2AIUA

Crystal structure of mouse testicular cytochrome c at 1.6 angstrom
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
104
structure length
104
Chain Sequence
GDAEAGKKIFVQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTDANKNKGVIWSEETLMEYLENPKKYIPGTKMIFAGIKKKSEREDLIKYLKQATSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c, testis-specific
publication title Remarkably high activities of testicular cytochrome c in destroying reactive oxygen species and in triggering apoptosis
pubmed doi rcsb
source organism Mus musculus
molecule tags Electron transport
total genus 31
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2005-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00034 Cytochrom_C Cytochrome c
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2aiuA00
1CIFA 4FA1A 5CIEB 1WEJF 2ZOOA 3L74D 2CE1A 2FYNB 1IRWA 1LMSA 1FJ0A 4IL6V 5TISV 3M97X 3OCDA 1CYIA 3OCDB 1OCDA 4AALA 1YIQA 1E8EA 1CORA 2N3BA 3PXSA 4PWAA 1CTJA 3O0RC 3PXTA 2GIWA 2C9XB 3O20A 3KZIV 4YE1A 3SJLA 1E29A 2YQBA 3H1HD 1M6ZA 4GEDB 1C6OA 1I55A 5GTHV 1DIQC 1QL4A 1M70A 2C2CA 2A06D 351CA 2CA4B 1L0LD 5DJQB 1K3GA 1R0QA 4AAMA 4WQ7A 5KLVD 1FOCA 5EXQA 4FA4A 3ZOYA 4RSZA 2C1DA 5DF5A 1ZZHA 4H0KA 3H1JD 1LFMA 1HH7A 5C0ZA 2CE0A 1CC5A 5CYTR 1CNOA 451CA 1L9JC 5CIGB 2GB8B 1CSUA 1KX2A 1EB7A 1KX7A 2ORLA 3O5CA 4L3HA 2ZONG 1DIIC 1DT1A 5H2FV 1NU1D 3RN1A 1J3SA 3ZBMA 1QL3A 2LITA 1HJ3A 1COTA 3CX5W 1H31A 1H31B 1AYGA 3CXHW 4XXLA 1YEAA 1AKKA 5B5EV 1YICA 2EXVA 1LS9A 2YIUB 1H32A 1DW0A 3L70D 1C6SA 2AIUA 4DY9A 2D0WA 3CP5A 2CXBA 2N9JA 1CO6A 5DFSA 4QAOA 5B66V 3CYTI 4PW9B 1HCMA 2IBZD 1CHIA 1WVEC 3WU2V 1I5TA 2FWLA 1DVHA 1GDVA 1GJQA 2OZ1A 4K3IA 1CYJA 2N18C 155CA 4N0KA 1W5CT 2AI5A 1A8CA 1CYCA 1CHHA 1K3HA 3CX5D 3CXHD 1RZ6A 4PJ0V 1FI9A 2C1VA 1CCHA 5KAFV 1CXCA 1YEBA 5IY51 3L72D 3RN0A 1A2SA 3ZOOA 3ZOXA 4WQ8A 1C52A 3RLMA 1CIHA 1C75A 4FA5A 2GC7D 3WFCC 1GKSA 4AX3A 2LIRA 3HQ6A 1HJ4A 1N15A 2BPBB 3WFBC 3WFEC 1HZVA 1CIGA 1CSVA 5KKZB 1CRHA 2YCCA 4JCGA 4AANA 1IO3A 2I8FA 2BH4X 1YNRA 4J20A 2C1DB 1H9YA 1CIEA 1YFCA 1H33A 4GYDA 1LC1A 1H33B 1CHJA 3CU4A 3H1LD 1MG2D 2QJKB 5CICB 3JBTB 3CWBD 3WC8A 1LC2A 1CSXA 1ETPA 1IRVA 3O1YA 1OAEA 3ZIYA 1EZVD 1DW2A 5CIFB 1F1CA 2N18B 3HQ9A 5GTIV 3A0BV 3NBTA 2GC4D 1SQVD 2BCNB 1B7VA 1VYDA 4EIDA 1NIRA 1QN2A 4Y5RA 3BCCD 1C6RA 1BCCD 4WQBA 1SQPD 1HROA 1DVVA 1S5LV 1BGYD 1KYOW 1PP9D 1H32B 1SQQD 4FA9A 3DP5A 3ORVA 5AURA 1RAPA 3L4OA 2PACA 1HZUA 4EIFA 1IZL0 1KB9D 2FRCA 2VHDA 1RAQA 2HV4A 4FB1A 4WQ9A 4L3GA 1MG3D 1ZRTD 3RMZA 1DW1A 1DW3A 1CSWA 4LJIA 3HQ7A 1NTZD 2N9IA 3DMIA 1N90A 3PH2B 2OZ1B 1CRYA 1PPJD 1BE3D 2BGVX 4Q5PA 1L0ND 3L4MA 3TYIA 2YK3A 2L4DA 4WQCA 2CA3B 3SVWA 1RZ5A 4EIEA 2C8SA 2ZXYA 2QJPB 3SWSA 1CRIA 2B0ZB 5CIBB 1M60A 3MK7C 4P4QB 1H1OA 3H1KD 1SQXD 1H9XA 5B6QA 1GU2A 2QJYB 2ZZS1 3HQ8A 3C2CA 2B4ZA 3H1ID 2BH5X 4O1WA 2C1UA 5CIHB 2PCCB 1AOQA 1SQBD 5C9MA 2MHMA 1CRJA 2JTIB 1CRGA 1NMIA 3A0HV 3WUIA 1C2NA 4EICA 1NTMD 1S6VB 1QKSA 3L75D 2B10B 3PXWA 2B12B 4MU8A 1E2RA 2B11B 2FYUD 5E79V 2BLFB 1BL9A 3A9FA 1GQ1A 3VYMA 1F1FA 4U3FD 1FCDC 2JQRA 2V07A 1CRCA 4UB6V 1W2LA 3L73D 1NMLA 3X39A 2D0SA 1U74B 1P84D 5KLIB 3VNWA 1CTZA 1CEDA 3SXTA 4H0JA 4KMGA 3MK7B 3TGUD 2XTSB 1N50A 3SLEA 1I8PA 1NNOA 1U75B 4WQEA 3ZOWA 1IQCA 2AXTV 2ZBOA 2PCBB 1NTKD 2DGEA 2DVHA 4FAVA 1MZ4A 1I6DA 4D6TD 3NWVA 3VRDA 1FI3A 1QYZA 4FANA 1I6EA 2V08A 4V2KA 1KV9A 4UB8V 1CXAA 1I8OA 2MTAC 2BCCD 5DJQC 1C2RA 4WQAA 3NBSA 3DR0A 3WFDC 1A56A 5CIDB 1HRCA 1FI7A 3L71D 1KB0A 1CCRA 1I54A 1L9BC 1GIWA 1JDLA 1CTYA 3ZCFA 1N9CA 5KAIV 4XYDB 4O1QA 3OA8A 1FHBA 1C7MA 3OA8B 2N3YA 4L1QA 1YTCA 4NFGB 1HJ5A 1KYOD 4AAOA 1YCCA 4WQDA 1AOFA 1KIBA 4PD4D
chains in the Genus database with same CATH superfamily
1CIFA 4FA1A 5CIEB 1WEJF 2ZOOA 3L74D 2CE1A 2FYNB 1IRWA 1LMSA 1FJ0A 4IL6V 5TISV 3M97X 3OCDA 1CYIA 3OCDB 1OCDA 4AALA 1YIQA 1E8EA 1CORA 2N3BA 3PXSA 4PWAA 1CTJA 3O0RC 3PXTA 2GIWA 2C9XB 3O20A 3KZIV 4YE1A 3SJLA 1E29A 2YQBA 3H1HD 1M6ZA 4GEDB 1C6OA 1I55A 5GTHV 1DIQC 1QL4A 1M70A 2C2CA 2A06D 351CA 2CA4B 1L0LD 5DJQB 1K3GA 1R0QA 4AAMA 4WQ7A 5KLVD 1FOCA 5EXQA 4FA4A 3ZOYA 4RSZA 2C1DA 5DF5A 1ZZHA 4H0KA 3H1JD 1LFMA 1HH7A 5C0ZA 2CE0A 1CC5A 5CYTR 1CNOA 451CA 1L9JC 5CIGB 2GB8B 1CSUA 1KX2A 1EB7A 1KX7A 2ORLA 3O5CA 4L3HA 2ZONG 1DIIC 1DT1A 5H2FV 1NU1D 3RN1A 1J3SA 3ZBMA 1QL3A 2LITA 1HJ3A 1COTA 3CX5W 1H31A 1H31B 1AYGA 3CXHW 4XXLA 1YEAA 1AKKA 5B5EV 1YICA 2EXVA 1LS9A 2YIUB 1H32A 1DW0A 3L70D 1C6SA 2AIUA 4DY9A 2D0WA 3CP5A 2CXBA 2N9JA 1CO6A 5DFSA 4QAOA 5B66V 3CYTI 4PW9B 1HCMA 2IBZD 1CHIA 1WVEC 3WU2V 1I5TA 2FWLA 1DVHA 1GDVA 1GJQA 2OZ1A 4K3IA 1CYJA 2N18C 155CA 4N0KA 1W5CT 2AI5A 1A8CA 1CYCA 1CHHA 1K3HA 3CX5D 3CXHD 1RZ6A 4PJ0V 1FI9A 2C1VA 1CCHA 5KAFV 1CXCA 1YEBA 5IY51 3L72D 3RN0A 1A2SA 3ZOOA 3ZOXA 4WQ8A 1C52A 3RLMA 1CIHA 1C75A 4FA5A 2GC7D 3WFCC 1GKSA 4AX3A 2LIRA 3HQ6A 1HJ4A 1N15A 2BPBB 3WFBC 3WFEC 1HZVA 1CIGA 1CSVA 5KKZB 1CRHA 2YCCA 4JCGA 4AANA 1IO3A 2I8FA 2BH4X 1YNRA 4J20A 2C1DB 1H9YA 1CIEA 1YFCA 1H33A 4GYDA 1LC1A 1H33B 1CHJA 3CU4A 3H1LD 1MG2D 2QJKB 5CICB 3JBTB 3CWBD 3WC8A 1LC2A 1CSXA 1ETPA 1IRVA 3O1YA 1OAEA 3ZIYA 1EZVD 1DW2A 5CIFB 1F1CA 2N18B 3HQ9A 5GTIV 3A0BV 3NBTA 2GC4D 1SQVD 2BCNB 1B7VA 1VYDA 4EIDA 1NIRA 1QN2A 4Y5RA 3BCCD 1C6RA 1BCCD 4WQBA 1SQPD 1HROA 1DVVA 1S5LV 1BGYD 1KYOW 1PP9D 1H32B 1SQQD 4FA9A 3DP5A 3ORVA 5AURA 1RAPA 3L4OA 2PACA 1HZUA 4EIFA 1IZL0 1KB9D 2FRCA 2VHDA 1RAQA 2HV4A 4FB1A 4WQ9A 4L3GA 1MG3D 1ZRTD 3RMZA 1DW1A 1DW3A 1CSWA 4LJIA 3HQ7A 1NTZD 2N9IA 3DMIA 1N90A 3PH2B 2OZ1B 1CRYA 1PPJD 1BE3D 2BGVX 4Q5PA 1L0ND 3L4MA 3TYIA 2YK3A 2L4DA 4WQCA 2CA3B 3SVWA 1RZ5A 4EIEA 2C8SA 2ZXYA 2QJPB 3SWSA 1CRIA 2B0ZB 5CIBB 1M60A 3MK7C 4P4QB 1H1OA 3H1KD 1SQXD 1H9XA 5B6QA 1GU2A 2QJYB 2ZZS1 3HQ8A 3C2CA 2B4ZA 3H1ID 2BH5X 4O1WA 2C1UA 5CIHB 2PCCB 1AOQA 1SQBD 5C9MA 2MHMA 1CRJA 2JTIB 1CRGA 1NMIA 3A0HV 3WUIA 1C2NA 4EICA 1NTMD 1S6VB 1QKSA 3L75D 2B10B 3PXWA 2B12B 4MU8A 1E2RA 2B11B 2FYUD 5E79V 2BLFB 1BL9A 3A9FA 1GQ1A 3VYMA 1F1FA 4U3FD 1FCDC 2JQRA 2V07A 1CRCA 4UB6V 1W2LA 3L73D 1NMLA 3X39A 2D0SA 1U74B 1P84D 5KLIB 3VNWA 1CTZA 1CEDA 3SXTA 4H0JA 4KMGA 3MK7B 3TGUD 2XTSB 1N50A 3SLEA 1I8PA 1NNOA 1U75B 4WQEA 3ZOWA 1IQCA 2AXTV 2ZBOA 2PCBB 1NTKD 2DGEA 2DVHA 4FAVA 1MZ4A 1I6DA 4D6TD 3NWVA 3VRDA 1FI3A 1QYZA 4FANA 1I6EA 2V08A 4V2KA 1KV9A 4UB8V 1CXAA 1I8OA 2MTAC 2BCCD 5DJQC 1C2RA 4WQAA 3NBSA 3DR0A 3WFDC 1A56A 5CIDB 1HRCA 3D0WA 1FI7A 3L71D 1KB0A 1CCRA 1I54A 1L9BC 1GIWA 1JDLA 1CTYA 3ZCFA 1N9CA 5KAIV 4XYDB 4O1QA 3OA8A 1FHBA 1C7MA 3OA8B 2N3YA 4L1QA 1YTCA 4NFGB 1HJ5A 1KYOD 4AAOA 1YCCA 4WQDA 1AOFA 1KIBA 4PD4D
chains in the Genus database with same CATH topology
1CIFA 4FA1A 5CIEB 1WEJF 2ZOOA 3L74D 2CE1A 2FYNB 1IRWA 1LMSA 1FJ0A 4IL6V 5TISV 3M97X 3OCDA 1CYIA 3OCDB 1OCDA 4AALA 1YIQA 1E8EA 1CORA 2N3BA 3PXSA 4PWAA 1CTJA 3O0RC 3PXTA 2GIWA 2C9XB 3O20A 3KZIV 4YE1A 3SJLA 1E29A 2YQBA 3H1HD 1M6ZA 4GEDB 1C6OA 1I55A 5GTHV 1DIQC 1QL4A 1M70A 2C2CA 2A06D 351CA 2CA4B 1L0LD 5DJQB 1K3GA 1R0QA 4AAMA 4WQ7A 5KLVD 1FOCA 5EXQA 4FA4A 3ZOYA 4RSZA 2C1DA 5DF5A 1ZZHA 4H0KA 3H1JD 1LFMA 1HH7A 5C0ZA 2CE0A 1CC5A 5CYTR 1CNOA 451CA 1L9JC 5CIGB 2GB8B 1CSUA 1KX2A 1EB7A 1KX7A 2ORLA 3O5CA 4L3HA 2ZONG 1DIIC 1DT1A 5H2FV 1NU1D 3RN1A 1J3SA 3ZBMA 1QL3A 2LITA 1HJ3A 1COTA 3CX5W 1H31A 1H31B 1AYGA 3CXHW 4XXLA 1YEAA 1AKKA 5B5EV 1YICA 2EXVA 1LS9A 2YIUB 1H32A 1DW0A 3L70D 1C6SA 2AIUA 4DY9A 2D0WA 3CP5A 2CXBA 2N9JA 1CO6A 5DFSA 4QAOA 5B66V 3CYTI 4PW9B 1HCMA 2IBZD 1CHIA 1WVEC 3WU2V 1I5TA 2FWLA 1DVHA 1GDVA 1GJQA 2OZ1A 4K3IA 1CYJA 2N18C 155CA 4N0KA 1W5CT 2AI5A 1A8CA 1CYCA 1CHHA 1K3HA 3CX5D 3CXHD 1RZ6A 4PJ0V 1FI9A 2C1VA 1CCHA 5KAFV 1CXCA 1YEBA 5IY51 3L72D 3RN0A 1A2SA 3ZOOA 3ZOXA 4WQ8A 1C52A 3RLMA 1CIHA 1C75A 4FA5A 2GC7D 3WFCC 1GKSA 4AX3A 2LIRA 3HQ6A 1HJ4A 1N15A 2BPBB 3WFBC 3WFEC 1HZVA 1CIGA 1CSVA 5KKZB 1CRHA 2YCCA 4JCGA 4AANA 1IO3A 2I8FA 2BH4X 1YNRA 4J20A 2C1DB 1H9YA 1CIEA 1YFCA 1H33A 4GYDA 1LC1A 1H33B 1CHJA 3CU4A 3H1LD 1MG2D 2QJKB 5CICB 3JBTB 3CWBD 3WC8A 1LC2A 1CSXA 1ETPA 1IRVA 3O1YA 1OAEA 3ZIYA 1EZVD 1DW2A 5CIFB 1F1CA 2N18B 3HQ9A 5GTIV 3A0BV 3NBTA 2GC4D 1SQVD 2BCNB 1B7VA 1VYDA 4EIDA 1NIRA 1QN2A 4Y5RA 3BCCD 1C6RA 1BCCD 4WQBA 1SQPD 1HROA 1DVVA 1S5LV 1BGYD 1KYOW 1PP9D 1H32B 1SQQD 4FA9A 3DP5A 3ORVA 5AURA 1RAPA 3L4OA 2PACA 1HZUA 4EIFA 1IZL0 1KB9D 2FRCA 2VHDA 1RAQA 2HV4A 4FB1A 4WQ9A 4L3GA 1MG3D 1ZRTD 3RMZA 1DW1A 1DW3A 1CSWA 4LJIA 3HQ7A 1NTZD 2N9IA 3DMIA 1N90A 3PH2B 2OZ1B 1CRYA 1PPJD 1BE3D 2BGVX 4Q5PA 1L0ND 3L4MA 3TYIA 2YK3A 2L4DA 4WQCA 2CA3B 3SVWA 1RZ5A 4EIEA 2C8SA 2ZXYA 2QJPB 3SWSA 1CRIA 2B0ZB 5CIBB 1M60A 3MK7C 4P4QB 1H1OA 3H1KD 1SQXD 1H9XA 5B6QA 1GU2A 2QJYB 2ZZS1 3HQ8A 3C2CA 2B4ZA 3H1ID 2BH5X 4O1WA 2C1UA 5CIHB 2PCCB 1AOQA 1SQBD 5C9MA 2MHMA 1CRJA 2JTIB 1CRGA 1NMIA 3A0HV 3WUIA 1C2NA 4EICA 1NTMD 1S6VB 1QKSA 3L75D 2B10B 3PXWA 2B12B 4MU8A 1E2RA 2B11B 2FYUD 5E79V 2BLFB 1BL9A 3A9FA 1GQ1A 3VYMA 1F1FA 4U3FD 1FCDC 2JQRA 2V07A 1CRCA 4UB6V 1W2LA 3L73D 1NMLA 3X39A 2D0SA 1U74B 1P84D 5KLIB 3VNWA 1CTZA 1CEDA 3SXTA 4H0JA 4KMGA 3MK7B 3TGUD 2XTSB 1N50A 3SLEA 1I8PA 1NNOA 1U75B 4WQEA 3ZOWA 1IQCA 2AXTV 2ZBOA 2PCBB 1NTKD 2DGEA 2DVHA 4FAVA 1MZ4A 1I6DA 4D6TD 3NWVA 3VRDA 1FI3A 1QYZA 4FANA 1I6EA 2V08A 4V2KA 1KV9A 4UB8V 1CXAA 1I8OA 2MTAC 2BCCD 5DJQC 1C2RA 4WQAA 3NBSA 3DR0A 3WFDC 1A56A 5CIDB 1HRCA 1FI7A 3L71D 1KB0A 1CCRA 1I54A 1L9BC 1GIWA 1JDLA 1CTYA 3ZCFA 1N9CA 5KAIV 4XYDB 4O1QA 3OA8A 1FHBA 1C7MA 3OA8B 2N3YA 4L1QA 1YTCA 4NFGB 1HJ5A 1KYOD 4AAOA 1YCCA 4WQDA 1AOFA 1KIBA 4PD4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CIF A;  4FA1 A;  5CIE B;  1WEJ F;  2ZOO A;  3L74 D;  2CE1 A;  2FYN B;  1IRW A;  1LMS A;  1FJ0 A;  4IL6 V;  5TIS V;  3M97 X;  3OCD A;  1CYI A;  3OCD B;  1OCD A;  4AAL A;  1YIQ A;  1E8E A;  1COR A;  2N3B A;  3PXS A;  4PWA A;  1CTJ A;  3O0R C;  3PXT A;  2GIW A;  2C9X B;  3O20 A;  3KZI V;  4YE1 A;  3SJL A;  1E29 A;  2YQB A;  3H1H D;  1M6Z A;  4GED B;  1C6O A;  1I55 A;  5GTH V;  1DIQ C;  1QL4 A;  1M70 A;  2C2C A;  2A06 D;  351C A;  2CA4 B;  1L0L D;  5DJQ B;  1K3G A;  1R0Q A;  4AAM A;  4WQ7 A;  5KLV D;  1FOC A;  5EXQ A;  4FA4 A;  3ZOY A;  4RSZ A;  2C1D A;  5DF5 A;  1ZZH A;  4H0K A;  3H1J D;  1LFM A;  1HH7 A;  5C0Z A;  2CE0 A;  1CC5 A;  5CYT R;  1CNO A;  451C A;  1L9J C;  5CIG B;  2GB8 B;  1CSU A;  1KX2 A;  1EB7 A;  1KX7 A;  2ORL A;  3O5C A;  4L3H A;  2ZON G;  1DII C;  1DT1 A;  5H2F V;  1NU1 D;  3RN1 A;  1J3S A;  3ZBM A;  1QL3 A;  2LIT A;  1HJ3 A;  1COT A;  3CX5 W;  1H31 A;  1H31 B;  1AYG A;  3CXH W;  4XXL A;  1YEA A;  1AKK A;  5B5E V;  1YIC A;  2EXV A;  1LS9 A;  2YIU B;  1H32 A;  1DW0 A;  3L70 D;  1C6S A;  2AIU A;  4DY9 A;  2D0W A;  3CP5 A;  2CXB A;  2N9J A;  1CO6 A;  5DFS A;  4QAO A;  5B66 V;  3CYT I;  4PW9 B;  1HCM A;  2IBZ D;  1CHI A;  1WVE C;  3WU2 V;  1I5T A;  2FWL A;  1DVH A;  1GDV A;  1GJQ A;  2OZ1 A;  4K3I A;  1CYJ A;  2N18 C;  155C A;  4N0K A;  1W5C T;  2AI5 A;  1A8C A;  1CYC A;  1CHH A;  1K3H A;  3CX5 D;  3CXH D;  1RZ6 A;  4PJ0 V;  1FI9 A;  2C1V A;  1CCH A;  5KAF V;  1CXC A;  1YEB A;  5IY5 1;  3L72 D;  3RN0 A;  1A2S A;  3ZOO A;  3ZOX A;  4WQ8 A;  1C52 A;  3RLM A;  1CIH A;  1C75 A;  4FA5 A;  2GC7 D;  3WFC C;  1GKS A;  4AX3 A;  2LIR A;  3HQ6 A;  1HJ4 A;  1N15 A;  2BPB B;  3WFB C;  3WFE C;  1HZV A;  1CIG A;  1CSV A;  5KKZ B;  1CRH A;  2YCC A;  4JCG A;  4AAN A;  1IO3 A;  2I8F A;  2BH4 X;  1YNR A;  4J20 A;  2C1D B;  1H9Y A;  1CIE A;  1YFC A;  1H33 A;  4GYD A;  1LC1 A;  1H33 B;  1CHJ A;  3CU4 A;  3H1L D;  1MG2 D;  2QJK B;  5CIC B;  3JBT B;  3CWB D;  3WC8 A;  1LC2 A;  1CSX A;  1ETP A;  1IRV A;  3O1Y A;  1OAE A;  3ZIY A;  1EZV D;  1DW2 A;  5CIF B;  1F1C A;  2N18 B;  3HQ9 A;  5GTI V;  3A0B V;  3NBT A;  2GC4 D;  1SQV D;  2BCN B;  1B7V A;  1VYD A;  4EID A;  1NIR A;  1QN2 A;  4Y5R A;  3BCC D;  1C6R A;  1BCC D;  4WQB A;  1SQP D;  1HRO A;  1DVV A;  1S5L V;  1BGY D;  1KYO W;  1PP9 D;  1H32 B;  1SQQ D;  4FA9 A;  3DP5 A;  3ORV A;  5AUR A;  1RAP A;  3L4O A;  2PAC A;  1HZU A;  4EIF A;  1IZL 0;  1KB9 D;  2FRC A;  2VHD A;  1RAQ A;  2HV4 A;  4FB1 A;  4WQ9 A;  4L3G A;  1MG3 D;  1ZRT D;  3RMZ A;  1DW1 A;  1DW3 A;  1CSW A;  4LJI A;  3HQ7 A;  1NTZ D;  2N9I A;  3DMI A;  1N90 A;  3PH2 B;  2OZ1 B;  1CRY A;  1PPJ D;  1BE3 D;  2BGV X;  4Q5P A;  1L0N D;  3L4M A;  3TYI A;  2YK3 A;  2L4D A;  4WQC A;  2CA3 B;  3SVW A;  1RZ5 A;  4EIE A;  2C8S A;  2ZXY A;  2QJP B;  3SWS A;  1CRI A;  2B0Z B;  5CIB B;  1M60 A;  3MK7 C;  4P4Q B;  1H1O A;  3H1K D;  1SQX D;  1H9X A;  5B6Q A;  1GU2 A;  2QJY B;  2ZZS 1;  3HQ8 A;  3C2C A;  2B4Z A;  3H1I D;  2BH5 X;  4O1W A;  2C1U A;  5CIH B;  2PCC B;  1AOQ A;  1SQB D;  5C9M A;  2MHM A;  1CRJ A;  2JTI B;  1CRG A;  1NMI A;  3A0H V;  3WUI A;  1C2N A;  4EIC A;  1NTM D;  1S6V B;  1QKS A;  3L75 D;  2B10 B;  3PXW A;  2B12 B;  4MU8 A;  1E2R A;  2B11 B;  2FYU D;  5E79 V;  2BLF B;  1BL9 A;  3A9F A;  1GQ1 A;  3VYM A;  1F1F A;  4U3F D;  1FCD C;  2JQR A;  2V07 A;  1CRC A;  4UB6 V;  1W2L A;  3L73 D;  1NML A;  3X39 A;  2D0S A;  1U74 B;  1P84 D;  5KLI B;  3VNW A;  1CTZ A;  1CED A;  3SXT A;  4H0J A;  4KMG A;  3MK7 B;  3TGU D;  2XTS B;  1N50 A;  3SLE A;  1I8P A;  1NNO A;  1U75 B;  4WQE A;  3ZOW A;  1IQC A;  2AXT V;  2ZBO A;  2PCB B;  1NTK D;  2DGE A;  2DVH A;  4FAV A;  1MZ4 A;  1I6D A;  4D6T D;  3NWV A;  3VRD A;  1FI3 A;  1QYZ A;  4FAN A;  1I6E A;  2V08 A;  4V2K A;  1KV9 A;  4UB8 V;  1CXA A;  1I8O A;  2MTA C;  2BCC D;  5DJQ C;  1C2R A;  4WQA A;  3NBS A;  3DR0 A;  3WFD C;  1A56 A;  5CID B;  1HRC A;  1FI7 A;  3L71 D;  1KB0 A;  1CCR A;  1I54 A;  1L9B C;  1GIW A;  1JDL A;  1CTY A;  3ZCF A;  1N9C A;  5KAI V;  4XYD B;  4O1Q A;  3OA8 A;  1FHB A;  1C7M A;  3OA8 B;  2N3Y A;  4L1Q A;  1YTC A;  4NFG B;  1HJ5 A;  1KYO D;  4AAO A;  1YCC A;  4WQD A;  1AOF A;  1KIB A;  4PD4 D; 
#chains in the Genus database with same CATH topology
 1CIF A;  4FA1 A;  5CIE B;  1WEJ F;  2ZOO A;  3L74 D;  2CE1 A;  2FYN B;  1IRW A;  1LMS A;  1FJ0 A;  4IL6 V;  5TIS V;  3M97 X;  3OCD A;  1CYI A;  3OCD B;  1OCD A;  4AAL A;  1YIQ A;  1E8E A;  1COR A;  2N3B A;  3PXS A;  4PWA A;  1CTJ A;  3O0R C;  3PXT A;  2GIW A;  2C9X B;  3O20 A;  3KZI V;  4YE1 A;  3SJL A;  1E29 A;  2YQB A;  3H1H D;  1M6Z A;  4GED B;  1C6O A;  1I55 A;  5GTH V;  1DIQ C;  1QL4 A;  1M70 A;  2C2C A;  2A06 D;  351C A;  2CA4 B;  1L0L D;  5DJQ B;  1K3G A;  1R0Q A;  4AAM A;  4WQ7 A;  5KLV D;  1FOC A;  5EXQ A;  4FA4 A;  3ZOY A;  4RSZ A;  2C1D A;  5DF5 A;  1ZZH A;  4H0K A;  3H1J D;  1LFM A;  1HH7 A;  5C0Z A;  2CE0 A;  1CC5 A;  5CYT R;  1CNO A;  451C A;  1L9J C;  5CIG B;  2GB8 B;  1CSU A;  1KX2 A;  1EB7 A;  1KX7 A;  2ORL A;  3O5C A;  4L3H A;  2ZON G;  1DII C;  1DT1 A;  5H2F V;  1NU1 D;  3RN1 A;  1J3S A;  3ZBM A;  1QL3 A;  2LIT A;  1HJ3 A;  1COT A;  3CX5 W;  1H31 A;  1H31 B;  1AYG A;  3CXH W;  4XXL A;  1YEA A;  1AKK A;  5B5E V;  1YIC A;  2EXV A;  1LS9 A;  2YIU B;  1H32 A;  1DW0 A;  3L70 D;  1C6S A;  2AIU A;  4DY9 A;  2D0W A;  3CP5 A;  2CXB A;  2N9J A;  1CO6 A;  5DFS A;  4QAO A;  5B66 V;  3CYT I;  4PW9 B;  1HCM A;  2IBZ D;  1CHI A;  1WVE C;  3WU2 V;  1I5T A;  2FWL A;  1DVH A;  1GDV A;  1GJQ A;  2OZ1 A;  4K3I A;  1CYJ A;  2N18 C;  155C A;  4N0K A;  1W5C T;  2AI5 A;  1A8C A;  1CYC A;  1CHH A;  1K3H A;  3CX5 D;  3CXH D;  1RZ6 A;  4PJ0 V;  1FI9 A;  2C1V A;  1CCH A;  5KAF V;  1CXC A;  1YEB A;  5IY5 1;  3L72 D;  3RN0 A;  1A2S A;  3ZOO A;  3ZOX A;  4WQ8 A;  1C52 A;  3RLM A;  1CIH A;  1C75 A;  4FA5 A;  2GC7 D;  3WFC C;  1GKS A;  4AX3 A;  2LIR A;  3HQ6 A;  1HJ4 A;  1N15 A;  2BPB B;  3WFB C;  3WFE C;  1HZV A;  1CIG A;  1CSV A;  5KKZ B;  1CRH A;  2YCC A;  4JCG A;  4AAN A;  1IO3 A;  2I8F A;  2BH4 X;  1YNR A;  4J20 A;  2C1D B;  1H9Y A;  1CIE A;  1YFC A;  1H33 A;  4GYD A;  1LC1 A;  1H33 B;  1CHJ A;  3CU4 A;  3H1L D;  1MG2 D;  2QJK B;  5CIC B;  3JBT B;  3CWB D;  3WC8 A;  1LC2 A;  1CSX A;  1ETP A;  1IRV A;  3O1Y A;  1OAE A;  3ZIY A;  1EZV D;  1DW2 A;  5CIF B;  1F1C A;  2N18 B;  3HQ9 A;  5GTI V;  3A0B V;  3NBT A;  2GC4 D;  1SQV D;  2BCN B;  1B7V A;  1VYD A;  4EID A;  1NIR A;  1QN2 A;  4Y5R A;  3BCC D;  1C6R A;  1BCC D;  4WQB A;  1SQP D;  1HRO A;  1DVV A;  1S5L V;  1BGY D;  1KYO W;  1PP9 D;  1H32 B;  1SQQ D;  4FA9 A;  3DP5 A;  3ORV A;  5AUR A;  1RAP A;  3L4O A;  2PAC A;  1HZU A;  4EIF A;  1IZL 0;  1KB9 D;  2FRC A;  2VHD A;  1RAQ A;  2HV4 A;  4FB1 A;  4WQ9 A;  4L3G A;  1MG3 D;  1ZRT D;  3RMZ A;  1DW1 A;  1DW3 A;  1CSW A;  4LJI A;  3HQ7 A;  1NTZ D;  2N9I A;  3DMI A;  1N90 A;  3PH2 B;  2OZ1 B;  1CRY A;  1PPJ D;  1BE3 D;  2BGV X;  4Q5P A;  1L0N D;  3L4M A;  3TYI A;  2YK3 A;  2L4D A;  4WQC A;  2CA3 B;  3SVW A;  1RZ5 A;  4EIE A;  2C8S A;  2ZXY A;  2QJP B;  3SWS A;  1CRI A;  2B0Z B;  5CIB B;  1M60 A;  3MK7 C;  4P4Q B;  1H1O A;  3H1K D;  1SQX D;  1H9X A;  5B6Q A;  1GU2 A;  2QJY B;  2ZZS 1;  3HQ8 A;  3C2C A;  2B4Z A;  3H1I D;  2BH5 X;  4O1W A;  2C1U A;  5CIH B;  2PCC B;  1AOQ A;  1SQB D;  5C9M A;  2MHM A;  1CRJ A;  2JTI B;  1CRG A;  1NMI A;  3A0H V;  3WUI A;  1C2N A;  4EIC A;  1NTM D;  1S6V B;  1QKS A;  3L75 D;  2B10 B;  3PXW A;  2B12 B;  4MU8 A;  1E2R A;  2B11 B;  2FYU D;  5E79 V;  2BLF B;  1BL9 A;  3A9F A;  1GQ1 A;  3VYM A;  1F1F A;  4U3F D;  1FCD C;  2JQR A;  2V07 A;  1CRC A;  4UB6 V;  1W2L A;  3L73 D;  1NML A;  3X39 A;  2D0S A;  1U74 B;  1P84 D;  5KLI B;  3VNW A;  1CTZ A;  1CED A;  3SXT A;  4H0J A;  4KMG A;  3MK7 B;  3TGU D;  2XTS B;  1N50 A;  3SLE A;  1I8P A;  1NNO A;  1U75 B;  4WQE A;  3ZOW A;  1IQC A;  2AXT V;  2ZBO A;  2PCB B;  1NTK D;  2DGE A;  2DVH A;  4FAV A;  1MZ4 A;  1I6D A;  4D6T D;  3NWV A;  3VRD A;  1FI3 A;  1QYZ A;  4FAN A;  1I6E A;  2V08 A;  4V2K A;  1KV9 A;  4UB8 V;  1CXA A;  1I8O A;  2MTA C;  2BCC D;  5DJQ C;  1C2R A;  4WQA A;  3NBS A;  3DR0 A;  3WFD C;  1A56 A;  5CID B;  1HRC A;  3D0W A;  1FI7 A;  3L71 D;  1KB0 A;  1CCR A;  1I54 A;  1L9B C;  1GIW A;  1JDL A;  1CTY A;  3ZCF A;  1N9C A;  5KAI V;  4XYD B;  4O1Q A;  3OA8 A;  1FHB A;  1C7M A;  3OA8 B;  2N3Y A;  4L1Q A;  1YTC A;  4NFG B;  1HJ5 A;  1KYO D;  4AAO A;  1YCC A;  4WQD A;  1AOF A;  1KIB A;  4PD4 D; 
#chains in the Genus database with same CATH homology
 1CIF A;  4FA1 A;  5CIE B;  1WEJ F;  2ZOO A;  3L74 D;  2CE1 A;  2FYN B;  1IRW A;  1LMS A;  1FJ0 A;  4IL6 V;  5TIS V;  3M97 X;  3OCD A;  1CYI A;  3OCD B;  1OCD A;  4AAL A;  1YIQ A;  1E8E A;  1COR A;  2N3B A;  3PXS A;  4PWA A;  1CTJ A;  3O0R C;  3PXT A;  2GIW A;  2C9X B;  3O20 A;  3KZI V;  4YE1 A;  3SJL A;  1E29 A;  2YQB A;  3H1H D;  1M6Z A;  4GED B;  1C6O A;  1I55 A;  5GTH V;  1DIQ C;  1QL4 A;  1M70 A;  2C2C A;  2A06 D;  351C A;  2CA4 B;  1L0L D;  5DJQ B;  1K3G A;  1R0Q A;  4AAM A;  4WQ7 A;  5KLV D;  1FOC A;  5EXQ A;  4FA4 A;  3ZOY A;  4RSZ A;  2C1D A;  5DF5 A;  1ZZH A;  4H0K A;  3H1J D;  1LFM A;  1HH7 A;  5C0Z A;  2CE0 A;  1CC5 A;  5CYT R;  1CNO A;  451C A;  1L9J C;  5CIG B;  2GB8 B;  1CSU A;  1KX2 A;  1EB7 A;  1KX7 A;  2ORL A;  3O5C A;  4L3H A;  2ZON G;  1DII C;  1DT1 A;  5H2F V;  1NU1 D;  3RN1 A;  1J3S A;  3ZBM A;  1QL3 A;  2LIT A;  1HJ3 A;  1COT A;  3CX5 W;  1H31 A;  1H31 B;  1AYG A;  3CXH W;  4XXL A;  1YEA A;  1AKK A;  5B5E V;  1YIC A;  2EXV A;  1LS9 A;  2YIU B;  1H32 A;  1DW0 A;  3L70 D;  1C6S A;  2AIU A;  4DY9 A;  2D0W A;  3CP5 A;  2CXB A;  2N9J A;  1CO6 A;  5DFS A;  4QAO A;  5B66 V;  3CYT I;  4PW9 B;  1HCM A;  2IBZ D;  1CHI A;  1WVE C;  3WU2 V;  1I5T A;  2FWL A;  1DVH A;  1GDV A;  1GJQ A;  2OZ1 A;  4K3I A;  1CYJ A;  2N18 C;  155C A;  4N0K A;  1W5C T;  2AI5 A;  1A8C A;  1CYC A;  1CHH A;  1K3H A;  3CX5 D;  3CXH D;  1RZ6 A;  4PJ0 V;  1FI9 A;  2C1V A;  1CCH A;  5KAF V;  1CXC A;  1YEB A;  5IY5 1;  3L72 D;  3RN0 A;  1A2S A;  3ZOO A;  3ZOX A;  4WQ8 A;  1C52 A;  3RLM A;  1CIH A;  1C75 A;  4FA5 A;  2GC7 D;  3WFC C;  1GKS A;  4AX3 A;  2LIR A;  3HQ6 A;  1HJ4 A;  1N15 A;  2BPB B;  3WFB C;  3WFE C;  1HZV A;  1CIG A;  1CSV A;  5KKZ B;  1CRH A;  2YCC A;  4JCG A;  4AAN A;  1IO3 A;  2I8F A;  2BH4 X;  1YNR A;  4J20 A;  2C1D B;  1H9Y A;  1CIE A;  1YFC A;  1H33 A;  4GYD A;  1LC1 A;  1H33 B;  1CHJ A;  3CU4 A;  3H1L D;  1MG2 D;  2QJK B;  5CIC B;  3JBT B;  3CWB D;  3WC8 A;  1LC2 A;  1CSX A;  1ETP A;  1IRV A;  3O1Y A;  1OAE A;  3ZIY A;  1EZV D;  1DW2 A;  5CIF B;  1F1C A;  2N18 B;  3HQ9 A;  5GTI V;  3A0B V;  3NBT A;  2GC4 D;  1SQV D;  2BCN B;  1B7V A;  1VYD A;  4EID A;  1NIR A;  1QN2 A;  4Y5R A;  3BCC D;  1C6R A;  1BCC D;  4WQB A;  1SQP D;  1HRO A;  1DVV A;  1S5L V;  1BGY D;  1KYO W;  1PP9 D;  1H32 B;  1SQQ D;  4FA9 A;  3DP5 A;  3ORV A;  5AUR A;  1RAP A;  3L4O A;  2PAC A;  1HZU A;  4EIF A;  1IZL 0;  1KB9 D;  2FRC A;  2VHD A;  1RAQ A;  2HV4 A;  4FB1 A;  4WQ9 A;  4L3G A;  1MG3 D;  1ZRT D;  3RMZ A;  1DW1 A;  1DW3 A;  1CSW A;  4LJI A;  3HQ7 A;  1NTZ D;  2N9I A;  3DMI A;  1N90 A;  3PH2 B;  2OZ1 B;  1CRY A;  1PPJ D;  1BE3 D;  2BGV X;  4Q5P A;  1L0N D;  3L4M A;  3TYI A;  2YK3 A;  2L4D A;  4WQC A;  2CA3 B;  3SVW A;  1RZ5 A;  4EIE A;  2C8S A;  2ZXY A;  2QJP B;  3SWS A;  1CRI A;  2B0Z B;  5CIB B;  1M60 A;  3MK7 C;  4P4Q B;  1H1O A;  3H1K D;  1SQX D;  1H9X A;  5B6Q A;  1GU2 A;  2QJY B;  2ZZS 1;  3HQ8 A;  3C2C A;  2B4Z A;  3H1I D;  2BH5 X;  4O1W A;  2C1U A;  5CIH B;  2PCC B;  1AOQ A;  1SQB D;  5C9M A;  2MHM A;  1CRJ A;  2JTI B;  1CRG A;  1NMI A;  3A0H V;  3WUI A;  1C2N A;  4EIC A;  1NTM D;  1S6V B;  1QKS A;  3L75 D;  2B10 B;  3PXW A;  2B12 B;  4MU8 A;  1E2R A;  2B11 B;  2FYU D;  5E79 V;  2BLF B;  1BL9 A;  3A9F A;  1GQ1 A;  3VYM A;  1F1F A;  4U3F D;  1FCD C;  2JQR A;  2V07 A;  1CRC A;  4UB6 V;  1W2L A;  3L73 D;  1NML A;  3X39 A;  2D0S A;  1U74 B;  1P84 D;  5KLI B;  3VNW A;  1CTZ A;  1CED A;  3SXT A;  4H0J A;  4KMG A;  3MK7 B;  3TGU D;  2XTS B;  1N50 A;  3SLE A;  1I8P A;  1NNO A;  1U75 B;  4WQE A;  3ZOW A;  1IQC A;  2AXT V;  2ZBO A;  2PCB B;  1NTK D;  2DGE A;  2DVH A;  4FAV A;  1MZ4 A;  1I6D A;  4D6T D;  3NWV A;  3VRD A;  1FI3 A;  1QYZ A;  4FAN A;  1I6E A;  2V08 A;  4V2K A;  1KV9 A;  4UB8 V;  1CXA A;  1I8O A;  2MTA C;  2BCC D;  5DJQ C;  1C2R A;  4WQA A;  3NBS A;  3DR0 A;  3WFD C;  1A56 A;  5CID B;  1HRC A;  1FI7 A;  3L71 D;  1KB0 A;  1CCR A;  1I54 A;  1L9B C;  1GIW A;  1JDL A;  1CTY A;  3ZCF A;  1N9C A;  5KAI V;  4XYD B;  4O1Q A;  3OA8 A;  1FHB A;  1C7M A;  3OA8 B;  2N3Y A;  4L1Q A;  1YTC A;  4NFG B;  1HJ5 A;  1KYO D;  4AAO A;  1YCC A;  4WQD A;  1AOF A;  1KIB A;  4PD4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...