2AIZP

Solution structure of peptidoglycan associated lipoprotein from haemophilus influenza bound to udp-n-acetylmuramoyl-l-alanyl-d-glutamyl-meso-2,6-diaminopimeloyl-d-alanyl-d-alanine
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
134
Chain Sequence
b'CSSSNNDAAGNGAAQTFGGYSVADLQQRYNTVYFGFDKYDITGEYVQILDAHAAYLNATPAAKVLVEGNTDERGTPEYNIALGQRRADAVKGYLAGKGVDAGKLGTVSYGEEKPAVLGHDEAAYSKNRRAVLAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein P6
publication title Peptidoglycan recognition by pal, an outer membrane lipoprotein.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Membrane protein
total genus 32
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2005-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2aizP01
4ZHWA 3S06A 3TD4A 4ZHYB 2AIZP 4G4YA 2W8BC 3LDTA 4G4XA 1OAPA 5EB1B 4G4VA 2ZVZA 2LBTA 2MQEA 4G88A 2LCAA 3TD3A 1R1MA 2ZVYA 3CYPB 5EAZA 3S03A 3S0WA 4ZHVA 3S02A 5EB0A 4R40B 4B5CA 4PWTA 4RHAA 2HQSC 3IMPA 3KHNA 2K1SA 3CYQA 2ZOVA 2KGWA 3WPXA 3S0YA 2N48A 3S0HA 3TD5A 4ERHA 3WPWA 3OONA 4B62A 4G4ZA 2ZF8A 2L26A 4G4WA
chains in the Genus database with same CATH superfamily
4ZOLB 5JQGB 2UYJA 1VQ9F 4LCKA 3E22A 1COMA 4YJ3A 3HKCA 4NQ3A 3RE3A 3CCEF 2G9IA 1YITF 3PAFA 4I4TB 1E7KA 4O2AA 3I55F 4BT7A 3HKDA 2Z1FA 4C81A 1U43A 3P4EA 4DRXB 5GONB 2HP3A 4BT5A 1VQ5F 4R40B 1RLGA 4RHAA 3HKBB 4C8GA 4WBNB 5LOVA 3D54A 4U3JA 5LP6A 2DT4A 3WJPA 1M1KH 5HWEA 3NVIB 3HKCB 2FC3A 4O2AB 4I55A 2UYKA 3HKDB 3CMEF 2DYYA 3RYFA 3CG6A 4FFBB 4BT6A 3Q8HA 5HY0A 1VQ8F 3HKEA 1S72F 2RHJA 2CHTA 1CN7A 1CLIA 3G6EF 5LYJA 5KX5A 1YQNA 1YI2F 5J2TB 4G4ZA 3G71F 3KJKA 2FGYA 3S06A 1KD1H 4O4IA 4E6EA 5JCOA 4EI7A 3RYFB 3VYUC 2OZBA 5CB4A 4EI9A 1CK2A 3F6MA 3JALB 4I50A 3CMAF 4NUTA 2BTUA 3NK7A 5ITZA 3HKEB 4O2BA 2P6YA 3IKEA 4ZI7B 2CW4A 2ALEA 3RYIB 5LYJB 2Q1YA 3JAWB 1VQ4F 1Q82H 2V9YA 3UT5B 1U3PA 4O4IB 3BYQA 1JJ2F 3B6NA 5DCVA 3OBWA 3CC2F 3K14A 5KMGA 5EB1B 1ODEA 2ZVZA 4I50B 3CCQF 2CVLA 5IJ9A 5FNVB 1X52A 2QA4F 4X3MA 3F0GA 1TVKA 3FD5A 3S02A 4KWEA 2VAWA 4BY9D 2HQSC 2VGMA 4TV9A 2HS3A 1YJNF 5FJ4C 1SA0B 1Q7YH 3SIVA 3N2KA 4ZHQB 2ZF8A 5GIPC 2L26A 3F0EA 5JH7B 5GAPK 2RHOA 3D01A 3KE1A 5AVMA 1JD1A 2YXZA 4IIJB 4F6RA 3LWRC 1W41A 3CC7F 3VCZA 5EIBC 4X1YB 3RYCA 1OFUA 5BMVA 5HY4A 1W5EA 1VHAA 1FNJA 3MBMA 3ERNA 1U40A 3GTZA 3AGKA 1UI9A 1W5AA 4ERHA 4O4LA 1T0AA 2HS0A 3OONA 1W40A 4ZHYB 5IT9M 2I6DA 2YYEA 5EYPB 4LNUB 3G4SF 1J7HA 1W57A 1PXWA 2F9ZC 1OAPA 3VOBA 1Q86H 2MQEA 3JARA 4TV8A 3WXMB 5HY1A 5C8YB 1FFXA 5G4VC 2BTQB 3N2GA 2IQQA 3J80M 2ZAUA 3V4DA 3FD6A 2HVYD 2KTUA 2UYNB 1RA4A 3S0HA 2VAMA 1T0KB 3NMUC 4C4WC 4U39A 2HX0A 3I3FA 4O4JB 1W2BF 3FBAA 1SZQA 2LBXA 3E22B 4YJ3B 3CCJF 1PF5A 1IV2A 1UFYA 3CC4F 3JARB 2AIFA 4TV8B 3C9RA 1FSZA 3F0FA 3IEQA 1KNJA 3QTYA 1RQ2A 3S03A 3CPWF 1RLUA 3LMEA 2UZHA 4B5CA 2QTPA 3CCRF 5GINC 1DT9A 2KGWA 2H6LA 1X7PA 3CB2A 3E20B 5LOVB 3JASA 1DBFA 4U3JB 3IEWA 5JVDA 5LP6B 1W55A 5EIBD 2HRUA 3TD4A 3E1YA 2VXYA 5HXZA 1NMUB 2BO1A 3ZO8A 3MCQA 4M8IA 5B8FA 3KIZA 2ZODA 3DC2A 4I55B 3VYTC 1R1MA 3WGLA 4XCQA 1N8RH 1X25A 3JVHA 3WGMA 1QD9A 3HWUA 5J2UA 3ESJA 4O4HA 1Q81H 1JFFA 1KQSF 2RB9A 5EO3A 3R0PA 1XRGA 3S0YA 5IJ0A 5KX5B 3SIUA 1GO1A 2GLZA 1QVGF 3P10A 1SDSA 3CXCF 2IG8A 3VTIC 3OW2F 1NQ3A 1YGYA 2HP0A 1TUBA 3LFOA 2H8EA 5CA1A 4G4YA 2W8BC 3U0OA 4G4XA 4EB6A 3DDNA 4NWOB 5CB4B 3LYBA 1IV4A 3CCMF 3RYHA 4YJ2A 2KG4A 5ITZB 1VQMF 5G4UC 4HNAA 4O2BB 2Z1UA 1JY8A 3JATA 4X1IA 1H7MA 5MN4A 1ZWZA 1NJIH 4IHJA 1XBIA 4X1KA 3ZOPA 2R751 1KC8H 3WPXA 2Z1TA 1X7OA 1GZ0A 1W581 5LA6A 2AIZP 2VAPA 3WGNA 4DXDA 2GZLA 2PMPA 5KMGB 1XHOA 4X20A 5IJ9B 1YJ9F 2GVIA 2OTLF 3PLAC 3FFMA 1TVKB 5A2QM 1VQOF 4IHJB 4RQOA 3T80A 2R6R1 3KHNA 4TV9B 3V7QA 3TD5A 3RA5A 3WJQA 3MCAB 3K0TA 3N2KB 2IAFA 1Z5WA 2VGNA 4ZOLA 3VI6A 5JQGA 4F6RB 1W42A 1FNKA 3C9SA 2QEXF 1GO0A 3C9UA 1QAHA 3ELCA 4EI8A 4BW0B 2LCAA 3RYCB 2KTVA 4DRXA 5GONA 1VQ6F 4ZHVA 5BMVB 3CCVF 4BVRA 2QI2A 3O85A 3GHZA 3IMPA 1RQ7A 1H48A 2HRYA 3WJRA 5GANK 3HKBA 3HAXD 3VIUA 4O4LB 4WBNA 4B62A 5LXTA 3JAMM 4G4WA 3N4YA 3JAKA 2B33A 3VMFB 4X3LA 5HP7A 3LWOC 2I6RA 4B45A 3RA6A 3NK6A 3TD3A 1M90H 2OHWA 4FFBA 5HXUA 1FFXB 3N2GB 2AMTA 2Z1EA 5HY2A 1VQ7F 4BT3A 1U3LA 2H8CA 5LXTB 5EZYA 4BT4A 3LWPC 3JAKB 5J2TA 5GIOC 2BTOA 2UYPA 3ON1A 3D00A 3LDTA 1VQLF 1W3EX 3WGJA 4G88A 3JALA 1IPAA 3N4ZA 3QUWA 3CCUF 1K73H 1VQKF 5MN6A 2RHLA 2EWCA 1Q8RA 4ZI7A 3C9TA 2CSLA 3RYIA 2CZWA 2N48A 1QVFF 3LWVC 1K9MH 3HTNA 1KNKA 5EZYB 3JAWA 3JASB 3L7QA 3C8LA 5JVDB 3IKFA 4TUYA 3WGKA 4BVSA 1JN1A 4PWTA 4BVTA 1XV2A 3UT5A 5FLXM 3KJJA 1VQNF 1VH8A 3NVKE 1W59A 3VYSC 3QHDA 5FNVA 1VQVA 3JCMM 5LP6C 3M84A 2OTJF 2ZVYA 3OBYA 2LBWA 5J2UB 4O4HB 4BT2A 2WALA 1JFFB 2Q1XA 1VK3A 3CYQA 3HJWC 3I56F 3K2XA 2PHNA 3CPQA 3MQWA 5IJ0B 4TUYB 1YJWF 3V3TA 1SA0A 3V7EA 2Z01A 4ZHQA 5CA0A 2HP0B 4C82A 5JH7A 1TUBB 4B46A 1YHQF 5CA1B 1IV3A 4IIJA 4EB6B 3CD6F 3M1XA 4G4VA 4C8EA 2LBTA 4ZK7A 1Z5VA 4X1YA 3RYHB 5HP8A 1K8AH 4YJ2B 4C8IA 4HNAB 3P0ZA 1ONIA 3JATB 4X1IB 5EWRA 5JCOC 2HS4A 2K1SA 3M4SA 2ZOVA 3F0DA 4X1KB 2JNBA 5IYZA 3GYQA 3MDOA 3J81M 5CA0B 1QU9A 3IR9A 4ZHWA 3J7AR 5LA6B 5EYPA 1YIJF 2RHHA 4LNUA 3I7TA 4BVQA 3FPIA 4X20B 4I4TA 3LWQC 3EORA 1VQPF 5MN5A 1IV1A 1GX1A 1W5FA 5C8YA 2OTMA 3ZP7A 3CYPB 5EAZA 3K12A 3S0WA 3CCLF 5EB0A 3ZP4A 3CCSF 2CWJA 2UYNA 1W5BA 5IYZB 2NMUA 2CHSA 4TZZA 3WPWA 3VOAA 4O4JA 1H47A 3VO8A
chains in the Genus database with same CATH topology
4ZHWA 3S06A 3TD4A 4ZHYB 2AIZP 4G4YA 2W8BC 3LDTA 4G4XA 1OAPA 5EB1B 4G4VA 2ZVZA 2LBTA 2MQEA 4G88A 2LCAA 3TD3A 1R1MA 2ZVYA 3CYPB 5EAZA 3S03A 3S0WA 4ZHVA 3S02A 5EB0A 4R40B 4B5CA 4PWTA 4RHAA 2HQSC 3IMPA 3KHNA 2K1SA 3CYQA 2ZOVA 2KGWA 3WPXA 3S0YA 2N48A 3S0HA 3TD5A 4ERHA 3WPWA 3OONA 4B62A 4G4ZA 2ZF8A 2L26A 4G4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZHW A;  3S06 A;  3TD4 A;  4ZHY B;  2AIZ P;  4G4Y A;  2W8B C;  3LDT A;  4G4X A;  1OAP A;  5EB1 B;  4G4V A;  2ZVZ A;  2LBT A;  2MQE A;  4G88 A;  2LCA A;  3TD3 A;  1R1M A;  2ZVY A;  3CYP B;  5EAZ A;  3S03 A;  3S0W A;  4ZHV A;  3S02 A;  5EB0 A;  4R40 B;  4B5C A;  4PWT A;  4RHA A;  2HQS C;  3IMP A;  3KHN A;  2K1S A;  3CYQ A;  2ZOV A;  2KGW A;  3WPX A;  3S0Y A;  2N48 A;  3S0H A;  3TD5 A;  4ERH A;  3WPW A;  3OON A;  4B62 A;  4G4Z A;  2ZF8 A;  2L26 A;  4G4W A; 
#chains in the Genus database with same CATH topology
 4ZOL B;  5JQG B;  2UYJ A;  1VQ9 F;  4LCK A;  3E22 A;  1COM A;  4YJ3 A;  3HKC A;  4NQ3 A;  3RE3 A;  3CCE F;  2G9I A;  1YIT F;  3PAF A;  4I4T B;  1E7K A;  4O2A A;  3I55 F;  4BT7 A;  3HKD A;  2Z1F A;  4C81 A;  1U43 A;  3P4E A;  4DRX B;  5GON B;  2HP3 A;  4BT5 A;  1VQ5 F;  4R40 B;  1RLG A;  4RHA A;  3HKB B;  4C8G A;  4WBN B;  5LOV A;  3D54 A;  4U3J A;  5LP6 A;  2DT4 A;  3WJP A;  1M1K H;  5HWE A;  3NVI B;  3HKC B;  2FC3 A;  4O2A B;  4I55 A;  2UYK A;  3HKD B;  3CME F;  2DYY A;  3RYF A;  3CG6 A;  4FFB B;  4BT6 A;  3Q8H A;  5HY0 A;  1VQ8 F;  3HKE A;  1S72 F;  2RHJ A;  2CHT A;  1CN7 A;  1CLI A;  3G6E F;  5LYJ A;  5KX5 A;  1YQN A;  1YI2 F;  5J2T B;  4G4Z A;  3G71 F;  3KJK A;  2FGY A;  3S06 A;  1KD1 H;  4O4I A;  4E6E A;  5JCO A;  4EI7 A;  3RYF B;  3VYU C;  2OZB A;  5CB4 A;  4EI9 A;  1CK2 A;  3F6M A;  3JAL B;  4I50 A;  3CMA F;  4NUT A;  2BTU A;  3NK7 A;  5ITZ A;  3HKE B;  4O2B A;  2P6Y A;  3IKE A;  4ZI7 B;  2CW4 A;  2ALE A;  3RYI B;  5LYJ B;  2Q1Y A;  3JAW B;  1VQ4 F;  1Q82 H;  2V9Y A;  3UT5 B;  1U3P A;  4O4I B;  3BYQ A;  1JJ2 F;  3B6N A;  5DCV A;  3OBW A;  3CC2 F;  3K14 A;  5KMG A;  5EB1 B;  1ODE A;  2ZVZ A;  4I50 B;  3CCQ F;  2CVL A;  5IJ9 A;  5FNV B;  1X52 A;  2QA4 F;  4X3M A;  3F0G A;  1TVK A;  3FD5 A;  3S02 A;  4KWE A;  2VAW A;  4BY9 D;  2HQS C;  2VGM A;  4TV9 A;  2HS3 A;  1YJN F;  5FJ4 C;  1SA0 B;  1Q7Y H;  3SIV A;  3N2K A;  4ZHQ B;  2ZF8 A;  5GIP C;  2L26 A;  3F0E A;  5JH7 B;  5GAP K;  2RHO A;  3D01 A;  3KE1 A;  5AVM A;  1JD1 A;  2YXZ A;  4IIJ B;  4F6R A;  3LWR C;  1W41 A;  3CC7 F;  3VCZ A;  5EIB C;  4X1Y B;  3RYC A;  1OFU A;  5BMV A;  5HY4 A;  1W5E A;  1VHA A;  1FNJ A;  3MBM A;  3ERN A;  1U40 A;  3GTZ A;  3AGK A;  1UI9 A;  1W5A A;  4ERH A;  4O4L A;  1T0A A;  2HS0 A;  3OON A;  1W40 A;  4ZHY B;  5IT9 M;  2I6D A;  2YYE A;  5EYP B;  4LNU B;  3G4S F;  1J7H A;  1W57 A;  1PXW A;  2F9Z C;  1OAP A;  3VOB A;  1Q86 H;  2MQE A;  3JAR A;  4TV8 A;  3WXM B;  5HY1 A;  5C8Y B;  1FFX A;  5G4V C;  2BTQ B;  3N2G A;  2IQQ A;  3J80 M;  2ZAU A;  3V4D A;  3FD6 A;  2HVY D;  2KTU A;  2UYN B;  1RA4 A;  3S0H A;  2VAM A;  1T0K B;  3NMU C;  4C4W C;  4U39 A;  2HX0 A;  3I3F A;  4O4J B;  1W2B F;  3FBA A;  1SZQ A;  2LBX A;  3E22 B;  4YJ3 B;  3CCJ F;  1PF5 A;  1IV2 A;  1UFY A;  3CC4 F;  3JAR B;  2AIF A;  4TV8 B;  3C9R A;  1FSZ A;  3F0F A;  3IEQ A;  1KNJ A;  3QTY A;  1RQ2 A;  3S03 A;  3CPW F;  1RLU A;  3LME A;  2UZH A;  4B5C A;  2QTP A;  3CCR F;  5GIN C;  1DT9 A;  2KGW A;  2H6L A;  1X7P A;  3CB2 A;  3E20 B;  5LOV B;  3JAS A;  1DBF A;  4U3J B;  3IEW A;  5JVD A;  5LP6 B;  1W55 A;  5EIB D;  2HRU A;  3TD4 A;  3E1Y A;  2VXY A;  5HXZ A;  1NMU B;  2BO1 A;  3ZO8 A;  3MCQ A;  4M8I A;  5B8F A;  3KIZ A;  2ZOD A;  3DC2 A;  4I55 B;  3VYT C;  1R1M A;  3WGL A;  4XCQ A;  1N8R H;  1X25 A;  3JVH A;  3WGM A;  1QD9 A;  3HWU A;  5J2U A;  3ESJ A;  4O4H A;  1Q81 H;  1JFF A;  1KQS F;  2RB9 A;  5EO3 A;  3R0P A;  1XRG A;  3S0Y A;  5IJ0 A;  5KX5 B;  3SIU A;  1GO1 A;  2GLZ A;  1QVG F;  3P10 A;  1SDS A;  3CXC F;  2IG8 A;  3VTI C;  3OW2 F;  1NQ3 A;  1YGY A;  2HP0 A;  1TUB A;  3LFO A;  2H8E A;  5CA1 A;  4G4Y A;  2W8B C;  3U0O A;  4G4X A;  4EB6 A;  3DDN A;  4NWO B;  5CB4 B;  3LYB A;  1IV4 A;  3CCM F;  3RYH A;  4YJ2 A;  2KG4 A;  5ITZ B;  1VQM F;  5G4U C;  4HNA A;  4O2B B;  2Z1U A;  1JY8 A;  3JAT A;  4X1I A;  1H7M A;  5MN4 A;  1ZWZ A;  1NJI H;  4IHJ A;  1XBI A;  4X1K A;  3ZOP A;  2R75 1;  1KC8 H;  3WPX A;  2Z1T A;  1X7O A;  1GZ0 A;  1W58 1;  5LA6 A;  2AIZ P;  2VAP A;  3WGN A;  4DXD A;  2GZL A;  2PMP A;  5KMG B;  1XHO A;  4X20 A;  5IJ9 B;  1YJ9 F;  2GVI A;  2OTL F;  3PLA C;  3FFM A;  1TVK B;  5A2Q M;  1VQO F;  4IHJ B;  4RQO A;  3T80 A;  2R6R 1;  3KHN A;  4TV9 B;  3V7Q A;  3TD5 A;  3RA5 A;  3WJQ A;  3MCA B;  3K0T A;  3N2K B;  2IAF A;  1Z5W A;  2VGN A;  4ZOL A;  3VI6 A;  5JQG A;  4F6R B;  1W42 A;  1FNK A;  3C9S A;  2QEX F;  1GO0 A;  3C9U A;  1QAH A;  3ELC A;  4EI8 A;  4BW0 B;  2LCA A;  3RYC B;  2KTV A;  4DRX A;  5GON A;  1VQ6 F;  4ZHV A;  5BMV B;  3CCV F;  4BVR A;  2QI2 A;  3O85 A;  3GHZ A;  3IMP A;  1RQ7 A;  1H48 A;  2HRY A;  3WJR A;  5GAN K;  3HKB A;  3HAX D;  3VIU A;  4O4L B;  4WBN A;  4B62 A;  5LXT A;  3JAM M;  4G4W A;  3N4Y A;  3JAK A;  2B33 A;  3VMF B;  4X3L A;  5HP7 A;  3LWO C;  2I6R A;  4B45 A;  3RA6 A;  3NK6 A;  3TD3 A;  1M90 H;  2OHW A;  4FFB A;  5HXU A;  1FFX B;  3N2G B;  2AMT A;  2Z1E A;  5HY2 A;  1VQ7 F;  4BT3 A;  1U3L A;  2H8C A;  5LXT B;  5EZY A;  4BT4 A;  3LWP C;  3JAK B;  5J2T A;  5GIO C;  2BTO A;  2UYP A;  3ON1 A;  3D00 A;  3LDT A;  1VQL F;  1W3E X;  3WGJ A;  4G88 A;  3JAL A;  1IPA A;  3N4Z A;  3QUW A;  3CCU F;  1K73 H;  1VQK F;  5MN6 A;  2RHL A;  2EWC A;  1Q8R A;  4ZI7 A;  3C9T A;  2CSL A;  3RYI A;  2CZW A;  2N48 A;  1QVF F;  3LWV C;  1K9M H;  3HTN A;  1KNK A;  5EZY B;  3JAW A;  3JAS B;  3L7Q A;  3C8L A;  5JVD B;  3IKF A;  4TUY A;  3WGK A;  4BVS A;  1JN1 A;  4PWT A;  4BVT A;  1XV2 A;  3UT5 A;  5FLX M;  3KJJ A;  1VQN F;  1VH8 A;  3NVK E;  1W59 A;  3VYS C;  3QHD A;  5FNV A;  1VQV A;  3JCM M;  5LP6 C;  3M84 A;  2OTJ F;  2ZVY A;  3OBY A;  2LBW A;  5J2U B;  4O4H B;  4BT2 A;  2WAL A;  1JFF B;  2Q1X A;  1VK3 A;  3CYQ A;  3HJW C;  3I56 F;  3K2X A;  2PHN A;  3CPQ A;  3MQW A;  5IJ0 B;  4TUY B;  1YJW F;  3V3T A;  1SA0 A;  3V7E A;  2Z01 A;  4ZHQ A;  5CA0 A;  2HP0 B;  4C82 A;  5JH7 A;  1TUB B;  4B46 A;  1YHQ F;  5CA1 B;  1IV3 A;  4IIJ A;  4EB6 B;  3CD6 F;  3M1X A;  4G4V A;  4C8E A;  2LBT A;  4ZK7 A;  1Z5V A;  4X1Y A;  3RYH B;  5HP8 A;  1K8A H;  4YJ2 B;  4C8I A;  4HNA B;  3P0Z A;  1ONI A;  3JAT B;  4X1I B;  5EWR A;  5JCO C;  2HS4 A;  2K1S A;  3M4S A;  2ZOV A;  3F0D A;  4X1K B;  2JNB A;  5IYZ A;  3GYQ A;  3MDO A;  3J81 M;  5CA0 B;  1QU9 A;  3IR9 A;  4ZHW A;  3J7A R;  5LA6 B;  5EYP A;  1YIJ F;  2RHH A;  4LNU A;  3I7T A;  4BVQ A;  3FPI A;  4X20 B;  4I4T A;  3LWQ C;  3EOR A;  1VQP F;  5MN5 A;  1IV1 A;  1GX1 A;  1W5F A;  5C8Y A;  2OTM A;  3ZP7 A;  3CYP B;  5EAZ A;  3K12 A;  3S0W A;  3CCL F;  5EB0 A;  3ZP4 A;  3CCS F;  2CWJ A;  2UYN A;  1W5B A;  5IYZ B;  2NMU A;  2CHS A;  4TZZ A;  3WPW A;  3VOA A;  4O4J A;  1H47 A;  3VO8 A; 
#chains in the Genus database with same CATH homology
 4ZHW A;  3S06 A;  3TD4 A;  4ZHY B;  2AIZ P;  4G4Y A;  2W8B C;  3LDT A;  4G4X A;  1OAP A;  5EB1 B;  4G4V A;  2ZVZ A;  2LBT A;  2MQE A;  4G88 A;  2LCA A;  3TD3 A;  1R1M A;  2ZVY A;  3CYP B;  5EAZ A;  3S03 A;  3S0W A;  4ZHV A;  3S02 A;  5EB0 A;  4R40 B;  4B5C A;  4PWT A;  4RHA A;  2HQS C;  3IMP A;  3KHN A;  2K1S A;  3CYQ A;  2ZOV A;  2KGW A;  3WPX A;  3S0Y A;  2N48 A;  3S0H A;  3TD5 A;  4ERH A;  3WPW A;  3OON A;  4B62 A;  4G4Z A;  2ZF8 A;  2L26 A;  4G4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...