2RDMA 2WAMA 2C77A 1ZHOA 3R9XA 1HE8B 3OEEA 2AT1A 3IAFA 3OQ1A 2PKQP 3WLTA 2QVXX 2JHAA 3A3YA 2V7EA 3NBXX 3OCVA 5UKDA 3T7EA 1R0KA 3AX6A 3VR3D 3HRKA 3GA0A 3AVTA 3BH6A 3OQ6A 3V8EA 3WFIA 4Q24A 4BAZA 4P93A 4M21A 4NCXA 2H2AA 1GEEA 5CVVA 2PBLA 3ZE7A 3ORSA 3RD5A 1X19A 1P19A 1GGNA 4O4JA 1G21E 4E3WA 1ZNQO 3UT0A 2JJQA 2R87A 3OQHA 3OX3A 4A3SA 3ND8A 2H1RA 4D25A 1CJBA 2I62A 1L8LA 1D4ZA 2OD9A 4C6HA 3C45A 1V8OA 4F97A 2QAGB 1JPVA 3V4OA 1M5UA 2GZ2A 2GPNA 5F3RA 4KKVA 1C30B 5E7MA 5BSKA 2ROQA 4AKSA 5H68A 2P75A 1IY1A 3A36A 3VC3A 1CUUA 3R6DA 3SFTA 5CD9A 2MIIA 2PWZA 3OJFA 4ZVOA 4WA8A 3M4JA 1K6EA 1KDZA 1U9CA 4FVTA 4RHYA 1J8DA 4EAQA 5M5BA 3N0VA 4JELA 4KSBA 4MVJG 1Z2PX 5JLAA 3UOAB 3P20A 4A1FA 5CYFA 3ZDDA 3ZD9A 2HWXA 5EZYB 1L6IA 4B45A 3OPYI 2DFVA 4P33A 4I1IA 1JJIA 3VNSA 4A16A 3AI7A 4NHOA 5HFNA 4BLRA 4E4RA 4YMHA 5LP6B 1WUYA 4YRIA 3H1BA 1RJDA 2X5KO 4GDMA 2GM9A 3C5EA 1FUIA 4BGEA 1GGEA 4QOSA 1MW8X 2H2DA 1EUDA 1CQJA 3E27A 3VRHA 1PT7A 3AR9A 3THXB 5B3AA 1P1KA 4D8VA 4S2UA 1B16A 3EDMA 1UFKA 4MS4B 4L57A 4HADA 4XYBA 3TX2A 3WIVA 4ZCTA 2ON6A 2HNKA 1ZCAA 2ZKIA 3IPXA 3FOAA 5IDXA 1XK7A 4CFZA 3T54A 1LPBB 3HCEA 4K28A 4HVCA 1MEEA 1GLNA 4X6XA 2HD4A 5EJ8A 2YWXA 4UEJA 5I01A 2ZIAA 4Q4DA 4B6RA 2C3YA 3MMPA 2AOTA 4C2AA 2JI8A 5IDQA 1C3OA 1I5RA 3EA5A 2O3SA 4FUQA 4N3GA 3VKVA 1CCWA 2VLBA 4ZQIA 1BJTA 3DV9A 3DDOA 4FOTA 3REFA 1I3CA 3HL4A 2DGDA 5CYOA 4A7PA 2DH5A 4HDMB 2IDJA 3ZHOA 3UJ7A 3PE6A 4ARVA 1TMGE 4DT1B 3AEXA 4ZT6A 1FMFA 1LA2A 3RCBA 4H6XA 4Y9DA 1SY7A 2O3QA 1HDZA 2O7RA 3EEOA 4Z6KA 4F2GA 2ZXUA 5KTSA 4ZT2A 2HRRA 4WXEA 4ZHSA 1H8EA 3JY6A 2WTUA 2APJA 1N6OA 1FFXB 5DLDA 2EJCA 1UJ5A 2XT0A 2PFGA 3ANNA 2HSDA 3G1UA 3GLUA 4I55F 1KFBB 1BRTA 3JCZA 4ND6A 2FDXA 5EUQB 2VZ9A 2I1LA 1UP7A 3WLOA 2I2CA 4ITVA 4RD2A 3G2PA 4ACBA 1QYIA 1QK4A 1JLRA 1J42A 1M75A 1XKXA 2H1OA 1RR6A 2I1VB 3LOQA 4ZEXA 2V3CC 3OO0A 1QCZA 5B1IA 4Z4FA 1MFZA 4HBZA 3WDLA 5CYPA 3WYEA 3DS8A 5KNBD 3BXOA 1L7MA 5FT9A 3OETA 3WOVA 3KPVA 3RI3A 3MYRA 4EUEA 2PCJA 2EG9A 1DEAA 1M1NA 4GGOA 2P90A 5TF0A 2IT1A 1YOVB 2D3WA 2RFLA 2QZZA 5HIJA 2CMGA 2GK6A 3RIXA 3W2EA 2R0QC 3NNSA 3VJLA 4H1WA 3NANA 1SXQA 2C1ZA 1QHYA 1WXXA 4EW6A 4ARAA 1AK9A 1LXCA 3QPVA 4P1ZA 3LCMA 4EI7A 2QTFA 2W83A 3HU5A 2XVYA 2YOGA 1JBKA 1GGMA 3KHTA 1RQ2A 3IVGA 3TEJA 2G7MC 1YE8A 1MG0A 1NJ8A 1Z75A 2HJVA 3L0SA 4LYAA 2F3TA 3FHTA 2XF8A 3C6YA 4C4OA 3F0TA 3LH5A 4H3KB 1GPKA 2BVNA 3WQHA 4HLUA 5TEVA 1P4HA 4ZVUA 3Q8LA 2QX6A 2H7XA 1QYDA 4NU8X 3T0FA 1H69A 2QP4A 2F3SA 3PRJA 4RAOA 4D0NA 1ILWA 2WG2A 3Q1KA 5IJ9B 1BMFA 1HGXA 2HDHA 1B42A 3RSCA 3V33A 1E3JA 1RXEA 3DDSA 4HN4B 3SEFA 1XIVA 3Q9SA 3OPMA 2RGUA 1XEAA 1PE0A 3VKFA 2H5IA 4QASA 2OGWA 4IVNA 2WWXA 2YV2A 2ZIGA 3OTHA 2VHTA 3HJHA 2AKEA 2Y3IA 4IICA 4BKMA 4MVJH 5I8WA 4ETWA 3AY7A 4X1KA 3QU4A 1XL1A 3ZV4A 5FNZA 1Z5WA 4N47A 1JQJC 3PB3A 3ML1A 1SOVA 1H1LB 4D9JA 2VKTA 3VU9B 3TW8B 1B43A 4EY6A 4EARA 5ES4B 1OY1A 4PSDA 4K26A 3ZOZA 2FUEA 2IPAB 4WY5A 3KOZA 2WHQA 4PG5A 5THQA 1T8SA 3MFYA 4NRDA 4EB6A 3D1LA 4RE5A 2VPZA 3RJMA 1H1TA 3CR7A 3R6LA 1DELA 1JHVA 5CIYA 1ZH6A 1CQWA 4E51A 2IPOA 1RNLA 1IL0A 4LXQA 3HJNA 3RVSA 3SNHA 1KI8A 1XNGA 4S1NA 2D5AA 2WWRA 2PUEA 2DFDA 4XGQA 3B2EA 4BECA 3TXYA 1E3IA 4XYMA 5AI9A 1ZGHA 1YTLA 2EZTA 4YP1A 3MSCA 1ECCA 4FEEA 3FIUA 4CQMD 4IO1A 4KN8A 4RM2A 5DP1A 3JQDA 4FS8A 4ITRC 4NESA 4R84A 2N1MA 3T0IA 3BT7A 1ZC4A 3ZWYA 1W25A 3M70A 1W52X 4U8HA 1RMYA 2QUBA 5ILOA 3ZD6A 1VSBA 5H3HA 2O2XA 3BEDA 3KC2A 3BIJA 3MBOA 2GF2A 2IYZA 1U3CA 1KK0A 1P5FA 4K3VA 1W49A 2ODEA 3RYCB 3TW4A 2QE7A 1TF5A 3D8NA 4YMLA 1QV9A 3ME5A 1P7ZA 4B33A 1A69A 3B5IA 2OG2A 4DM4A 4H6VA 2ORYA 4UAUA 1JHRA 3TPCA 1ZD5A 3C98A 2ID9A 2E89A 1EB8A 4J7AA 3NIFB 2CXPA 2YWBA 3H3FA 1NBIA 1C4WA 1XJ5A 3TFWA 4QUGA 3K72B 3ZBQA 4CCSA 2BSXA 3STUA 1Q14A 3R23A 1H2AS 4ID3A 2YZ7A 1O8CA 1TYBE 1W9HA 1LU9A 2JAUA 1CS0B 2X3UA 2J9FA 3GYGA 5KYUA 4AECA 4BU0A 4HLQB 5KI6A 2GA8A 2GXUA 2PWAA 4B34A 1IXYA 1ZYUA 2W8ZA 1GG5A 4I6JA 3ITEA 3FNQA 1OWNA 3RVPA 2C4KA 2WMDA 3MJDA 4EB8A 5LXTA 2ZITA 3NOVA 1QM5A 5IM4A 2ZSEA 4H6WA 3VJMA 3ZYCA 1G2PA 4YRDA 5C32A 1TVMA 3C5CA 3T7JA 2WD7A 3EEQA 4JUFA 3HRIA 3M33A 1KS2A 1JDPA 3HFGA 4ILKA 4PYMA 4B4OA 4EVIA 4EY8A 2GD1O 1JKFA 4OX9Y 2Z2JA 1SUFA 4LXXA 5ITWA 1QHIA 1YK0A 1ID1A 3OZRA 2C59A 3TN7A 2HC9A 2FYTA 1ZHHA 5KJFA 2CVFA 3KO8A 1XWIA 1MBZA 1CUJA 5CIQA 2VAPA 4J07A 1JFTA 4NECA 4RFSA 4W9RA 1NJFA 1G17A 1RCFA 1N6LA 3V97A 3AVXA 4IV5A 1GU7A 4KR0A 3UF0A 4ZI3A 4LRWA 2CLIB 2D8MA 4BQFA 1DBWA 1PSWA 2J5KA 2NUPB 3RJ9A 2Q5OA 4XX0B 2QT1A 4L3OA 2ZUBA 1OLSB 4R05A 3QFCA 5JNTA 4MYTA 5K05A 4EPWA 1OZFA 4AD8A 3EGOA 5LFAA 3AJRA 2HHHB 2F6RA 3MWFA 4U39A 1ZSVA 4RH3A 1CQPA 3NZEA 4ENSA 1UC9A 3IP9A 4HDQB 4PYNA 1XV5A 4EEKA 1UBOS 2ESRA 3AOEA 3FA2A 2FW6A 3FNRA 4OBWA 4ZIRB 1OUMA 1FTQA 2VJYA 1JKJA 2ZE8A 2ZYGA 3L8EA 4YRJA 1FOEB 2QXYA 1XDGA 2VP5A 2G76A 5CT5A 3TEMA 2ZRCA 2OO5C 1GL6A 4LAFA 1FFSA 4BVHA 2BM1A 4NG5A 2RMKA 2WILA 1QMGA 2F3PA 2FLWA 3H9GA 1J0XO 2GD0A 3VH4A 9ATCA 3GBPA 4JSTA 4OGWA 4DUYB 2PKCA 2Z83A 4BQQA 4IMIB 3U17A 1Q2XA 3UMYA 2RSLA 4OYHA 1ZCBA 2WLSA 1NJSA 4KRFA 4HL6A 1ATZA 1MW9X 4KQFA 5KYUB 1EAYA 3OQJA 4P3PA 3R74A 2WHXA 3CH5A 4OHPA 2H65A 4GR5A 4IL5A 3ET4A 3BB3A 1NN5A 3Q0EA 1GAWA 4MHOA 1ZJ4A 3W5DA 1NBOA 2VN8A 1KORA 2IU6A 4OP2A 3SC3A 4KAAA 2AG0A 4M9UA 1D2AA 4B40A 3BFXA 1CJVC 1E5DA 4XD7A 3DBIA 3UG7A 2R1TB 4FCCA 4Z2YA 2FN4A 2OB1A 1U0TA 3ZCRA 2Z2ZA 4ATNA 4O1HA 4EUKA 1SMKA 5M04A 1Z37A 2E87A 4PM4A 3U3RA 1GGHA 1LLUA 1E94E 1QWOA 2XDAA 3N6VA 1DVRA 4YJGB 2I4IA 4NARA 1PX0A 2CUTA 3W9YA 3WP0A 4OHMA 1TLLA 3C3WA 1QLWA 3L04A 3WI7A 4ZO4A 4FYXA 1KQNA 3RG8A 3FE2A 4F71A 4FQ5A 3IMFA 4R1TA 5TXGA 3W5BA 5FBQB 2Z1DA 1MEOA 4RKQA 2DMRA 3GK3A 4J0GA 3UTDA 4ZT5A 1K6XA 1ESEA 3JVEA 1NX9A 4V1CB 3H2SA 4KO4S 2PSHA 3EXIA 4BFUA 2QTBA 3J81k 2KLHA 1EFUA 4HNAB 4OI2A 5TT0A 4D9NA 2D06A 4OQZA 3IQZA 2JJYA 1G9SA 1KWGA 3A4NA 1H8HA 4J0EA 1EUCB 4NYJQ 5AO9A 4DR3B 1A4UA 4GX2A 2R4UA 1RZRD 5AHKA 2X0EA 1F0NA 1ZIOA 1JDZA 2X0DA 5I8PA 1C0IA 1RXWA 2RJOA 1H6AA 2J33A 1RJ9A 2WJGA 4C89A 1JB9A 2TRSB 1RJWA 4I5IA 7MDHA 2ZSUA 4ZVLA 2BGTA 5HMMA 1YR6A 4ZC8A 3OZWA 2FR0A 3N0RA 3LWNA 3ZV7A 4A6EA 1WABA 4L76A 4OM8A 3V1LA 3FSEA 4TWAA 1ZI6A 1PFKA 2BZ1A 4I5FA 3CPEA 4N6NA 4DM3A 4DV6B 2H1CA 2PAAA 5HE9A 5JNUA 1GADO 2OILA 1KZGB 1TECE 2J3DA 2YHBA 4NP6A 4QVKA 4AWBA 5H1YA 3S1SA 4WFKA 3G9QA 1KEVA 5BSFA 3DZJA 3EFEA 4LJSA 3AGQA 3OZTA 3BJIC 3VU3A 2F4VB 3KQSA 3P4UA 1GAJA 2XQIA 4MJ3A 4YMSA 1PZFA 4IINA 1YFZA 3L1KA 2D62A 1SZPA 2AC2A 1UPXA 3L84A 4MZXA 1GPH1 2XQKA 1PU2A 2QTVB 3DUWA 4B81A 1RE0A 3T3IA 1T2FA 2XCOA 3HLTA 1N5JA 3K0EA 3O3NB 4NMHA 5T6BA 4CM6A 4KGZA 3K1TA 1W93A 3KJFA 1VKRA 5DHRA 2AXQA 1R8QA 5LB2A 1TEVA 4IEEA 3L1VA 2MSWA 4FZRA 2N9UA 4BE7B 4PWYA 2IYAA 3QUAA 5HGXA 5K4HA 1EZ4A 3RODA 1ZVVA 4ZV7A 5JI2E 1OYVA 4JXXA 4R9SA 2WR8A 3JYQA 4K9QA 4L5YA 4B2PA 4KO2S 2ZE6A 4MVJF 1ZSYA 1OXUA 4ED9A 5JNVA 5J3JA 1KZYC 2EBWA 3BMQB 3L8CA 3BIWA 3VSCA 1P1JA 1QSGA 1OPRA 4MP6A 3ESYA 4LHXA 4EITA 1FY2A 1M8KA 2JRLA 3BXGA 3H04A 1P0FA 4XM0A 2Q4DA 3CX4A 1LTKA 4IVPA 4LI0A 3T9DA 3TSYA 5F5NA 1LV8A 1SUAA 2AZMA 3GWZA 1Q2UA 3U62A 5DYTA 4ZCRA 1TU3A 4ZAFA 1OIWA 3C3CA 2XRYA 3LTNC 2O8EA 3KSRA 1FRNA 4BNHA 2ZATA 1RTTA 4DA6A 5GTDA 2LTAA 4KR7A 2HQBA 3O38A 3I5XA 4Y9UA 5LZ9A 1WXHA 3FUWA 3I42A 2ATEA 2IVZA 1LDGA 2A58A 1U8TA 2UAGA 2G4VA 3VFDA 1G2IA 1XNHA 3WMGA 4M83A 1PFGA 3IVXA 4B7CA 2BEKA 4G6ZA 3PDIA 5FI0B 1N32B 4M1KA 3OAAD 3PZRA 2ZS9A 3MAJA 3QFHA 4YUZA 4KUEA 4BRSA 1ZW6A 2IHVA 1CERA 1R10A 4O3MA 3I92A 3A2LA 4CEIA 1K7CA 1OFTA 1PD1A 1M7GA 3QPCA 2DLNA 2FK8A 2HL6A 4UFOA 2GM5A 2YJNA 1MX1A 1NKSA 3GV0A 3PEYA 4LK2A 5CA1F 5CXQA 4D96A 1OBFO 1RXIA 3BE6A 2ATXA 3H4VA 3HCAA 3REOA 2VS1A 3ZNNA 1CY4A 3T4XA 3DOEA 5LZ2A 1KYZA 3T34A 1FS5A 2HCFA 3R24A 3KCNA 3OA0A 1XCOA 1PSDA 4M1YA 3EE6A 5BR7A 4KSCA 5LQAA 4JJ4A 4ZXPA 5IVDA 5D8DA 3QOXA 1OT5A 4RZ3A 5DI9A 4YYEA 2HYIC 2PL9A 3EUFA 5IC6A 3IJEB 3WRWA 3CZ9A 1AS0A 3BJZA 2ZWVA 1GM5A 4YJKA 4W5NA 2C42A 8ATCA 2FZ5A 3CNBA 1NUUA 3DE5X 3DW3X 4HXYA 4EW3A 1ACMA 2G6TA 1RCUA 2YKGA 5DYWA 2YN2A 4JUCA 1KP9A 4LDPA 4AZ0A 4EATA 2WZCA 4MHSA 4F91B 5AW4A 2P1ZA 4GMFA 3IIIA 3WGVA 3PNPA 3NFYA 4Y1GA 3QWFA 1R0BA 3TBFA 2QRKA 3QLJA 3BOSA 3IP8A 3LKDA 3KUXA 1XEXB 3HKBA 1CSEE 4M9QA 2H7CA 2IJGX 1SVNA 1V2HE 2CNWA 4K88A 3K5PA 4CL2A 3NAGA 3K2IA 1F6WA 3CINA 4ENPA 5HCIA 3E3OA 1E2KA 4JB2A 2WWTA 2YYSA 4BQOA 1FQKA 1D0VA 4YXWA 3RYHB 4LXHA 1O6FA 4BKUA 2H1WA 5BPFA 2NYAA 5T3UA 2LDXA 3L5OA 3ZHZA 1PS9A 2H9AA 4ZGWA 3P9NA 4FX2A 2J3LA 4RBNA 1JFRA 1VKNA 1NLUA 1RBZA 1V2GA 2FY8A 2O2HA 2VT3A 3JZAA 3QFRA 1S02A 2QRZA 3P32A 4JB0A 1T9ZA 4TTJA 1KE1A 4QGGA 1W4RA 2VJMB 4DDTA 3BRQA 5ILQA 2B61A 5KOIA 1XNQB 2B6NA 4TMWA 2CMHA 4NE2A 3EFOB 4N7MA 1T6YA 1BMFD 1MJFA 1PK9A 4JUBA 2BF7A 2DULA 2C1EA 4RQBA 4LN1A 3PIIA 1J8YF 3O4IA 2ALJA 2H1HA 1YR7A 2VP6A 4D8XA 4EH1A 1T2AA 2Z95A 3CC8A 3MJTA 4NE7A 4MW6A 1M2FA 1WQ3A 3H11A 3KU4A 5IAOA 1P2DA 3X2SA 1QYCA 3BL5A 2OFXA 3JD4A 4L8GA 4MGIR 2EBUA 3OOHA 4QPDA 4D9CA 4NXMB 3ZWBA 1M6NA 1AJEA 3H9JA 5A4DA 4OY3A 1SIOA 3E35A 4W6QA 4JC5A 4ALJA 4UDNA 5CPBA 4JYBA 1E1DA 2MSNA 1RYBA 2DLDA 5DX0A 1TYZA 4TL7A 4PE5B 3QXJA 5SYMA 4QUDA 2PR7A 4Y2UA 3ANSA 3DKRA 3B1VA 5FPPA 4KGDA 5JSQA 2PE5A 4WE3A 4JV5B 2BFDB 1T9KA 1JZSA 3SXPA 3C6KA 3HVKA 2WIGA 3WJ7A 4RTRA 4CDNA 1HETA 4G5YA 2NTYC 1Y6FA 3V7UA 4PFJA 3SX2A 3QVGA 3I76A 3UJDA 2YVAA 3FYDA 4QXRA 5JMTA 5DBIA 1FZTA 1Q7RA 3IBTA 3TBKA 1TZMA 1V48A 2OY0A 3PI7A 4WBNF 4NCAA 2WIBA 4HB2A 1E9FA 3C7DB 1GN8A 3L7CA 1MEJA 3W8NA 1QTQA 1L5OA 1V4BA 3P27A 5GVRA 2LPMA 4JT4A 4KBYA 1K27A 3QW2A 4RHEA 3RS5A 4BWVA 4YQFA 2N47A 1IXRC 4NMXB 3L0CA 1T9CA 5HP4A 1CW2B 4H31A 1USKA 2GEFA 2IIBA 2C8KA 4EYOA 1M74A 5D6OA 2Q2QA 4KQ6A 4MNTA 4HJXA 2PIDA 1KDOA 3ZHRA 1NXTA 1OKKA 2P2DA 3LX4A 4C5CA 2D5CA 1WX1A 1YL7A 1MNQA 3HSSA 3CG4A 1TUBA 1J8QA 3ELYA 2Z5VA 1XTJA 2AQ8A 3PPWA 3TQHA 4MVCA 3WHKA 4B5KA 4DLXA 1V5EA 3DLCA 4OKNA 4KPEC 1JXQA 2NV2B 4L0DA 4N40A 1Y63A 2YXEA 1ZD2P 2QL6A 3OQIA 4B3DA 4LG1A 4CW7A 1E2BA 3G8CA 3C3DA 4PZYA 2HX1A 1HURA 5AKGA 4G8JA 3AH8A 3JD1A 1ZK4A 3RAEC 4JLAA 3FHOA 2CWWA 3NJ4A 2P7HA 3MUFA 5I48A 1V5GA 1ZZEA 2VDVE 1B1CA 2ZCUA 4P36A 3ZCSA 5B30A 3K15A 3QTLA 4YJ3B 3RHFA 1A4IA 4LBVA 1RYYA 4CM9A 3CF0A 6GPBA 1Y42X 1M0EA 4FR0A 1ZY2A 3H6GA 4QJIA 2Q7OE 2A30A 3A1SA 1GNLA 2H1FA 3GJQA 2GXQA 3Q7IA 3ZKWB 4BNWA 2QI9F 3LUHA 1JI3A 4DF3A 1IRXA 2GDJA 1YJQA 3DL4A 5LDDC 4IV8A 1ZM7A 2CXTA 2UZ0A 3ONFA 5DNEA 2P6UA 3IB6A 3Q2IA 2IEZA 3PC8A 3B12A 1L3BA 1Y8RB 2GZSA 5FCDA 5HXAA 4A1OA 3F1LA 1P9RA 2XE4A 3F49S 3G7SA 1A9TA 2OHHA 4Z53A 2C0CA 2ONJA 4M38A 2GFQA 3EVAA 1WF6A 1PGQA 4RD0A 2FN9A 5SICE 5KSYA 1EFAA 5CLLA 1GY8A 3O8DA 1RHQA 3L77A 4ZT7A 1C0PA 1L5MA 3I0NA 3WBJA 5L6LB 5E2IA 5K0JA 4HSGA 1G4AE 4RESA 2A57A 1DRJA 1QANA 3PR1A 1SHZA 2XUDA 1YZVA 3DFMA 4BX2A 2I80A 2ZU6A 1I1QB 3CTMA 4D79A 5DE3A 2RGDA 2FA9A 2JFQA 2ETVA 4G23A 5HJ7A 3WL3A 4HEJA 2RKWA 3KTDA 4RV4A 4ROTA 1Y6GA 4Q4HA 3AF4A 2J0UA 4AUNA 5EIOA 4JQCA 5DHPA 1ZEJA 4Z7OB 3JAWA 1U4NA 1B8UA 1G16A 2W6MA 4FI3C 4WFQA 5AUQA 3V34A 4JMLA 4BQRA 1XZFA 1FP4A 1J8MF 3SVLA 1I7LA 4DUPA 1D9XA 1OBHA 4RENA 1QO7A 4G1MB 2ZLBA 2JJ8A 1HYEA 3NTQA 5DGHA 4N5IX 4S0XA 1SELA 2Q1TA 1PSZA 3KPYA 5J5CA 1O0CA 4F85A 3FDZA 4JB8A 3E1KA 4LWQA 2BIFA 4BV9A 2B1GA 4LQDA 4WINA 1UWVA 3GFRA 1A2KC 1Z2NX 1HH4A 2DVMA 2XCQA 1P7CA 3B6KA 3DCJA 3I9LA 5GIOE 3K6KA 1XJWA 1NU6A 3FG9A 2B99A 4MULA 1EEXB 4RPCA 2WOOA 2O8CA 2RHGB 4Z0NA 3L6OO 3G2QA 1G98A 4TL6A 3ZWWA 4B9EA 5HKKA 5KYYB 3HUEA 3RUEA 3TR0A 3ZKWA 3ZI7A 4BLWA 4EKIA 2PDAA 3G0OA 4P5DA 1CNFA 4V03A 4I4TF 3OWOA 1B41A 3SJUA 3FPBA 2UYHA 4YCMA 1SKYE 1RLMA 5CLIA 3SIXA 3AMVA 1PL0A 2XT6A 1MO6A 4YI3A 1Y3FE 1Z34A 4H08A 4M89A 1X3SA 1AV6A 1SR8A 4FKMA 2NU8B 2AR0A 1QF7A 4ISBA 3WL4A 1FDTA 1MA0A 3M6WA 1YRAA 1NXVA 2V9CA 2GEBA 4EL0A 2P27A 4IDNA 2ENWA 4AMGA 2OTCA 2IWRA 4ER3A 3K8QA 2VRNA 4E12A 3SJAA 1OAOA 2HV8A 4RLHA 4REOA 4N3AA 4U3JB 2G4LA 4B2IA 1T2DA 4OXRA 3HB7A 2R5WA 4Q3LA 3IKJA 4RULA 4FK8A 1YOBA