2AIGP

Adamalysin ii with peptidomimetic inhibitor pol647
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
201
structure length
201
Chain Sequence
NLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINEFYRSLNIRVSLTDLEIWSGQDFITIQSSSSNTLNSFGEWRERVLLTRKRHDNAQLLTAINFEGKIIGKAYTSSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADAMALYSIN II
publication title Structures of adamalysin II with peptidic inhibitors. Implications for the design of tumor necrosis factor alpha convertase inhibitors.
pubmed rcsb
molecule tags Hydrolast/hydrolase inhibitor
total genus 71
structure length 201
sequence length 201
ec nomenclature ec 3.4.24.46: Adamalysin.
pdb deposition date 1997-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2aigP00
1JIWP 1KUKA 1ZXCA 1CGEA 3G5CA 1USNA 2OW9A 3WV1A 3HBUP 5LABA 2ERQA 1CQRA 3NX7A 1CAQA 5I3MA 2W14A 1WNIA 2WO8A 4XCTA 5CZMA 2DW2A 1PWQA 1JH1A 1PWWA 4GF1A 3OHLA 1EAKA 4PKUA 1OM8A 1H71P 4QKZA 1JIZA 3LUNA 1DTHA 4WKIA 3EHYA 1BQOA 4G0DA 2DW1A 1GE5A 2DDYA 4IJOA 3UVCA 5JMYA 3GBOA 1RMZA 1XFZA 2OXUA 4GWNA 1IAAA 1MMQA 4R3VA 5L7FA 4JQGA 3Q2HA 3LE9A 3I7IA 2JNPA 4L6TA 2MZHA 1R1JA 3DPFA 3O2XA 1B8YA 1Y0VA 3ELMA 1ASTA 1I1IP 1AYKA 3Q2GA 2K9CA 1Q3AA 1BUDA 3HYGA 4DPEA 1HV5A 2MLRA 2SRTA 4JPAA 830CA 2W0DA 2W13A 4PKTA 3LKAA 3EDHA 4H2EA 5BOYA 4GR0A 1ZTQA 5BOTA 5CXAA 1XFVA 1D7XA 4XM7A 1G9KA 1YOUA 1IACA 3WV2A 1UEAA 1JAOA 1BSWA 3KECA 5D1UA 1Z3JA 5I43A 1FBLA 1HFSA 4JA1A 4WK7A 3DWBA 4WKEA 5D7WA 1KUFA 4DF9A 5I4OA 4AUOA 4H1QA 1YQYA 1C3IA 1C7KA 1QIBA 1R54A 2YB9A 2RJPA 3AYUA 4H3XA 3HDAP 1KUIA 1BKCI 5B5PA 3I7GA 2OY2A 4H49A 4ON1A 1YCMA 3F19A 4A3WA 1BUVM 4XM6A 4HMAA 5D2BA 1FLSA 2K2GA 1GKDA 4G9LA 1EB6A 3G42A 1ZVXA 2HU6A 1Y93A 2XS3A 3LILA 3KRYA 1QICA 3KEKA 3KWVC 4IUWA 2AIGP 2EROA 3V96B 4XBHA 1HFCA 1BKCA 966CA 2MZEA 2CLTA 4H76A 4WF6A 4GR3A 2QPJA 4HX3A 3SHIA 4H30A 4I35A 4XM8A 2J83A 3LJTA 2Y6DA 1QJIA 4PKWA 1CGFA 1PWUA 3L0TA 3HDBA 1JKYA 2WO9A 2OXZA 4CTHA 1AF0A 3LMCA 2JT5A 3P24A 1AKLA 1BIWA 1I76A 4IN9A 4L19A 1UTZA 2OW1A 2Z2DA 2ERPA 2MZIA 2X3AA 3N2VA 5I12A 1OMJA 4A7BA 2X3CA 5I0LA 1O0TA 1XFXA 1G05A 2XS4A 1MMPA 1XUDA 1ROSA 1IABA 1PWPA 3U1RA 1R1HA 3DL1A 2JSDA 4DD8A 2N8RA 3LJGA 5B5OA 3E8RA 3LGPA 4FU4A 1BM6A 1HOVA 1D8FA 1SMPA 1CK7A 456CA 1ZP5A 1UMTA 4JP4A 2J0TA 1D5JA 1SLNA 2TCLA 2KRJA 2OVXA 1ZXVA 3LUMA 3B2ZA 1JAPA 1IAEA 2Y6CA 2POJA 1BKCE 1CIZA 4FXYP 2X7MA 4GUYA 5CUHA 1ATLA 2OXWA 4FXQA 2OZRA 2O3EA 3AYKA 4PKSA 4I03A 2JT6A 3K7LA 2D1NA 4H82A 1UMSA 1CXVA 1GXDA 2JIHA 3P1VA 1BZSA 2AYKA 1QUAA 3TS4A 1JK3A 2FV5A 1ZS0A 1KBCA 1MMRA 3LQBA 3ZUKA 4DV8A 1XURA 1G12A 3TVCA 1OM7A 2CKIA 1YP1A 1OO9A 2V4BA 1R55A 4ZR5A 3KEJA 3TSKA 2O36A 1O0QA 2USNA 3EDIA 2A8HA 2FV9A 4EFSA 1MMBA 1GKCA 1G49A 1QIAA 1KAPP 1IAGA 2E3XA 5BPAA 3MA2A 4ILWD 2YIGA 1KUHA 1K7QA 3F17A 3RTSA 1EUBA 2PJTA 3HB2P 3F16A 3F18A 2X3BA 3TT4A 3BA0A 3EDZA 1GE6A 3K7NA 1KUGA 1GO7P 1R1IA 3EDGA 1B3DA 4GQLA 1D8MA 1XFWA 2D1OA 2MLSA 3AIGA 1OS2A 2DW0A 1SATA 3DSLA 3OHOA 3HBVP 1G4KA 2OW0A 1UTTA 2OW2A 3ZVSA 3LJZA 1HY7A 3LEAA 1C8TA 3HY7A 1GE7A 3KMCA 5H8XA 1JJ9A 3DNGA 1A85A 1L6JA 5D3CA 1XFUA 3CKIA 1PWVA 1OM6A 4Q1LA 4AXQA 4JIJA 4J4MA 3HY9A 2I47A 3EWJA 1BQQM 1CGLA 1HTDA 3VI1A 3O64A 4H84A 1A86A 1DMTA 3VTGA 3USNA 1K7GA 1JAQA 1ND1A 1SLMA 1J7NA 3EHXA 3B8ZA 3LIRA 3LQ0A 1S4BP 1JANA 2RJQA 2WOAA 4PKVA 3B92A 3F15A 1QJJA 5I2ZA 1K7IA 3ZXHA 1SU3A 1MNCA 2E2DA 3LK8A 3LIKA 1IADA 5D1TA 1FM1A 4PKQA 3L0VA 3F1AA 3WV3A 2OY4A 1Y8JA 4L63A 4AYKA 1RM8A 4GWMA 1XFYA 4AIGA 2W15A 3N2UA 4GR8A 5D1SA 3KMEA 5L79A 4WZVA 2DDFA 2W12A 3RTTA 2L0RA 3DPEA 3KHIA 4PKRA 2OI0A 1GO8P 1OS9A 1I73A 2OVZA 4FVLA 1SRPA 1XUCA
chains in the Genus database with same CATH superfamily
1JIWP 1KUKA 1ZXCA 1CGEA 3G5CA 1USNA 2OW9A 3WV1A 3HBUP 5LABA 2ERQA 1CQRA 3NX7A 1CAQA 5I3MA 2W14A 1WNIA 2WO8A 4XCTA 5CZMA 2DW2A 1PWQA 1JH1A 1PWWA 4GF1A 3OHLA 1EAKA 4PKUA 1OM8A 1H71P 4QKZA 1JIZA 3LUNA 1DTHA 4WKIA 3EHYA 1BQOA 4G0DA 2DW1A 1GE5A 2DDYA 4IJOA 3UVCA 5JMYA 3GBOA 1RMZA 1XFZA 2OXUA 4GWNA 1IAAA 1MMQA 4R3VA 5L7FA 1XAXA 4JQGA 3Q2HA 3LE9A 3I7IA 2JNPA 4L6TA 2MZHA 1R1JA 3DPFA 3O2XA 1B8YA 1Y0VA 3ELMA 1ASTA 1I1IP 1AYKA 2YUFA 3Q2GA 2K9CA 1Q3AA 1BUDA 3HYGA 4DPEA 1HV5A 2MLRA 2SRTA 4JPAA 830CA 2W0DA 2W13A 4PKTA 3LKAA 3EDHA 4H2EA 5BOYA 4GR0A 1ZTQA 5BOTA 5CXAA 1XFVA 1D7XA 4XM7A 1G9KA 1YOUA 1IACA 3WV2A 1UEAA 1JAOA 1BSWA 3KECA 5D1UA 1Z3JA 5I43A 1FBLA 1HFSA 4JA1A 4WK7A 3DWBA 4WKEA 5D7WA 1KUFA 4DF9A 5I4OA 4AUOA 4H1QA 1YQYA 1C3IA 1C7KA 1OZ9A 1QIBA 1R54A 2YB9A 2RJPA 3AYUA 4H3XA 3DTEA 3HDAP 1KUIA 1BKCI 5B5PA 3I7GA 2OY2A 4H49A 4ON1A 1YCMA 3F19A 4A3WA 1XM5A 1BUVM 4XM6A 4HMAA 5D2BA 1FLSA 2K2GA 1GKDA 4G9LA 1EB6A 3G42A 1ZVXA 2HU6A 1Y93A 2XS3A 3LILA 3KRYA 1QICA 3KEKA 3KWVC 4IUWA 3DTIA 2AIGP 2EROA 3V96B 4XBHA 1HFCA 1BKCA 966CA 2MZEA 2CLTA 4H76A 4WF6A 4GR3A 2QPJA 4HX3A 3SHIA 4H30A 4I35A 4XM8A 2J83A 3LJTA 2Y6DA 1QJIA 4PKWA 1CGFA 1PWUA 3L0TA 3HDBA 1JKYA 2WO9A 2OXZA 4CTHA 1AF0A 3LMCA 2JT5A 3P24A 1AKLA 1BIWA 1I76A 4IN9A 4L19A 1UTZA 2OW1A 2Z2DA 2ERPA 2MZIA 2X3AA 3N2VA 5I12A 1OMJA 4A7BA 2X3CA 5I0LA 4L7AA 1O0TA 1XFXA 1G05A 2XS4A 1MMPA 1XUDA 1ROSA 1IABA 1PWPA 3U1RA 1R1HA 3DL1A 2JSDA 4DD8A 2N8RA 3LJGA 5B5OA 3E8RA 3LGPA 4FU4A 1BM6A 1HOVA 1D8FA 1SMPA 1CK7A 456CA 1ZP5A 1UMTA 4JP4A 2J0TA 1D5JA 1SLNA 2TCLA 2KRJA 2OVXA 1ZXVA 3LUMA 3B2ZA 1JAPA 1IAEA 2Y6CA 2POJA 1BKCE 1CIZA 4FXYP 2X7MA 4GUYA 5CUHA 1ATLA 3DTKA 2OXWA 4FXQA 2OZRA 2O3EA 3AYKA 1TVIA 4PKSA 4I03A 2JT6A 3K7LA 2D1NA 4H82A 1UMSA 1CXVA 1GXDA 2JIHA 3P1VA 1BZSA 2AYKA 1QUAA 3TS4A 1JK3A 2FV5A 1ZS0A 1KBCA 1MMRA 3LQBA 3ZUKA 4DV8A 1XURA 1G12A 3TVCA 1OM7A 2CKIA 1YP1A 1OO9A 2V4BA 1R55A 4ZR5A 3KEJA 3TSKA 2O36A 1O0QA 2USNA 3EDIA 2A8HA 2FV9A 4EFSA 1MMBA 1GKCA 1G49A 1QIAA 1KAPP 1IAGA 2E3XA 5BPAA 3MA2A 4ILWD 2YIGA 1KUHA 1K7QA 3F17A 3RTSA 1EUBA 2PJTA 3HB2P 3F16A 3F18A 2X3BA 3TT4A 3BA0A 3EDZA 1GE6A 3K7NA 1KUGA 1GO7P 1R1IA 3EDGA 1B3DA 4GQLA 1D8MA 1XFWA 2D1OA 2MLSA 3AIGA 1OS2A 2DW0A 1SATA 3DSLA 3OHOA 3HBVP 1G4KA 2OW0A 1UTTA 2OW2A 3ZVSA 3LJZA 1HY7A 3LEAA 1C8TA 3HY7A 1GE7A 3KMCA 5H8XA 1JJ9A 3DNGA 1A85A 1L6JA 5D3CA 1XFUA 3CKIA 1PWVA 1OM6A 4Q1LA 4AXQA 4JIJA 4J4MA 3HY9A 2I47A 3EWJA 1BQQM 1CGLA 1HTDA 3VI1A 3O64A 4H84A 1A86A 1DMTA 3VTGA 3USNA 1K7GA 1JAQA 1ND1A 1SLMA 1J7NA 3EHXA 3B8ZA 3LIRA 3LQ0A 1S4BP 1JANA 2RJQA 2WOAA 4PKVA 3B92A 3F15A 1QJJA 5I2ZA 1K7IA 3ZXHA 1SU3A 1MNCA 2E2DA 3LK8A 3LIKA 1IADA 5D1TA 1FM1A 4PKQA 3L0VA 3F1AA 3WV3A 2OY4A 1Y8JA 4L63A 4AYKA 1RM8A 4GWMA 1XFYA 4AIGA 2W15A 3N2UA 4GR8A 5D1SA 3KMEA 5L79A 4WZVA 2DDFA 2W12A 3RTTA 2L0RA 3DPEA 3KHIA 4PKRA 2OI0A 1GO8P 1OS9A 1I73A 2OVZA 4FVLA 1SRPA 1XUCA
chains in the Genus database with same CATH topology
1JIWP 1KUKA 1ZXCA 1CGEA 3G5CA 1USNA 2OW9A 3WV1A 3HBUP 5LABA 2ERQA 1CQRA 3NX7A 1CAQA 5I3MA 2W14A 1WNIA 2WO8A 4XCTA 5CZMA 2DW2A 1PWQA 1JH1A 1PWWA 4GF1A 3OHLA 1EAKA 4PKUA 1OM8A 1H71P 4QKZA 1JIZA 3LUNA 1DTHA 4WKIA 3EHYA 1BQOA 4G0DA 2DW1A 1GE5A 2DDYA 4IJOA 3UVCA 5JMYA 3GBOA 1RMZA 1XFZA 2OXUA 4GWNA 1IAAA 1MMQA 4R3VA 5L7FA 4JQGA 3Q2HA 3LE9A 3I7IA 2JNPA 4L6TA 2MZHA 1R1JA 3DPFA 3O2XA 1B8YA 1Y0VA 3ELMA 1ASTA 1I1IP 1AYKA 2YUFA 3Q2GA 2K9CA 1Q3AA 1BUDA 3HYGA 4DPEA 1HV5A 2MLRA 2SRTA 4JPAA 830CA 2W0DA 2W13A 4PKTA 3LKAA 3EDHA 4H2EA 5BOYA 4GR0A 1ZTQA 5BOTA 5CXAA 1XFVA 1D7XA 4XM7A 1G9KA 1YOUA 1IACA 3WV2A 1UEAA 1JAOA 1BSWA 3KECA 5D1UA 1Z3JA 5I43A 1FBLA 1HFSA 4JA1A 4WK7A 3DWBA 4WKEA 5D7WA 1KUFA 4DF9A 5I4OA 4AUOA 4H1QA 1YQYA 1C3IA 1C7KA 1QIBA 1R54A 2YB9A 2RJPA 3AYUA 4H3XA 3DTEA 3HDAP 1KUIA 1BKCI 5B5PA 3I7GA 2OY2A 4H49A 4ON1A 1YCMA 3F19A 4A3WA 1BUVM 4XM6A 4HMAA 5D2BA 1FLSA 2K2GA 1GKDA 4G9LA 1EB6A 3G42A 1ZVXA 2HU6A 1Y93A 2XS3A 3LILA 3KRYA 1QICA 3KEKA 3KWVC 4IUWA 3DTIA 2AIGP 2EROA 3V96B 4XBHA 1HFCA 1BKCA 966CA 2MZEA 2CLTA 4H76A 4WF6A 4GR3A 2QPJA 4HX3A 3SHIA 4H30A 4I35A 4XM8A 2J83A 3LJTA 2Y6DA 1QJIA 4PKWA 1CGFA 1PWUA 3L0TA 3HDBA 1JKYA 2WO9A 2OXZA 4CTHA 1AF0A 3LMCA 2JT5A 3P24A 1AKLA 1BIWA 1I76A 4IN9A 4L19A 1UTZA 2OW1A 2Z2DA 2ERPA 2MZIA 2X3AA 3N2VA 5I12A 1OMJA 4A7BA 2X3CA 5I0LA 4L7AA 1O0TA 1XFXA 1G05A 2XS4A 1MMPA 1XUDA 1ROSA 1IABA 1PWPA 3U1RA 1R1HA 3DL1A 2JSDA 4DD8A 2N8RA 3LJGA 5B5OA 3E8RA 3LGPA 4FU4A 1BM6A 1HOVA 1D8FA 1SMPA 1CK7A 456CA 1ZP5A 1UMTA 4JP4A 2J0TA 1D5JA 1SLNA 2TCLA 2KRJA 2OVXA 1ZXVA 3LUMA 3B2ZA 1JAPA 1IAEA 2Y6CA 2POJA 1BKCE 1CIZA 4FXYP 2X7MA 4GUYA 5CUHA 1ATLA 3DTKA 2OXWA 4FXQA 2OZRA 2O3EA 3AYKA 4PKSA 4I03A 2JT6A 3K7LA 2D1NA 4H82A 1UMSA 1CXVA 1GXDA 2JIHA 3P1VA 1BZSA 2AYKA 1QUAA 3TS4A 1JK3A 2FV5A 1ZS0A 1KBCA 1MMRA 3LQBA 3ZUKA 4DV8A 1XURA 1G12A 3TVCA 1OM7A 2CKIA 1YP1A 1OO9A 2V4BA 1R55A 4ZR5A 3KEJA 3TSKA 2O36A 1O0QA 2USNA 3EDIA 2A8HA 2FV9A 4EFSA 1MMBA 1GKCA 1G49A 1QIAA 1KAPP 1IAGA 2E3XA 5BPAA 3MA2A 4ILWD 2YIGA 1KUHA 1K7QA 3F17A 3RTSA 1EUBA 2PJTA 3HB2P 3F16A 3F18A 2X3BA 3TT4A 3BA0A 3EDZA 1GE6A 3K7NA 1KUGA 1GO7P 1R1IA 3EDGA 1B3DA 4GQLA 1D8MA 1XFWA 2D1OA 2MLSA 3AIGA 1OS2A 2DW0A 1SATA 3DSLA 3OHOA 3HBVP 1G4KA 2OW0A 1UTTA 2OW2A 3ZVSA 3LJZA 1HY7A 3LEAA 1C8TA 3HY7A 1GE7A 3KMCA 5H8XA 1JJ9A 3DNGA 1A85A 1L6JA 5D3CA 1XFUA 3CKIA 1PWVA 1OM6A 4Q1LA 4AXQA 4JIJA 4J4MA 3HY9A 2I47A 3EWJA 1BQQM 1CGLA 1HTDA 3VI1A 3O64A 4H84A 1A86A 1DMTA 3VTGA 3USNA 1K7GA 1JAQA 1ND1A 1SLMA 1J7NA 3EHXA 3B8ZA 3LIRA 3LQ0A 1S4BP 1JANA 2RJQA 2WOAA 4PKVA 3B92A 3F15A 1QJJA 5I2ZA 1K7IA 3ZXHA 1SU3A 1MNCA 2E2DA 3LK8A 3LIKA 1IADA 5D1TA 1FM1A 4PKQA 3L0VA 3F1AA 3WV3A 2OY4A 1Y8JA 4L63A 4AYKA 1RM8A 4GWMA 1XFYA 4AIGA 2W15A 3N2UA 4GR8A 5D1SA 3KMEA 5L79A 4WZVA 2DDFA 2W12A 3RTTA 2L0RA 3DPEA 3KHIA 4PKRA 2OI0A 1GO8P 1OS9A 1I73A 2OVZA 4FVLA 1SRPA 1XUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JIW P;  1KUK A;  1ZXC A;  1CGE A;  3G5C A;  1USN A;  2OW9 A;  3WV1 A;  3HBU P;  5LAB A;  2ERQ A;  1CQR A;  3NX7 A;  1CAQ A;  5I3M A;  2W14 A;  1WNI A;  2WO8 A;  4XCT A;  5CZM A;  2DW2 A;  1PWQ A;  1JH1 A;  1PWW A;  4GF1 A;  3OHL A;  1EAK A;  4PKU A;  1OM8 A;  1H71 P;  4QKZ A;  1JIZ A;  3LUN A;  1DTH A;  4WKI A;  3EHY A;  1BQO A;  4G0D A;  2DW1 A;  1GE5 A;  2DDY A;  4IJO A;  3UVC A;  5JMY A;  3GBO A;  1RMZ A;  1XFZ A;  2OXU A;  4GWN A;  1IAA A;  1MMQ A;  4R3V A;  5L7F A;  4JQG A;  3Q2H A;  3LE9 A;  3I7I A;  2JNP A;  4L6T A;  2MZH A;  1R1J A;  3DPF A;  3O2X A;  1B8Y A;  1Y0V A;  3ELM A;  1AST A;  1I1I P;  1AYK A;  3Q2G A;  2K9C A;  1Q3A A;  1BUD A;  3HYG A;  4DPE A;  1HV5 A;  2MLR A;  2SRT A;  4JPA A;  830C A;  2W0D A;  2W13 A;  4PKT A;  3LKA A;  3EDH A;  4H2E A;  5BOY A;  4GR0 A;  1ZTQ A;  5BOT A;  5CXA A;  1XFV A;  1D7X A;  4XM7 A;  1G9K A;  1YOU A;  1IAC A;  3WV2 A;  1UEA A;  1JAO A;  1BSW A;  3KEC A;  5D1U A;  1Z3J A;  5I43 A;  1FBL A;  1HFS A;  4JA1 A;  4WK7 A;  3DWB A;  4WKE A;  5D7W A;  1KUF A;  4DF9 A;  5I4O A;  4AUO A;  4H1Q A;  1YQY A;  1C3I A;  1C7K A;  1QIB A;  1R54 A;  2YB9 A;  2RJP A;  3AYU A;  4H3X A;  3HDA P;  1KUI A;  1BKC I;  5B5P A;  3I7G A;  2OY2 A;  4H49 A;  4ON1 A;  1YCM A;  3F19 A;  4A3W A;  1BUV M;  4XM6 A;  4HMA A;  5D2B A;  1FLS A;  2K2G A;  1GKD A;  4G9L A;  1EB6 A;  3G42 A;  1ZVX A;  2HU6 A;  1Y93 A;  2XS3 A;  3LIL A;  3KRY A;  1QIC A;  3KEK A;  3KWV C;  4IUW A;  2AIG P;  2ERO A;  3V96 B;  4XBH A;  1HFC A;  1BKC A;  966C A;  2MZE A;  2CLT A;  4H76 A;  4WF6 A;  4GR3 A;  2QPJ A;  4HX3 A;  3SHI A;  4H30 A;  4I35 A;  4XM8 A;  2J83 A;  3LJT A;  2Y6D A;  1QJI A;  4PKW A;  1CGF A;  1PWU A;  3L0T A;  3HDB A;  1JKY A;  2WO9 A;  2OXZ A;  4CTH A;  1AF0 A;  3LMC A;  2JT5 A;  3P24 A;  1AKL A;  1BIW A;  1I76 A;  4IN9 A;  4L19 A;  1UTZ A;  2OW1 A;  2Z2D A;  2ERP A;  2MZI A;  2X3A A;  3N2V A;  5I12 A;  1OMJ A;  4A7B A;  2X3C A;  5I0L A;  1O0T A;  1XFX A;  1G05 A;  2XS4 A;  1MMP A;  1XUD A;  1ROS A;  1IAB A;  1PWP A;  3U1R A;  1R1H A;  3DL1 A;  2JSD A;  4DD8 A;  2N8R A;  3LJG A;  5B5O A;  3E8R A;  3LGP A;  4FU4 A;  1BM6 A;  1HOV A;  1D8F A;  1SMP A;  1CK7 A;  456C A;  1ZP5 A;  1UMT A;  4JP4 A;  2J0T A;  1D5J A;  1SLN A;  2TCL A;  2KRJ A;  2OVX A;  1ZXV A;  3LUM A;  3B2Z A;  1JAP A;  1IAE A;  2Y6C A;  2POJ A;  1BKC E;  1CIZ A;  4FXY P;  2X7M A;  4GUY A;  5CUH A;  1ATL A;  2OXW A;  4FXQ A;  2OZR A;  2O3E A;  3AYK A;  4PKS A;  4I03 A;  2JT6 A;  3K7L A;  2D1N A;  4H82 A;  1UMS A;  1CXV A;  1GXD A;  2JIH A;  3P1V A;  1BZS A;  2AYK A;  1QUA A;  3TS4 A;  1JK3 A;  2FV5 A;  1ZS0 A;  1KBC A;  1MMR A;  3LQB A;  3ZUK A;  4DV8 A;  1XUR A;  1G12 A;  3TVC A;  1OM7 A;  2CKI A;  1YP1 A;  1OO9 A;  2V4B A;  1R55 A;  4ZR5 A;  3KEJ A;  3TSK A;  2O36 A;  1O0Q A;  2USN A;  3EDI A;  2A8H A;  2FV9 A;  4EFS A;  1MMB A;  1GKC A;  1G49 A;  1QIA A;  1KAP P;  1IAG A;  2E3X A;  5BPA A;  3MA2 A;  4ILW D;  2YIG A;  1KUH A;  1K7Q A;  3F17 A;  3RTS A;  1EUB A;  2PJT A;  3HB2 P;  3F16 A;  3F18 A;  2X3B A;  3TT4 A;  3BA0 A;  3EDZ A;  1GE6 A;  3K7N A;  1KUG A;  1GO7 P;  1R1I A;  3EDG A;  1B3D A;  4GQL A;  1D8M A;  1XFW A;  2D1O A;  2MLS A;  3AIG A;  1OS2 A;  2DW0 A;  1SAT A;  3DSL A;  3OHO A;  3HBV P;  1G4K A;  2OW0 A;  1UTT A;  2OW2 A;  3ZVS A;  3LJZ A;  1HY7 A;  3LEA A;  1C8T A;  3HY7 A;  1GE7 A;  3KMC A;  5H8X A;  1JJ9 A;  3DNG A;  1A85 A;  1L6J A;  5D3C A;  1XFU A;  3CKI A;  1PWV A;  1OM6 A;  4Q1L A;  4AXQ A;  4JIJ A;  4J4M A;  3HY9 A;  2I47 A;  3EWJ A;  1BQQ M;  1CGL A;  1HTD A;  3VI1 A;  3O64 A;  4H84 A;  1A86 A;  1DMT A;  3VTG A;  3USN A;  1K7G A;  1JAQ A;  1ND1 A;  1SLM A;  1J7N A;  3EHX A;  3B8Z A;  3LIR A;  3LQ0 A;  1S4B P;  1JAN A;  2RJQ A;  2WOA A;  4PKV A;  3B92 A;  3F15 A;  1QJJ A;  5I2Z A;  1K7I A;  3ZXH A;  1SU3 A;  1MNC A;  2E2D A;  3LK8 A;  3LIK A;  1IAD A;  5D1T A;  1FM1 A;  4PKQ A;  3L0V A;  3F1A A;  3WV3 A;  2OY4 A;  1Y8J A;  4L63 A;  4AYK A;  1RM8 A;  4GWM A;  1XFY A;  4AIG A;  2W15 A;  3N2U A;  4GR8 A;  5D1S A;  3KME A;  5L79 A;  4WZV A;  2DDF A;  2W12 A;  3RTT A;  2L0R A;  3DPE A;  3KHI A;  4PKR A;  2OI0 A;  1GO8 P;  1OS9 A;  1I73 A;  2OVZ A;  4FVL A;  1SRP A;  1XUC A; 
#chains in the Genus database with same CATH topology
 1JIW P;  1KUK A;  1ZXC A;  1CGE A;  3G5C A;  1USN A;  2OW9 A;  3WV1 A;  3HBU P;  5LAB A;  2ERQ A;  1CQR A;  3NX7 A;  1CAQ A;  5I3M A;  2W14 A;  1WNI A;  2WO8 A;  4XCT A;  5CZM A;  2DW2 A;  1PWQ A;  1JH1 A;  1PWW A;  4GF1 A;  3OHL A;  1EAK A;  4PKU A;  1OM8 A;  1H71 P;  4QKZ A;  1JIZ A;  3LUN A;  1DTH A;  4WKI A;  3EHY A;  1BQO A;  4G0D A;  2DW1 A;  1GE5 A;  2DDY A;  4IJO A;  3UVC A;  5JMY A;  3GBO A;  1RMZ A;  1XFZ A;  2OXU A;  4GWN A;  1IAA A;  1MMQ A;  4R3V A;  5L7F A;  1XAX A;  4JQG A;  3Q2H A;  3LE9 A;  3I7I A;  2JNP A;  4L6T A;  2MZH A;  1R1J A;  3DPF A;  3O2X A;  1B8Y A;  1Y0V A;  3ELM A;  1AST A;  1I1I P;  1AYK A;  2YUF A;  3Q2G A;  2K9C A;  1Q3A A;  1BUD A;  3HYG A;  4DPE A;  1HV5 A;  2MLR A;  2SRT A;  4JPA A;  830C A;  2W0D A;  2W13 A;  4PKT A;  3LKA A;  3EDH A;  4H2E A;  5BOY A;  4GR0 A;  1ZTQ A;  5BOT A;  5CXA A;  1XFV A;  1D7X A;  4XM7 A;  1G9K A;  1YOU A;  1IAC A;  3WV2 A;  1UEA A;  1JAO A;  1BSW A;  3KEC A;  5D1U A;  1Z3J A;  5I43 A;  1FBL A;  1HFS A;  4JA1 A;  4WK7 A;  3DWB A;  4WKE A;  5D7W A;  1KUF A;  4DF9 A;  5I4O A;  4AUO A;  4H1Q A;  1YQY A;  1C3I A;  1C7K A;  1OZ9 A;  1QIB A;  1R54 A;  2YB9 A;  2RJP A;  3AYU A;  4H3X A;  3DTE A;  3HDA P;  1KUI A;  1BKC I;  5B5P A;  3I7G A;  2OY2 A;  4H49 A;  4ON1 A;  1YCM A;  3F19 A;  4A3W A;  1XM5 A;  1BUV M;  4XM6 A;  4HMA A;  5D2B A;  1FLS A;  2K2G A;  1GKD A;  4G9L A;  1EB6 A;  3G42 A;  1ZVX A;  2HU6 A;  1Y93 A;  2XS3 A;  3LIL A;  3KRY A;  1QIC A;  3KEK A;  3KWV C;  4IUW A;  3DTI A;  2AIG P;  2ERO A;  3V96 B;  4XBH A;  1HFC A;  1BKC A;  966C A;  2MZE A;  2CLT A;  4H76 A;  4WF6 A;  4GR3 A;  2QPJ A;  4HX3 A;  3SHI A;  4H30 A;  4I35 A;  4XM8 A;  2J83 A;  3LJT A;  2Y6D A;  1QJI A;  4PKW A;  1CGF A;  1PWU A;  3L0T A;  3HDB A;  1JKY A;  2WO9 A;  2OXZ A;  4CTH A;  1AF0 A;  3LMC A;  2JT5 A;  3P24 A;  1AKL A;  1BIW A;  1I76 A;  4IN9 A;  4L19 A;  1UTZ A;  2OW1 A;  2Z2D A;  2ERP A;  2MZI A;  2X3A A;  3N2V A;  5I12 A;  1OMJ A;  4A7B A;  2X3C A;  5I0L A;  4L7A A;  1O0T A;  1XFX A;  1G05 A;  2XS4 A;  1MMP A;  1XUD A;  1ROS A;  1IAB A;  1PWP A;  3U1R A;  1R1H A;  3DL1 A;  2JSD A;  4DD8 A;  2N8R A;  3LJG A;  5B5O A;  3E8R A;  3LGP A;  4FU4 A;  1BM6 A;  1HOV A;  1D8F A;  1SMP A;  1CK7 A;  456C A;  1ZP5 A;  1UMT A;  4JP4 A;  2J0T A;  1D5J A;  1SLN A;  2TCL A;  2KRJ A;  2OVX A;  1ZXV A;  3LUM A;  3B2Z A;  1JAP A;  1IAE A;  2Y6C A;  2POJ A;  1BKC E;  1CIZ A;  4FXY P;  2X7M A;  4GUY A;  5CUH A;  1ATL A;  3DTK A;  2OXW A;  4FXQ A;  2OZR A;  2O3E A;  3AYK A;  1TVI A;  4PKS A;  4I03 A;  2JT6 A;  3K7L A;  2D1N A;  4H82 A;  1UMS A;  1CXV A;  1GXD A;  2JIH A;  3P1V A;  1BZS A;  2AYK A;  1QUA A;  3TS4 A;  1JK3 A;  2FV5 A;  1ZS0 A;  1KBC A;  1MMR A;  3LQB A;  3ZUK A;  4DV8 A;  1XUR A;  1G12 A;  3TVC A;  1OM7 A;  2CKI A;  1YP1 A;  1OO9 A;  2V4B A;  1R55 A;  4ZR5 A;  3KEJ A;  3TSK A;  2O36 A;  1O0Q A;  2USN A;  3EDI A;  2A8H A;  2FV9 A;  4EFS A;  1MMB A;  1GKC A;  1G49 A;  1QIA A;  1KAP P;  1IAG A;  2E3X A;  5BPA A;  3MA2 A;  4ILW D;  2YIG A;  1KUH A;  1K7Q A;  3F17 A;  3RTS A;  1EUB A;  2PJT A;  3HB2 P;  3F16 A;  3F18 A;  2X3B A;  3TT4 A;  3BA0 A;  3EDZ A;  1GE6 A;  3K7N A;  1KUG A;  1GO7 P;  1R1I A;  3EDG A;  1B3D A;  4GQL A;  1D8M A;  1XFW A;  2D1O A;  2MLS A;  3AIG A;  1OS2 A;  2DW0 A;  1SAT A;  3DSL A;  3OHO A;  3HBV P;  1G4K A;  2OW0 A;  1UTT A;  2OW2 A;  3ZVS A;  3LJZ A;  1HY7 A;  3LEA A;  1C8T A;  3HY7 A;  1GE7 A;  3KMC A;  5H8X A;  1JJ9 A;  3DNG A;  1A85 A;  1L6J A;  5D3C A;  1XFU A;  3CKI A;  1PWV A;  1OM6 A;  4Q1L A;  4AXQ A;  4JIJ A;  4J4M A;  3HY9 A;  2I47 A;  3EWJ A;  1BQQ M;  1CGL A;  1HTD A;  3VI1 A;  3O64 A;  4H84 A;  1A86 A;  1DMT A;  3VTG A;  3USN A;  1K7G A;  1JAQ A;  1ND1 A;  1SLM A;  1J7N A;  3EHX A;  3B8Z A;  3LIR A;  3LQ0 A;  1S4B P;  1JAN A;  2RJQ A;  2WOA A;  4PKV A;  3B92 A;  3F15 A;  1QJJ A;  5I2Z A;  1K7I A;  3ZXH A;  1SU3 A;  1MNC A;  2E2D A;  3LK8 A;  3LIK A;  1IAD A;  5D1T A;  1FM1 A;  4PKQ A;  3L0V A;  3F1A A;  3WV3 A;  2OY4 A;  1Y8J A;  4L63 A;  4AYK A;  1RM8 A;  4GWM A;  1XFY A;  4AIG A;  2W15 A;  3N2U A;  4GR8 A;  5D1S A;  3KME A;  5L79 A;  4WZV A;  2DDF A;  2W12 A;  3RTT A;  2L0R A;  3DPE A;  3KHI A;  4PKR A;  2OI0 A;  1GO8 P;  1OS9 A;  1I73 A;  2OVZ A;  4FVL A;  1SRP A;  1XUC A; 
#chains in the Genus database with same CATH homology
 1JIW P;  1KUK A;  1ZXC A;  1CGE A;  3G5C A;  1USN A;  2OW9 A;  3WV1 A;  3HBU P;  5LAB A;  2ERQ A;  1CQR A;  3NX7 A;  1CAQ A;  5I3M A;  2W14 A;  1WNI A;  2WO8 A;  4XCT A;  5CZM A;  2DW2 A;  1PWQ A;  1JH1 A;  1PWW A;  4GF1 A;  3OHL A;  1EAK A;  4PKU A;  1OM8 A;  1H71 P;  4QKZ A;  1JIZ A;  3LUN A;  1DTH A;  4WKI A;  3EHY A;  1BQO A;  4G0D A;  2DW1 A;  1GE5 A;  2DDY A;  4IJO A;  3UVC A;  5JMY A;  3GBO A;  1RMZ A;  1XFZ A;  2OXU A;  4GWN A;  1IAA A;  1MMQ A;  4R3V A;  5L7F A;  4JQG A;  3Q2H A;  3LE9 A;  3I7I A;  2JNP A;  4L6T A;  2MZH A;  1R1J A;  3DPF A;  3O2X A;  1B8Y A;  1Y0V A;  3ELM A;  1AST A;  1I1I P;  1AYK A;  2YUF A;  3Q2G A;  2K9C A;  1Q3A A;  1BUD A;  3HYG A;  4DPE A;  1HV5 A;  2MLR A;  2SRT A;  4JPA A;  830C A;  2W0D A;  2W13 A;  4PKT A;  3LKA A;  3EDH A;  4H2E A;  5BOY A;  4GR0 A;  1ZTQ A;  5BOT A;  5CXA A;  1XFV A;  1D7X A;  4XM7 A;  1G9K A;  1YOU A;  1IAC A;  3WV2 A;  1UEA A;  1JAO A;  1BSW A;  3KEC A;  5D1U A;  1Z3J A;  5I43 A;  1FBL A;  1HFS A;  4JA1 A;  4WK7 A;  3DWB A;  4WKE A;  5D7W A;  1KUF A;  4DF9 A;  5I4O A;  4AUO A;  4H1Q A;  1YQY A;  1C3I A;  1C7K A;  1QIB A;  1R54 A;  2YB9 A;  2RJP A;  3AYU A;  4H3X A;  3DTE A;  3HDA P;  1KUI A;  1BKC I;  5B5P A;  3I7G A;  2OY2 A;  4H49 A;  4ON1 A;  1YCM A;  3F19 A;  4A3W A;  1BUV M;  4XM6 A;  4HMA A;  5D2B A;  1FLS A;  2K2G A;  1GKD A;  4G9L A;  1EB6 A;  3G42 A;  1ZVX A;  2HU6 A;  1Y93 A;  2XS3 A;  3LIL A;  3KRY A;  1QIC A;  3KEK A;  3KWV C;  4IUW A;  3DTI A;  2AIG P;  2ERO A;  3V96 B;  4XBH A;  1HFC A;  1BKC A;  966C A;  2MZE A;  2CLT A;  4H76 A;  4WF6 A;  4GR3 A;  2QPJ A;  4HX3 A;  3SHI A;  4H30 A;  4I35 A;  4XM8 A;  2J83 A;  3LJT A;  2Y6D A;  1QJI A;  4PKW A;  1CGF A;  1PWU A;  3L0T A;  3HDB A;  1JKY A;  2WO9 A;  2OXZ A;  4CTH A;  1AF0 A;  3LMC A;  2JT5 A;  3P24 A;  1AKL A;  1BIW A;  1I76 A;  4IN9 A;  4L19 A;  1UTZ A;  2OW1 A;  2Z2D A;  2ERP A;  2MZI A;  2X3A A;  3N2V A;  5I12 A;  1OMJ A;  4A7B A;  2X3C A;  5I0L A;  4L7A A;  1O0T A;  1XFX A;  1G05 A;  2XS4 A;  1MMP A;  1XUD A;  1ROS A;  1IAB A;  1PWP A;  3U1R A;  1R1H A;  3DL1 A;  2JSD A;  4DD8 A;  2N8R A;  3LJG A;  5B5O A;  3E8R A;  3LGP A;  4FU4 A;  1BM6 A;  1HOV A;  1D8F A;  1SMP A;  1CK7 A;  456C A;  1ZP5 A;  1UMT A;  4JP4 A;  2J0T A;  1D5J A;  1SLN A;  2TCL A;  2KRJ A;  2OVX A;  1ZXV A;  3LUM A;  3B2Z A;  1JAP A;  1IAE A;  2Y6C A;  2POJ A;  1BKC E;  1CIZ A;  4FXY P;  2X7M A;  4GUY A;  5CUH A;  1ATL A;  3DTK A;  2OXW A;  4FXQ A;  2OZR A;  2O3E A;  3AYK A;  4PKS A;  4I03 A;  2JT6 A;  3K7L A;  2D1N A;  4H82 A;  1UMS A;  1CXV A;  1GXD A;  2JIH A;  3P1V A;  1BZS A;  2AYK A;  1QUA A;  3TS4 A;  1JK3 A;  2FV5 A;  1ZS0 A;  1KBC A;  1MMR A;  3LQB A;  3ZUK A;  4DV8 A;  1XUR A;  1G12 A;  3TVC A;  1OM7 A;  2CKI A;  1YP1 A;  1OO9 A;  2V4B A;  1R55 A;  4ZR5 A;  3KEJ A;  3TSK A;  2O36 A;  1O0Q A;  2USN A;  3EDI A;  2A8H A;  2FV9 A;  4EFS A;  1MMB A;  1GKC A;  1G49 A;  1QIA A;  1KAP P;  1IAG A;  2E3X A;  5BPA A;  3MA2 A;  4ILW D;  2YIG A;  1KUH A;  1K7Q A;  3F17 A;  3RTS A;  1EUB A;  2PJT A;  3HB2 P;  3F16 A;  3F18 A;  2X3B A;  3TT4 A;  3BA0 A;  3EDZ A;  1GE6 A;  3K7N A;  1KUG A;  1GO7 P;  1R1I A;  3EDG A;  1B3D A;  4GQL A;  1D8M A;  1XFW A;  2D1O A;  2MLS A;  3AIG A;  1OS2 A;  2DW0 A;  1SAT A;  3DSL A;  3OHO A;  3HBV P;  1G4K A;  2OW0 A;  1UTT A;  2OW2 A;  3ZVS A;  3LJZ A;  1HY7 A;  3LEA A;  1C8T A;  3HY7 A;  1GE7 A;  3KMC A;  5H8X A;  1JJ9 A;  3DNG A;  1A85 A;  1L6J A;  5D3C A;  1XFU A;  3CKI A;  1PWV A;  1OM6 A;  4Q1L A;  4AXQ A;  4JIJ A;  4J4M A;  3HY9 A;  2I47 A;  3EWJ A;  1BQQ M;  1CGL A;  1HTD A;  3VI1 A;  3O64 A;  4H84 A;  1A86 A;  1DMT A;  3VTG A;  3USN A;  1K7G A;  1JAQ A;  1ND1 A;  1SLM A;  1J7N A;  3EHX A;  3B8Z A;  3LIR A;  3LQ0 A;  1S4B P;  1JAN A;  2RJQ A;  2WOA A;  4PKV A;  3B92 A;  3F15 A;  1QJJ A;  5I2Z A;  1K7I A;  3ZXH A;  1SU3 A;  1MNC A;  2E2D A;  3LK8 A;  3LIK A;  1IAD A;  5D1T A;  1FM1 A;  4PKQ A;  3L0V A;  3F1A A;  3WV3 A;  2OY4 A;  1Y8J A;  4L63 A;  4AYK A;  1RM8 A;  4GWM A;  1XFY A;  4AIG A;  2W15 A;  3N2U A;  4GR8 A;  5D1S A;  3KME A;  5L79 A;  4WZV A;  2DDF A;  2W12 A;  3RTT A;  2L0R A;  3DPE A;  3KHI A;  4PKR A;  2OI0 A;  1GO8 P;  1OS9 A;  1I73 A;  2OVZ A;  4FVL A;  1SRP A;  1XUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...