2AIZP

Solution structure of peptidoglycan associated lipoprotein from haemophilus influenza bound to udp-n-acetylmuramoyl-l-alanyl-d-glutamyl-meso-2,6-diaminopimeloyl-d-alanyl-d-alanine
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
134
Chain Sequence
CSSSNNDAAGNGAAQTFGGYSVADLQQRYNTVYFGFDKYDITGEYVQILDAHAAYLNATPAAKVLVEGNTDERGTPEYNIALGQRRADAVKGYLAGKGVDAGKLGTVSYGEEKPAVLGHDEAAYSKNRRAVLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptidoglycan recognition by pal, an outer membrane lipoprotein.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Membrane protein
molecule keywords Outer membrane protein P6
total genus 32
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2005-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2aizP01
2HQSC 4RHAA 2LCAA 3S0HA 3TD4A 3S0WA 4B5CA 4B62A 4G4ZA 2W8BC 4G4XA 4ZHVA 4G4VA 2MQEA 4G4YA 3S0YA 2ZVZA 4PWTA 3OONA 1OAPA 3WPWA 3TD3A 3KHNA 4G4WA 3CYPB 3CYQA 3IMPA 2ZF8A 3WPXA 3LDTA 2ZOVA 4G88A 2LBTA 2K1SA 2ZVYA 3S02A 5EB1B 3S03A 2L26A 3TD5A 4ERHA 2N48A 5EAZA 3S06A 1R1MA 5EB0A 4R40B 2AIZP 4ZHYB 4ZHWA 2KGWA
chains in the Genus database with same CATH superfamily
1YIJF 5G4UC 5KMGB 2ZAUA 4IIJA 3TD4A 4TZZA 3LFOA 3VYUC 5J2TB 5IT9M 2BTOA 4LNUB 2W8BC 4G4XA 1M90H 1W41A 4U39A 2DT4A 1H7MA 3ERNA 3VYSC 1Q8RA 3HKCA 1SA0A 4B45A 3SIVA 1FSZA 5LA6B 1KC8H 5EZYA 1W3EX 1K73H 2EWCA 3E22B 3IKFA 2HP0B 4BVRA 5ITZA 2ALEA 3ELCA 3HKEB 1UI9A 3CCSF 3LYBA 5JVDA 5DCVA 3K2XA 3GHZA 1RLGA 1VHAA 1PF5A 1YJ9F 3JASA 4C8EA 1VQ5F 4YJ3A 3J7AR 3N4ZA 1T0KB 3QTYA 5IYZA 3F0FA 3KHNA 1SA0B 3HKCB 3NMUC 2HS3A 1YITF 4XCQA 3HTNA 1GZ0A 3JCMM 3S02A 2ZVYA 4LCKA 3JATB 3N2KA 5HP7A 2WALA 3V7EA 3C8LA 4IHJA 1N8RH 4B5CA 4O2BA 3G4SF 3HJWC 2GVIA 3WJPA 1VQVA 4YJ2A 4I55A 4ZHVA 4G4VA 1CN7A 3JAWA 1TUBA 1VQ8F 3EORA 2Z1EA 1OAPA 3HWUA 1DBFA 2AMTA 2VXYA 3JARA 3M4SA 4TV8B 4X1IB 3RYCA 1K9MH 4E6EA 2KG4A 5LP6C 1CLIA 3JATA 5G4VC 1YGYA 3B6NA 1TVKB 3FFMA 3I56F 2HRYA 1ZWZA 2P6YA 4DXDA 3FD6A 1JJ2F 3QUWA 3M84A 3MCQA 3VTIC 4C4WC 3K0TA 3F0GA 5HY1A 2AIFA 5CA1B 5HY2A 1E7KA 3MQWA 1YI2F 5C8YA 2ZF8A 4ZI7B 5JH7A 2OTLF 3ON1A 1W5EA 4YJ3B 3NK7A 2B33A 1W55A 1W5FA 3I7TA 1UFYA 4HNAA 3T80A 1U3PA 2OTJF 3CCRF 3E1YA 1X52A 3O85A 5ITZB 5JQGB 3C9RA 3CXCF 3CCEF 2Z1FA 3N2KB 4X1YA 3JVHA 3QHDA 2QTPA 3ESJA 4NWOB 3JAMM 3MCAB 4TUYA 2HS4A 1RQ7A 4X3LA 3UT5B 5JVDB 1OFUA 2ZODA 3S06A 4ZI7A 5EB0A 5JH7B 5EO3A 5KMGA 3LWOC 5GIOC 4BT6A 5MN4A 3CMAF 3D01A 3CC4F 5BMVA 4HNAB 3FD5A 3HAXD 3K12A 4ZOLA 4EB6A 5LYJB 3J81M 3VYTC 3C9UA 4PWTA 3OW2F 3ZO8A 3K14A 1VQ7F 2VAMA 1H48A 2Z1TA 1VQLF 3LDTA 3V4DA 4I50B 4BW0B 5EB1B 3CC2F 4BT4A 5LXTB 3CB2A 3G71F 1J7HA 3WGJA 2VAWA 1YJWF 4O2AB 4R40B 4TV8A 4X1IA 3IR9A 3LWVC 3WXMB 3MBMA 3IEWA 1SDSA 4FFBB 5FJ4C 4C8GA 4C81A 2CSLA 3S0WA 5IJ0A 3JAWB 2CVLA 3PAFA 1TVKA 2VGNA 3WJQA 1X25A 3L7QA 4O4HB 3C9TA 5MN5A 3CPWF 2VGMA 3KE1A 1VQOF 5GONB 5AVMA 4X20B 3NVKE 4I4TA 2YXZA 2BO1A 5EYPA 3WGNA 5LP6B 1U43A 3F0DA 3HKDB 1H47A 4BVSA 2UYNB 4X1KA 1XRGA 3LMEA 3CMEF 4DRXA 4I50A 4TV9B 1VQMF 3J80M 2RHLA 1SZQA 1Q82H 1X7OA 4ZHWA 4RHAA 2UZHA 4B62A 4C8IA 4WBNA 4LNUA 2FC3A 4IIJB 2ZVZA 2NMUA 3V3TA 3OONA 5J2UA 2HVYD 3I55F 2KTUA 3VOAA 3CPQA 1XHOA 3N4YA 1COMA 1RQ2A 3RYFB 3F6MA 1W5BA 5HP8A 3GTZA 1U3LA 2L26A 5EZYB 3LWQC 2Z01A 5LA6A 3CG6A 3NVIB 3SIUA 1Z5VA 1W57A 3M1XA 3BYQA 3RE3A 3D00A 1M1KH 3RYHB 3HKEA 4X1YB 3UT5A 3WGKA 2RHOA 2GZLA 4F6RB 1KD1H 2MQEA 3S0YA 5HXUA 4G4WA 3D54A 3N2GB 1VQNF 3P10A 3HKBB 3DDNA 3ZP7A 4C82A 4G88A 2LBTA 3CCQF 1XBIA 2JNBA 3JASB 3CCVF 3HKDA 2I6DA 4X20A 5GONA 1Q86H 3LWPC 2I6RA 5A2QM 4EI8A 4O4HA 5KX5A 3CC7F 2CHTA 5EWRA 5LOVB 2GLZA 3JALA 2H8CA 1CK2A 3WPWA 2CW4A 3DC2A 4O2AA 3MDOA 5LXTA 4EI9A 5JCOA 4BT5A 5CA0A 3TD5A 3RYCB 5HY4A 1DT9A 1GO0A 1NMUB 1QD9A 2HRUA 4O4LA 1W59A 3VOBA 1Q7YH 1IPAA 1JFFA 2UYPA 1Z5WA 5EIBD 4O4JB 3RYFA 1IV3A 1JFFB 2UYJA 4ZK7A 1W42A 1RLUA 3V7QA 3CCUF 1IV1A 3JAKB 1ONIA 2PHNA 4BT2A 2OZBA 3FBAA 3RA6A 4I55B 2PMPA 2KTVA 4TUYB 1FFXB 2V9YA 4FFBA 3I3FA 1FFXA 3VCZA 1KNKA 4F6RA 1KQSF 2HP3A 4G4ZA 4ZHQA 1YJNF 2RHHA 5IJ9B 5CA0B 2DYYA 2G9IA 5KX5B 4KWEA 5BMVB 3LWRC 1QAHA 1FNKA 3TD3A 3JARB 3CYPB 2YYEA 3F0EA 4NQ3A 3CCMF 3VI6A 4ZOLB 2IQQA 3R0PA 4EB6B 5HWEA 4O4JA 1XV2A 3E22A 3S03A 1U40A 5EAZA 3OBYA 2H6LA 4O2BB 1W2BF 1YHQF 5CA1A 5GANK 4BT7A 4EI7A 2UYKA 3E20B 3CCLF 3RYIA 1NQ3A 4WBNB 1VQ9F 5J2TA 1ODEA 2RHJA 2HS0A 2R751 3HKBA 4RQOA 4B46A 1GX1A 3WGLA 3KIZA 4O4IB 3WPXA 3ZOPA 1W40A 5JQGA 4ERHA 4X1KB 2UYNA 1JD1A 1VQKF 3Q8HA 3U0OA 3OBWA 5FNVB 3S0HA 1QVFF 1IV4A 2BTUA 2QA4F 1KNJA 3KJJA 1W581 1QVGF 4O4LB 2BTQB 3N2GA 3AGKA 1YQNA 4U3JB 2HX0A 2ZOVA 5GINC 2K1SA 1K8AH 2Q1XA 3RYIB 5CB4A 5IJ9A 1IV2A 2LBWA 1VK3A 3RA5A 2H8EA 4I4TB 5LP6A 5GAPK 2OHWA 3WGMA 5IYZB 5GIPC 1FNJA 2IG8A 3VO8A 3JALB 4TV9A 4DRXB 1VQPF 2QEXF 3WJRA 3VIUA 1JN1A 5B8FA 5J2UB 3FPIA 3CYQA 5C8YB 2OTMA 3GYQA 3PLAC 2F9ZC 4ZHYB 1TUBB 1VQ6F 5MN6A 1JY8A 4YJ2B 2CHSA 4ZHQB 2N48A 1R1MA 4U3JA 3ZP4A 3G6EF 4O4IA 4BT3A 2AIZP 2LBXA 1VH8A 2FGYA 5JCOC 2Z1UA 3P4EA 2KGWA 3P0ZA 2HQSC 1X7PA 5HXZA 2LCAA 3CD6F 4IHJB 5LYJA 4BVQA 3IKEA 5LOVA 5CB4B 2QI2A 3RYHA 4BVTA 4G4YA 5FNVA 3JAKA 3VMFB 1PXWA 2IAFA 1RA4A 5EYPB 1S72F 1Q81H 4BY9D 1W5AA 3IMPA 3CCJF 2CWJA 3NK6A 4NUTA 2HP0A 5HY0A 4M8IA 1GO1A 2Q1YA 1VQ4F 3C9SA 1NJIH 3IEQA 4X3MA 5FLXM 5EIBC 5IJ0B 1QU9A 1T0AA 2CZWA 3KJKA 2VAPA 2RB9A 2R6R1
chains in the Genus database with same CATH topology
2HQSC 4RHAA 2LCAA 3S0HA 3TD4A 3S0WA 4B5CA 4B62A 4G4ZA 2W8BC 4G4XA 4ZHVA 4G4VA 2MQEA 4G4YA 3S0YA 2ZVZA 4PWTA 3OONA 1OAPA 3WPWA 3TD3A 3KHNA 4G4WA 3CYPB 3CYQA 3IMPA 2ZF8A 3WPXA 3LDTA 2ZOVA 4G88A 2LBTA 2K1SA 2ZVYA 3S02A 5EB1B 3S03A 2L26A 3TD5A 4ERHA 2N48A 5EAZA 3S06A 1R1MA 5EB0A 4R40B 2AIZP 4ZHYB 4ZHWA 2KGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQS C;  4RHA A;  2LCA A;  3S0H A;  3TD4 A;  3S0W A;  4B5C A;  4B62 A;  4G4Z A;  2W8B C;  4G4X A;  4ZHV A;  4G4V A;  2MQE A;  4G4Y A;  3S0Y A;  2ZVZ A;  4PWT A;  3OON A;  1OAP A;  3WPW A;  3TD3 A;  3KHN A;  4G4W A;  3CYP B;  3CYQ A;  3IMP A;  2ZF8 A;  3WPX A;  3LDT A;  2ZOV A;  4G88 A;  2LBT A;  2K1S A;  2ZVY A;  3S02 A;  5EB1 B;  3S03 A;  2L26 A;  3TD5 A;  4ERH A;  2N48 A;  5EAZ A;  3S06 A;  1R1M A;  5EB0 A;  4R40 B;  2AIZ P;  4ZHY B;  4ZHW A;  2KGW A; 
#chains in the Genus database with same CATH topology
 1YIJ F;  5G4U C;  5KMG B;  2ZAU A;  4IIJ A;  3TD4 A;  4TZZ A;  3LFO A;  3VYU C;  5J2T B;  5IT9 M;  2BTO A;  4LNU B;  2W8B C;  4G4X A;  1M90 H;  1W41 A;  4U39 A;  2DT4 A;  1H7M A;  3ERN A;  3VYS C;  1Q8R A;  3HKC A;  1SA0 A;  4B45 A;  3SIV A;  1FSZ A;  5LA6 B;  1KC8 H;  5EZY A;  1W3E X;  1K73 H;  2EWC A;  3E22 B;  3IKF A;  2HP0 B;  4BVR A;  5ITZ A;  2ALE A;  3ELC A;  3HKE B;  1UI9 A;  3CCS F;  3LYB A;  5JVD A;  5DCV A;  3K2X A;  3GHZ A;  1RLG A;  1VHA A;  1PF5 A;  1YJ9 F;  3JAS A;  4C8E A;  1VQ5 F;  4YJ3 A;  3J7A R;  3N4Z A;  1T0K B;  3QTY A;  5IYZ A;  3F0F A;  3KHN A;  1SA0 B;  3HKC B;  3NMU C;  2HS3 A;  1YIT F;  4XCQ A;  3HTN A;  1GZ0 A;  3JCM M;  3S02 A;  2ZVY A;  4LCK A;  3JAT B;  3N2K A;  5HP7 A;  2WAL A;  3V7E A;  3C8L A;  4IHJ A;  1N8R H;  4B5C A;  4O2B A;  3G4S F;  3HJW C;  2GVI A;  3WJP A;  1VQV A;  4YJ2 A;  4I55 A;  4ZHV A;  4G4V A;  1CN7 A;  3JAW A;  1TUB A;  1VQ8 F;  3EOR A;  2Z1E A;  1OAP A;  3HWU A;  1DBF A;  2AMT A;  2VXY A;  3JAR A;  3M4S A;  4TV8 B;  4X1I B;  3RYC A;  1K9M H;  4E6E A;  2KG4 A;  5LP6 C;  1CLI A;  3JAT A;  5G4V C;  1YGY A;  3B6N A;  1TVK B;  3FFM A;  3I56 F;  2HRY A;  1ZWZ A;  2P6Y A;  4DXD A;  3FD6 A;  1JJ2 F;  3QUW A;  3M84 A;  3MCQ A;  3VTI C;  4C4W C;  3K0T A;  3F0G A;  5HY1 A;  2AIF A;  5CA1 B;  5HY2 A;  1E7K A;  3MQW A;  1YI2 F;  5C8Y A;  2ZF8 A;  4ZI7 B;  5JH7 A;  2OTL F;  3ON1 A;  1W5E A;  4YJ3 B;  3NK7 A;  2B33 A;  1W55 A;  1W5F A;  3I7T A;  1UFY A;  4HNA A;  3T80 A;  1U3P A;  2OTJ F;  3CCR F;  3E1Y A;  1X52 A;  3O85 A;  5ITZ B;  5JQG B;  3C9R A;  3CXC F;  3CCE F;  2Z1F A;  3N2K B;  4X1Y A;  3JVH A;  3QHD A;  2QTP A;  3ESJ A;  4NWO B;  3JAM M;  3MCA B;  4TUY A;  2HS4 A;  1RQ7 A;  4X3L A;  3UT5 B;  5JVD B;  1OFU A;  2ZOD A;  3S06 A;  4ZI7 A;  5EB0 A;  5JH7 B;  5EO3 A;  5KMG A;  3LWO C;  5GIO C;  4BT6 A;  5MN4 A;  3CMA F;  3D01 A;  3CC4 F;  5BMV A;  4HNA B;  3FD5 A;  3HAX D;  3K12 A;  4ZOL A;  4EB6 A;  5LYJ B;  3J81 M;  3VYT C;  3C9U A;  4PWT A;  3OW2 F;  3ZO8 A;  3K14 A;  1VQ7 F;  2VAM A;  1H48 A;  2Z1T A;  1VQL F;  3LDT A;  3V4D A;  4I50 B;  4BW0 B;  5EB1 B;  3CC2 F;  4BT4 A;  5LXT B;  3CB2 A;  3G71 F;  1J7H A;  3WGJ A;  2VAW A;  1YJW F;  4O2A B;  4R40 B;  4TV8 A;  4X1I A;  3IR9 A;  3LWV C;  3WXM B;  3MBM A;  3IEW A;  1SDS A;  4FFB B;  5FJ4 C;  4C8G A;  4C81 A;  2CSL A;  3S0W A;  5IJ0 A;  3JAW B;  2CVL A;  3PAF A;  1TVK A;  2VGN A;  3WJQ A;  1X25 A;  3L7Q A;  4O4H B;  3C9T A;  5MN5 A;  3CPW F;  2VGM A;  3KE1 A;  1VQO F;  5GON B;  5AVM A;  4X20 B;  3NVK E;  4I4T A;  2YXZ A;  2BO1 A;  5EYP A;  3WGN A;  5LP6 B;  1U43 A;  3F0D A;  3HKD B;  1H47 A;  4BVS A;  2UYN B;  4X1K A;  1XRG A;  3LME A;  3CME F;  4DRX A;  4I50 A;  4TV9 B;  1VQM F;  3J80 M;  2RHL A;  1SZQ A;  1Q82 H;  1X7O A;  4ZHW A;  4RHA A;  2UZH A;  4B62 A;  4C8I A;  4WBN A;  4LNU A;  2FC3 A;  4IIJ B;  2ZVZ A;  2NMU A;  3V3T A;  3OON A;  5J2U A;  2HVY D;  3I55 F;  2KTU A;  3VOA A;  3CPQ A;  1XHO A;  3N4Y A;  1COM A;  1RQ2 A;  3RYF B;  3F6M A;  1W5B A;  5HP8 A;  3GTZ A;  1U3L A;  2L26 A;  5EZY B;  3LWQ C;  2Z01 A;  5LA6 A;  3CG6 A;  3NVI B;  3SIU A;  1Z5V A;  1W57 A;  3M1X A;  3BYQ A;  3RE3 A;  3D00 A;  1M1K H;  3RYH B;  3HKE A;  4X1Y B;  3UT5 A;  3WGK A;  2RHO A;  2GZL A;  4F6R B;  1KD1 H;  2MQE A;  3S0Y A;  5HXU A;  4G4W A;  3D54 A;  3N2G B;  1VQN F;  3P10 A;  3HKB B;  3DDN A;  3ZP7 A;  4C82 A;  4G88 A;  2LBT A;  3CCQ F;  1XBI A;  2JNB A;  3JAS B;  3CCV F;  3HKD A;  2I6D A;  4X20 A;  5GON A;  1Q86 H;  3LWP C;  2I6R A;  5A2Q M;  4EI8 A;  4O4H A;  5KX5 A;  3CC7 F;  2CHT A;  5EWR A;  5LOV B;  2GLZ A;  3JAL A;  2H8C A;  1CK2 A;  3WPW A;  2CW4 A;  3DC2 A;  4O2A A;  3MDO A;  5LXT A;  4EI9 A;  5JCO A;  4BT5 A;  5CA0 A;  3TD5 A;  3RYC B;  5HY4 A;  1DT9 A;  1GO0 A;  1NMU B;  1QD9 A;  2HRU A;  4O4L A;  1W59 A;  3VOB A;  1Q7Y H;  1IPA A;  1JFF A;  2UYP A;  1Z5W A;  5EIB D;  4O4J B;  3RYF A;  1IV3 A;  1JFF B;  2UYJ A;  4ZK7 A;  1W42 A;  1RLU A;  3V7Q A;  3CCU F;  1IV1 A;  3JAK B;  1ONI A;  2PHN A;  4BT2 A;  2OZB A;  3FBA A;  3RA6 A;  4I55 B;  2PMP A;  2KTV A;  4TUY B;  1FFX B;  2V9Y A;  4FFB A;  3I3F A;  1FFX A;  3VCZ A;  1KNK A;  4F6R A;  1KQS F;  2HP3 A;  4G4Z A;  4ZHQ A;  1YJN F;  2RHH A;  5IJ9 B;  5CA0 B;  2DYY A;  2G9I A;  5KX5 B;  4KWE A;  5BMV B;  3LWR C;  1QAH A;  1FNK A;  3TD3 A;  3JAR B;  3CYP B;  2YYE A;  3F0E A;  4NQ3 A;  3CCM F;  3VI6 A;  4ZOL B;  2IQQ A;  3R0P A;  4EB6 B;  5HWE A;  4O4J A;  1XV2 A;  3E22 A;  3S03 A;  1U40 A;  5EAZ A;  3OBY A;  2H6L A;  4O2B B;  1W2B F;  1YHQ F;  5CA1 A;  5GAN K;  4BT7 A;  4EI7 A;  2UYK A;  3E20 B;  3CCL F;  3RYI A;  1NQ3 A;  4WBN B;  1VQ9 F;  5J2T A;  1ODE A;  2RHJ A;  2HS0 A;  2R75 1;  3HKB A;  4RQO A;  4B46 A;  1GX1 A;  3WGL A;  3KIZ A;  4O4I B;  3WPX A;  3ZOP A;  1W40 A;  5JQG A;  4ERH A;  4X1K B;  2UYN A;  1JD1 A;  1VQK F;  3Q8H A;  3U0O A;  3OBW A;  5FNV B;  3S0H A;  1QVF F;  1IV4 A;  2BTU A;  2QA4 F;  1KNJ A;  3KJJ A;  1W58 1;  1QVG F;  4O4L B;  2BTQ B;  3N2G A;  3AGK A;  1YQN A;  4U3J B;  2HX0 A;  2ZOV A;  5GIN C;  2K1S A;  1K8A H;  2Q1X A;  3RYI B;  5CB4 A;  5IJ9 A;  1IV2 A;  2LBW A;  1VK3 A;  3RA5 A;  2H8E A;  4I4T B;  5LP6 A;  5GAP K;  2OHW A;  3WGM A;  5IYZ B;  5GIP C;  1FNJ A;  2IG8 A;  3VO8 A;  3JAL B;  4TV9 A;  4DRX B;  1VQP F;  2QEX F;  3WJR A;  3VIU A;  1JN1 A;  5B8F A;  5J2U B;  3FPI A;  3CYQ A;  5C8Y B;  2OTM A;  3GYQ A;  3PLA C;  2F9Z C;  4ZHY B;  1TUB B;  1VQ6 F;  5MN6 A;  1JY8 A;  4YJ2 B;  2CHS A;  4ZHQ B;  2N48 A;  1R1M A;  4U3J A;  3ZP4 A;  3G6E F;  4O4I A;  4BT3 A;  2AIZ P;  2LBX A;  1VH8 A;  2FGY A;  5JCO C;  2Z1U A;  3P4E A;  2KGW A;  3P0Z A;  2HQS C;  1X7P A;  5HXZ A;  2LCA A;  3CD6 F;  4IHJ B;  5LYJ A;  4BVQ A;  3IKE A;  5LOV A;  5CB4 B;  2QI2 A;  3RYH A;  4BVT A;  4G4Y A;  5FNV A;  3JAK A;  3VMF B;  1PXW A;  2IAF A;  1RA4 A;  5EYP B;  1S72 F;  1Q81 H;  4BY9 D;  1W5A A;  3IMP A;  3CCJ F;  2CWJ A;  3NK6 A;  4NUT A;  2HP0 A;  5HY0 A;  4M8I A;  1GO1 A;  2Q1Y A;  1VQ4 F;  3C9S A;  1NJI H;  3IEQ A;  4X3M A;  5FLX M;  5EIB C;  5IJ0 B;  1QU9 A;  1T0A A;  2CZW A;  3KJK A;  2VAP A;  2RB9 A;  2R6R 1; 
#chains in the Genus database with same CATH homology
 2HQS C;  4RHA A;  2LCA A;  3S0H A;  3TD4 A;  3S0W A;  4B5C A;  4B62 A;  4G4Z A;  2W8B C;  4G4X A;  4ZHV A;  4G4V A;  2MQE A;  4G4Y A;  3S0Y A;  2ZVZ A;  4PWT A;  3OON A;  1OAP A;  3WPW A;  3TD3 A;  3KHN A;  4G4W A;  3CYP B;  3CYQ A;  3IMP A;  2ZF8 A;  3WPX A;  3LDT A;  2ZOV A;  4G88 A;  2LBT A;  2K1S A;  2ZVY A;  3S02 A;  5EB1 B;  3S03 A;  2L26 A;  3TD5 A;  4ERH A;  2N48 A;  5EAZ A;  3S06 A;  1R1M A;  5EB0 A;  4R40 B;  2AIZ P;  4ZHY B;  4ZHW A;  2KGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...