2AIZP

Solution structure of peptidoglycan associated lipoprotein from haemophilus influenza bound to udp-n-acetylmuramoyl-l-alanyl-d-glutamyl-meso-2,6-diaminopimeloyl-d-alanyl-d-alanine
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
134
Chain Sequence
CSSSNNDAAGNGAAQTFGGYSVADLQQRYNTVYFGFDKYDITGEYVQILDAHAAYLNATPAAKVLVEGNTDERGTPEYNIALGQRRADAVKGYLAGKGVDAGKLGTVSYGEEKPAVLGHDEAAYSKNRRAVLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein P6
publication title Peptidoglycan recognition by pal, an outer membrane lipoprotein.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Membrane protein
total genus 32
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2005-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2aizP01
2W8BC 5EB1B 4R40B 2ZVZA 4ZHVA 4RHAA 2MQEA 5EAZA 4G4ZA 3S06A 2LCAA 3S0WA 3S0HA 3IMPA 2LBTA 2HQSC 3WPWA 4ZHYB 3S03A 3TD4A 1OAPA 4G4WA 4G4XA 2KGWA 3TD3A 4B5CA 4PWTA 4G88A 3KHNA 4G4YA 4G4VA 2ZF8A 2N48A 4ZHWA 3S02A 2L26A 1R1MA 5EB0A 2AIZP 3CYQA 3LDTA 3OONA 4B62A 2K1SA 3S0YA 3WPXA 4ERHA 2ZOVA 3CYPB 3TD5A 2ZVYA
chains in the Genus database with same CATH superfamily
3PLAC 1YQNA 4BT7A 3OW2F 2Z1UA 1KC8H 3HTNA 4X1KB 3O85A 4O2BA 1QU9A 2KTVA 1M90H 4I50B 3FBAA 1XV2A 3K0TA 3K12A 2QI2A 5LP6B 4KWEA 2RHJA 3F0FA 5JVDA 5CA0B 2CW4A 3VI6A 4O2AB 4BVSA 4E6EA 1JY8A 5ITZA 3V4DA 2BTOA 1U40A 1TVKA 2LBXA 5A2QM 1VQ9F 2HVYD 3JASB 4DXDA 5GAPK 1K73H 1Q7YH 3M4SA 5J2UB 2QA4F 2CHSA 2RB9A 3UT5A 3VMFB 4EB6A 5KX5A 4I4TB 3VYSC 1H48A 1W5BA 1W59A 2RHLA 2WALA 1S72F 4B5CA 1DBFA 3QHDA 3KHNA 4G4VA 2BTUA 2N48A 4X20A 1YI2F 4HNAB 1IV1A 1OFUA 5LXTA 3CXCF 2H8CA 3OBYA 1SDSA 3LWRC 2OTLF 2ZOVA 5MN4A 3VOBA 3DDNA 1QD9A 5MN6A 4NWOB 3E22B 1SZQA 3NK7A 3F0EA 1FFXA 2ZAUA 2UYNA 2VAWA 3SIUA 2YXZA 1FNKA 1W3EX 2RHHA 4G4WA 5EZYB 2VXYA 4TUYA 2OHWA 4G4YA 5GONA 3WGMA 5BMVA 3CCMF 2ZF8A 3JATA 3RYFB 3CCJF 4IIJB 4O4LA 5GINC 4X1IB 1X7OA 2BTQB 4BVTA 3N4ZA 2KTUA 3CMEF 3CD6F 4EI9A 3ZP7A 3J80M 1W2BF 3R0PA 2ZVZA 2ZODA 4FFBB 5CA1B 5JCOC 3WJQA 1QVGF 4G4ZA 3ELCA 2F9ZC 2LCAA 4X3LA 5KMGB 3CG6A 1GZ0A 3CCLF 4O4HB 4ZI7A 4I55B 2HX0A 4PWTA 5LOVA 1ZWZA 3FPIA 3T80A 3JAKA 4O4JB 3S02A 3CC4F 4TV9A 3CCRF 3FFMA 3LWQC 5HP7A 1XHOA 5HXZA 2PMPA 2Z1TA 2H8EA 3N4YA 1YIJF 1VQLF 3LYBA 3RYHA 2ALEA 3N2GA 3WGNA 3ZP4A 3HKDA 2G9IA 5HWEA 1T0AA 3QUWA 5J2TB 4U3JB 5JCOA 2Z1FA 3K14A 3VOAA 4F6RB 2IG8A 1N8RH 2DT4A 2KGWA 3RE3A 2GZLA 2Q1YA 4C8IA 1VQ4F 1RLGA 2BO1A 1W41A 1VQOF 1X7PA 3MBMA 3LFOA 3G6EF 1SA0A 2CVLA 3EORA 3RYIB 1IPAA 1K8AH 2CWJA 1VQ6F 3C9RA 3JARA 3RA5A 5LP6C 3N2KA 1U43A 3E1YA 3KJKA 1KNJA 3JAMM 3HKCB 3HKBA 1Q82H 3JAWB 3ON1A 4G88A 2Z1EA 3ERNA 1TUBB 3D00A 4C8EA 3ZOPA 1KNKA 3V7EA 4DRXB 5GANK 2GVIA 3MDOA 3LWPC 3F0DA 2CSLA 1U3LA 3P4EA 1CLIA 2AMTA 3NK6A 4X1KA 3WJRA 1VQ5F 3CCEF 4LNUB 2QEXF 5AVMA 2KG4A 4EB6B 1KD1H 3IKEA 3JCMM 3CB2A 1YHQF 3TD3A 5LP6A 1Q86H 5EYPB 3IR9A 5EWRA 1QAHA 5CA0A 4BW0B 5IYZB 2L26A 1RQ7A 3I55F 1PF5A 1RA4A 3WPXA 4ERHA 3WXMB 3RYCB 3M1XA 1XRGA 3G71F 5EB1B 3JASA 5LYJB 3DC2A 5J2UA 4RQOA 2OTJF 2AIFA 2I6RA 3C8LA 3C9SA 4I4TA 4ZHYB 3CCVF 5EIBC 4TV8A 4C4WC 2NMUA 1OAPA 4YJ3B 3CMAF 3M84A 2UYJA 2HS0A 2CHTA 1IV2A 4HNAA 1ONIA 5C8YB 4O4IB 1GO1A 4ZHQA 1H7MA 4ZOLB 2HP3A 5CB4B 5FJ4C 3E22A 3P0ZA 4RHAA 2MQEA 3S0WA 3LWVC 2HQSC 5LA6B 4BT3A 3V7QA 3WGLA 5EZYA 1YJNF 3RYFA 5IJ0B 3CCUF 3BYQA 3HAXD 2UYKA 4X1IA 2IAFA 3CYQA 1JFFB 3OONA 4EI7A 3KIZA 3S0YA 4WBNB 2UZHA 5JH7B 2HS4A 3TD5A 5HY1A 1CN7A 3HKEA 4FFBA 5CA1A 1RQ2A 3GYQA 3JALB 3S06A 5FNVB 4EI8A 4X1YA 3J7AR 1W5AA 4O4HA 3CCSF 1E7KA 4NUTA 3VIUA 4I55A 3S03A 1DT9A 3FD6A 5G4VC 2HP0B 4X3MA 3L7QA 1VH8A 4O4JA 5IJ9B 4ZHWA 4IHJB 1GX1A 1ODEA 4YJ2B 2AIZP 2HRUA 3CC7F 3Q8HA 3C9UA 1VQVA 5JQGB 4B62A 1VQNF 2K1SA 2R6R1 3E20B 1VQMF 3U0OA 3I56F 2I6DA 3IEWA 1YJWF 3KE1A 5J2TA 4U3JA 1W581 1W5FA 4O2BB 4F6RA 5HY4A 1CK2A 4LCKA 3J81M 2HS3A 4ZK7A 3NVKE 3P10A 1YJ9F 3C9TA 1R1MA 5JVDB 5EB0A 2EWCA 1Z5WA 1GO0A 3KJJA 3CPWF 3RYIA 4U39A 5ITZB 5HXUA 3SIVA 1UFYA 1Q8RA 3AGKA 3GTZA 3HJWC 1VQ8F 1TVKB 2QTPA 1IV3A 1X52A 1VQ7F 3HKCA 1RLUA 4I50A 4XCQA 3UT5B 3JAWA 5KX5B 4B45A 1COMA 1TUBA 3VYUC 4DRXA 3B6NA 2VAMA 4O2AA 4X20B 1YGYA 3NMUC 2Q1XA 1IV4A 5LXTB 2LBTA 4TZZA 1VQKF 1QVFF 1KQSF 1Z5VA 2B33A 2LBWA 1FFXB 3IMPA 3VYTC 4LNUA 2UYNB 4TV8B 1J7HA 3I3FA 4G4XA 1VHAA 5EYPA 4TUYB 3VTIC 5IYZA 4BY9D 1VK3A 2UYPA 2OTMA 5GONB 5BMVB 1Q81H 5GIOC 2FGYA 3JATB 5HY2A 2YYEA 4O4LB 3QTYA 3LDTA 1W40A 5GIPC 3HWUA 4BVQA 4ZHQB 3RYCA 3RA6A 4C8GA 5MN5A 2W8BC 5LYJA 1FSZA 1JD1A 4R40B 4ZHVA 1JJ2F 4BT6A 1K9MH 3OBWA 1NMUB 3D01A 1H47A 2Z01A 2IQQA 3IKFA 3MCQA 4YJ3A 4B46A 1W55A 4BVRA 1VQPF 1YITF 4ZI7B 2V9YA 1W42A 4BT2A 5LOVB 3MCAB 5IT9M 3NVIB 4C82A 4IIJA 3JAKB 1XBIA 3D54A 5C8YA 4TV9B 3ZO8A 4O4IA 4ZOLA 2VGMA 5CB4A 2CZWA 3CCQF 4C81A 3F6MA 3HKEB 5G4UC 3RYHB 2OZBA 2PHNA 5EAZA 3N2GB 2FC3A 3HKDB 4NQ3A 5LA6A 4BT4A 3LMEA 1W5EA 5B8FA 4X1YB 3CC2F 1M1KH 5EIBD 2VGNA 3JVHA 5KMGA 1FNJA 3FD5A 2JNBA 1PXWA 3MQWA 3V3TA 3WGKA 5IJ0A 2GLZA 3VCZA 1NQ3A 2P6YA 3LWOC 1T0KB 1JFFA 1X25A 1W57A 4M8IA 3G4SF 3VO8A 4WBNA 5HY0A 5JH7A 5FLXM 1SA0B 2H6LA 2RHOA 3ESJA 3IEQA 3JALA 1NJIH 5FNVA 3F0GA 1UI9A 3CPQA 3K2XA 3S0HA 3JARB 3WPWA 3N2KB 5DCVA 2HP0A 3TD4A 2R751 2DYYA 3HKBB 5IJ9A 1JN1A 4IHJA 3WJPA 1U3PA 3PAFA 4YJ2A 4BT5A 2HRYA 3GHZA 5JQGA 5EO3A 3WGJA 2VAPA 3I7TA 5HP8A 3CYPB 2ZVYA
chains in the Genus database with same CATH topology
2W8BC 5EB1B 4R40B 2ZVZA 4ZHVA 4RHAA 2MQEA 5EAZA 4G4ZA 3S06A 2LCAA 3S0WA 3S0HA 3IMPA 2LBTA 2HQSC 3WPWA 4ZHYB 3S03A 3TD4A 1OAPA 4G4WA 4G4XA 2KGWA 3TD3A 4B5CA 4PWTA 4G88A 3KHNA 4G4YA 4G4VA 2ZF8A 2N48A 4ZHWA 3S02A 2L26A 1R1MA 5EB0A 2AIZP 3CYQA 3LDTA 3OONA 4B62A 2K1SA 3S0YA 3WPXA 4ERHA 2ZOVA 3CYPB 3TD5A 2ZVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W8B C;  5EB1 B;  4R40 B;  2ZVZ A;  4ZHV A;  4RHA A;  2MQE A;  5EAZ A;  4G4Z A;  3S06 A;  2LCA A;  3S0W A;  3S0H A;  3IMP A;  2LBT A;  2HQS C;  3WPW A;  4ZHY B;  3S03 A;  3TD4 A;  1OAP A;  4G4W A;  4G4X A;  2KGW A;  3TD3 A;  4B5C A;  4PWT A;  4G88 A;  3KHN A;  4G4Y A;  4G4V A;  2ZF8 A;  2N48 A;  4ZHW A;  3S02 A;  2L26 A;  1R1M A;  5EB0 A;  2AIZ P;  3CYQ A;  3LDT A;  3OON A;  4B62 A;  2K1S A;  3S0Y A;  3WPX A;  4ERH A;  2ZOV A;  3CYP B;  3TD5 A;  2ZVY A; 
#chains in the Genus database with same CATH topology
 3PLA C;  1YQN A;  4BT7 A;  3OW2 F;  2Z1U A;  1KC8 H;  3HTN A;  4X1K B;  3O85 A;  4O2B A;  1QU9 A;  2KTV A;  1M90 H;  4I50 B;  3FBA A;  1XV2 A;  3K0T A;  3K12 A;  2QI2 A;  5LP6 B;  4KWE A;  2RHJ A;  3F0F A;  5JVD A;  5CA0 B;  2CW4 A;  3VI6 A;  4O2A B;  4BVS A;  4E6E A;  1JY8 A;  5ITZ A;  3V4D A;  2BTO A;  1U40 A;  1TVK A;  2LBX A;  5A2Q M;  1VQ9 F;  2HVY D;  3JAS B;  4DXD A;  5GAP K;  1K73 H;  1Q7Y H;  3M4S A;  5J2U B;  2QA4 F;  2CHS A;  2RB9 A;  3UT5 A;  3VMF B;  4EB6 A;  5KX5 A;  4I4T B;  3VYS C;  1H48 A;  1W5B A;  1W59 A;  2RHL A;  2WAL A;  1S72 F;  4B5C A;  1DBF A;  3QHD A;  3KHN A;  4G4V A;  2BTU A;  2N48 A;  4X20 A;  1YI2 F;  4HNA B;  1IV1 A;  1OFU A;  5LXT A;  3CXC F;  2H8C A;  3OBY A;  1SDS A;  3LWR C;  2OTL F;  2ZOV A;  5MN4 A;  3VOB A;  3DDN A;  1QD9 A;  5MN6 A;  4NWO B;  3E22 B;  1SZQ A;  3NK7 A;  3F0E A;  1FFX A;  2ZAU A;  2UYN A;  2VAW A;  3SIU A;  2YXZ A;  1FNK A;  1W3E X;  2RHH A;  4G4W A;  5EZY B;  2VXY A;  4TUY A;  2OHW A;  4G4Y A;  5GON A;  3WGM A;  5BMV A;  3CCM F;  2ZF8 A;  3JAT A;  3RYF B;  3CCJ F;  4IIJ B;  4O4L A;  5GIN C;  4X1I B;  1X7O A;  2BTQ B;  4BVT A;  3N4Z A;  2KTU A;  3CME F;  3CD6 F;  4EI9 A;  3ZP7 A;  3J80 M;  1W2B F;  3R0P A;  2ZVZ A;  2ZOD A;  4FFB B;  5CA1 B;  5JCO C;  3WJQ A;  1QVG F;  4G4Z A;  3ELC A;  2F9Z C;  2LCA A;  4X3L A;  5KMG B;  3CG6 A;  1GZ0 A;  3CCL F;  4O4H B;  4ZI7 A;  4I55 B;  2HX0 A;  4PWT A;  5LOV A;  1ZWZ A;  3FPI A;  3T80 A;  3JAK A;  4O4J B;  3S02 A;  3CC4 F;  4TV9 A;  3CCR F;  3FFM A;  3LWQ C;  5HP7 A;  1XHO A;  5HXZ A;  2PMP A;  2Z1T A;  2H8E A;  3N4Y A;  1YIJ F;  1VQL F;  3LYB A;  3RYH A;  2ALE A;  3N2G A;  3WGN A;  3ZP4 A;  3HKD A;  2G9I A;  5HWE A;  1T0A A;  3QUW A;  5J2T B;  4U3J B;  5JCO A;  2Z1F A;  3K14 A;  3VOA A;  4F6R B;  2IG8 A;  1N8R H;  2DT4 A;  2KGW A;  3RE3 A;  2GZL A;  2Q1Y A;  4C8I A;  1VQ4 F;  1RLG A;  2BO1 A;  1W41 A;  1VQO F;  1X7P A;  3MBM A;  3LFO A;  3G6E F;  1SA0 A;  2CVL A;  3EOR A;  3RYI B;  1IPA A;  1K8A H;  2CWJ A;  1VQ6 F;  3C9R A;  3JAR A;  3RA5 A;  5LP6 C;  3N2K A;  1U43 A;  3E1Y A;  3KJK A;  1KNJ A;  3JAM M;  3HKC B;  3HKB A;  1Q82 H;  3JAW B;  3ON1 A;  4G88 A;  2Z1E A;  3ERN A;  1TUB B;  3D00 A;  4C8E A;  3ZOP A;  1KNK A;  3V7E A;  4DRX B;  5GAN K;  2GVI A;  3MDO A;  3LWP C;  3F0D A;  2CSL A;  1U3L A;  3P4E A;  1CLI A;  2AMT A;  3NK6 A;  4X1K A;  3WJR A;  1VQ5 F;  3CCE F;  4LNU B;  2QEX F;  5AVM A;  2KG4 A;  4EB6 B;  1KD1 H;  3IKE A;  3JCM M;  3CB2 A;  1YHQ F;  3TD3 A;  5LP6 A;  1Q86 H;  5EYP B;  3IR9 A;  5EWR A;  1QAH A;  5CA0 A;  4BW0 B;  5IYZ B;  2L26 A;  1RQ7 A;  3I55 F;  1PF5 A;  1RA4 A;  3WPX A;  4ERH A;  3WXM B;  3RYC B;  3M1X A;  1XRG A;  3G71 F;  5EB1 B;  3JAS A;  5LYJ B;  3DC2 A;  5J2U A;  4RQO A;  2OTJ F;  2AIF A;  2I6R A;  3C8L A;  3C9S A;  4I4T A;  4ZHY B;  3CCV F;  5EIB C;  4TV8 A;  4C4W C;  2NMU A;  1OAP A;  4YJ3 B;  3CMA F;  3M84 A;  2UYJ A;  2HS0 A;  2CHT A;  1IV2 A;  4HNA A;  1ONI A;  5C8Y B;  4O4I B;  1GO1 A;  4ZHQ A;  1H7M A;  4ZOL B;  2HP3 A;  5CB4 B;  5FJ4 C;  3E22 A;  3P0Z A;  4RHA A;  2MQE A;  3S0W A;  3LWV C;  2HQS C;  5LA6 B;  4BT3 A;  3V7Q A;  3WGL A;  5EZY A;  1YJN F;  3RYF A;  5IJ0 B;  3CCU F;  3BYQ A;  3HAX D;  2UYK A;  4X1I A;  2IAF A;  3CYQ A;  1JFF B;  3OON A;  4EI7 A;  3KIZ A;  3S0Y A;  4WBN B;  2UZH A;  5JH7 B;  2HS4 A;  3TD5 A;  5HY1 A;  1CN7 A;  3HKE A;  4FFB A;  5CA1 A;  1RQ2 A;  3GYQ A;  3JAL B;  3S06 A;  5FNV B;  4EI8 A;  4X1Y A;  3J7A R;  1W5A A;  4O4H A;  3CCS F;  1E7K A;  4NUT A;  3VIU A;  4I55 A;  3S03 A;  1DT9 A;  3FD6 A;  5G4V C;  2HP0 B;  4X3M A;  3L7Q A;  1VH8 A;  4O4J A;  5IJ9 B;  4ZHW A;  4IHJ B;  1GX1 A;  1ODE A;  4YJ2 B;  2AIZ P;  2HRU A;  3CC7 F;  3Q8H A;  3C9U A;  1VQV A;  5JQG B;  4B62 A;  1VQN F;  2K1S A;  2R6R 1;  3E20 B;  1VQM F;  3U0O A;  3I56 F;  2I6D A;  3IEW A;  1YJW F;  3KE1 A;  5J2T A;  4U3J A;  1W58 1;  1W5F A;  4O2B B;  4F6R A;  5HY4 A;  1CK2 A;  4LCK A;  3J81 M;  2HS3 A;  4ZK7 A;  3NVK E;  3P10 A;  1YJ9 F;  3C9T A;  1R1M A;  5JVD B;  5EB0 A;  2EWC A;  1Z5W A;  1GO0 A;  3KJJ A;  3CPW F;  3RYI A;  4U39 A;  5ITZ B;  5HXU A;  3SIV A;  1UFY A;  1Q8R A;  3AGK A;  3GTZ A;  3HJW C;  1VQ8 F;  1TVK B;  2QTP A;  1IV3 A;  1X52 A;  1VQ7 F;  3HKC A;  1RLU A;  4I50 A;  4XCQ A;  3UT5 B;  3JAW A;  5KX5 B;  4B45 A;  1COM A;  1TUB A;  3VYU C;  4DRX A;  3B6N A;  2VAM A;  4O2A A;  4X20 B;  1YGY A;  3NMU C;  2Q1X A;  1IV4 A;  5LXT B;  2LBT A;  4TZZ A;  1VQK F;  1QVF F;  1KQS F;  1Z5V A;  2B33 A;  2LBW A;  1FFX B;  3IMP A;  3VYT C;  4LNU A;  2UYN B;  4TV8 B;  1J7H A;  3I3F A;  4G4X A;  1VHA A;  5EYP A;  4TUY B;  3VTI C;  5IYZ A;  4BY9 D;  1VK3 A;  2UYP A;  2OTM A;  5GON B;  5BMV B;  1Q81 H;  5GIO C;  2FGY A;  3JAT B;  5HY2 A;  2YYE A;  4O4L B;  3QTY A;  3LDT A;  1W40 A;  5GIP C;  3HWU A;  4BVQ A;  4ZHQ B;  3RYC A;  3RA6 A;  4C8G A;  5MN5 A;  2W8B C;  5LYJ A;  1FSZ A;  1JD1 A;  4R40 B;  4ZHV A;  1JJ2 F;  4BT6 A;  1K9M H;  3OBW A;  1NMU B;  3D01 A;  1H47 A;  2Z01 A;  2IQQ A;  3IKF A;  3MCQ A;  4YJ3 A;  4B46 A;  1W55 A;  4BVR A;  1VQP F;  1YIT F;  4ZI7 B;  2V9Y A;  1W42 A;  4BT2 A;  5LOV B;  3MCA B;  5IT9 M;  3NVI B;  4C82 A;  4IIJ A;  3JAK B;  1XBI A;  3D54 A;  5C8Y A;  4TV9 B;  3ZO8 A;  4O4I A;  4ZOL A;  2VGM A;  5CB4 A;  2CZW A;  3CCQ F;  4C81 A;  3F6M A;  3HKE B;  5G4U C;  3RYH B;  2OZB A;  2PHN A;  5EAZ A;  3N2G B;  2FC3 A;  3HKD B;  4NQ3 A;  5LA6 A;  4BT4 A;  3LME A;  1W5E A;  5B8F A;  4X1Y B;  3CC2 F;  1M1K H;  5EIB D;  2VGN A;  3JVH A;  5KMG A;  1FNJ A;  3FD5 A;  2JNB A;  1PXW A;  3MQW A;  3V3T A;  3WGK A;  5IJ0 A;  2GLZ A;  3VCZ A;  1NQ3 A;  2P6Y A;  3LWO C;  1T0K B;  1JFF A;  1X25 A;  1W57 A;  4M8I A;  3G4S F;  3VO8 A;  4WBN A;  5HY0 A;  5JH7 A;  5FLX M;  1SA0 B;  2H6L A;  2RHO A;  3ESJ A;  3IEQ A;  3JAL A;  1NJI H;  5FNV A;  3F0G A;  1UI9 A;  3CPQ A;  3K2X A;  3S0H A;  3JAR B;  3WPW A;  3N2K B;  5DCV A;  2HP0 A;  3TD4 A;  2R75 1;  2DYY A;  3HKB B;  5IJ9 A;  1JN1 A;  4IHJ A;  3WJP A;  1U3P A;  3PAF A;  4YJ2 A;  4BT5 A;  2HRY A;  3GHZ A;  5JQG A;  5EO3 A;  3WGJ A;  2VAP A;  3I7T A;  5HP8 A;  3CYP B;  2ZVY A; 
#chains in the Genus database with same CATH homology
 2W8B C;  5EB1 B;  4R40 B;  2ZVZ A;  4ZHV A;  4RHA A;  2MQE A;  5EAZ A;  4G4Z A;  3S06 A;  2LCA A;  3S0W A;  3S0H A;  3IMP A;  2LBT A;  2HQS C;  3WPW A;  4ZHY B;  3S03 A;  3TD4 A;  1OAP A;  4G4W A;  4G4X A;  2KGW A;  3TD3 A;  4B5C A;  4PWT A;  4G88 A;  3KHN A;  4G4Y A;  4G4V A;  2ZF8 A;  2N48 A;  4ZHW A;  3S02 A;  2L26 A;  1R1M A;  5EB0 A;  2AIZ P;  3CYQ A;  3LDT A;  3OON A;  4B62 A;  2K1S A;  3S0Y A;  3WPX A;  4ERH A;  2ZOV A;  3CYP B;  3TD5 A;  2ZVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...