2AIZP

Solution structure of peptidoglycan associated lipoprotein from haemophilus influenza bound to udp-n-acetylmuramoyl-l-alanyl-d-glutamyl-meso-2,6-diaminopimeloyl-d-alanyl-d-alanine
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
134
Chain Sequence
b'CSSSNNDAAGNGAAQTFGGYSVADLQQRYNTVYFGFDKYDITGEYVQILDAHAAYLNATPAAKVLVEGNTDERGTPEYNIALGQRRADAVKGYLAGKGVDAGKLGTVSYGEEKPAVLGHDEAAYSKNRRAVLAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein P6
molecule tags Membrane protein
source organism Haemophilus influenzae
publication title Peptidoglycan recognition by pal, an outer membrane lipoprotein.
pubmed doi rcsb
total genus 32
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2005-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2aizP01
4G4VA 4RHAA 3TD5A 3S02A 2L26A 2AIZP 3CYQA 3TD3A 5EAZA 2LBTA 3S0WA 4R40B 4ZHWA 2ZVYA 4G88A 4ERHA 2ZVZA 3LDTA 2K1SA 3CYPB 2KGWA 3IMPA 4G4YA 4B5CA 4G4XA 4G4ZA 3S03A 3S06A 2ZOVA 2MQEA 4PWTA 5EB0A 1OAPA 2LCAA 3KHNA 3S0HA 2HQSC 3TD4A 3S0YA 2W8BC 2ZF8A 1R1MA 3WPWA 2N48A 4ZHVA 4ZHYB 4G4WA 3WPXA 5EB1B 3OONA 4B62A
chains in the Genus database with same CATH superfamily
4G4VA 4RHAA 5JCOC 2IQQA 2AMTA 2HRUA 4YJ3B 2HX0A 1UI9A 3LFOA 3N2KB 3C9RA 4NUTA 3T80A 1GX1A 2LCAA 3JAKB 1YIJF 1YQNA 2YXZA 3D54A 1GZ0A 1DBFA 4X1YA 3AGKA 3QTYA 3RYCA 4G4WA 2R6R1 1Q82H 3D01A 4U3JA 3GYQA 1W57A 3HKDA 3S02A 2CZWA 4LNUB 1SA0B 1COMA 2GLZA 3ZO8A 3JAWB 2B33A 5MN5A 4X1YB 2UYPA 3VI6A 1ODEA 4X1IA 3LDTA 4O4LB 3CYPB 1U43A 1VQNF 3JVHA 1VH8A 4I4TB 4PWTA 4O4HB 3ERNA 1Z5WA 2RHHA 3I7TA 2DT4A 1RQ2A 3VTIC 3S0YA 4BT5A 2QA4F 1K8AH 3RYHA 3CCVF 1IV1A 1VQ7F 3M84A 5JVDB 4BVTA 3RA5A 1T0AA 1TUBA 5CA0B 3HTNA 4IIJB 3JASB 3E22A 5LA6A 5JH7A 1DT9A 4ZHWA 4DRXB 2BTQB 3CB2A 2IAFA 2ZVYA 2CVLA 5IJ9A 4G4YA 3F0FA 3JALB 2ZOVA 4I55A 1VQVA 2Z1EA 2UYKA 3KHNA 5EWRA 1VQOF 3LYBA 3M1XA 3IEQA 3MCAB 2LBXA 1FNJA 3RYCB 5HWEA 4ZHVA 1RLUA 2GZLA 5IJ0B 3C8LA 5GONA 5EZYB 1W55A 3JAKA 1GO1A 4RQOA 1PXWA 3NMUC 5EYPB 4WBNA 3N2KA 2L26A 2AIZP 2RHLA 2VGMA 3EORA 5B8FA 4BVQA 1JD1A 4B45A 1Q86H 1QVFF 1QD9A 3E20B 3CCRF 3ZP7A 3I55F 4G4XA 2YYEA 1W581 3JALA 4BVRA 3KIZA 4C82A 1X25A 1YITF 3FBAA 2UYNB 2KTVA 4TV9B 5KX5A 1W3EX 4B62A 3JASA 5LA6B 1QVGF 4I50A 2CSLA 3FD5A 3CYQA 1YHQF 4E6EA 5LYJA 4HNAB 1FFXB 1VQ6F 3P10A 4X1IB 3FD6A 5MN6A 4X1KB 2NMUA 4G88A 3JAWA 2K1SA 3HKEB 2H6LA 1RLGA 2HP0B 1KD1H 2V9YA 2W8BC 2Z1FA 4EI7A 5LXTA 3D00A 1TVKA 2I6RA 2H8EA 1KNJA 3LWPC 1H47A 2VAPA 1CLIA 3IR9A 4BT4A 1XBIA 1XRGA 3I3FA 3F0DA 3RYIA 1JN1A 2BTUA 3F0GA 3V7EA 5FNVB 3NK7A 3P0ZA 4F6RA 2HVYD 5J2UA 4M8IA 3J7AR 3K0TA 1IPAA 2HS3A 5EO3A 4HNAA 3K12A 1Z5VA 2BTOA 3HJWC 5GANK 2DYYA 4DXDA 1M1KH 4YJ3A 5GAPK 1XV2A 3UT5B 3CCEF 1Q7YH 1N8RH 5LP6A 3N2GB 5CB4B 1SDSA 3WXMB 3UT5A 1VK3A 3MDOA 3WGMA 4X20B 4C8EA 1JJ2F 4TV8A 5BMVB 5HY1A 1IV2A 3RYFA 2ZVZA 2OHWA 3VYSC 4X3MA 1K9MH 1H48A 4G4ZA 5FJ4C 3KJJA 2Q1YA 1RQ7A 5CA1B 3CCJF 2HQSC 4F6RB 3VOBA 3NVKE 3JATB 3K2XA 3CC4F 3SIUA 1GO0A 2N48A 3HKBB 3RYIB 4ZHYB 3VO8A 5IJ0A 1YGYA 4YJ2B 3LWOC 1X52A 3TD5A 1IV3A 2CWJA 4O4JB 5LXTB 2AIFA 3NK6A 5J2TB 4C8GA 2Z1TA 3FFMA 3HKCB 2R751 4TUYB 4DRXA 2GVIA 1SZQA 2PHNA 1W41A 3JARB 5HXZA 1KNKA 5JH7B 5EB0A 4ZI7B 3CXCF 4O4IA 4EB6A 1T0KB 4ZHQB 1TUBB 5CA0A 3S0HA 3CPQA 3FPIA 3VMFB 2ZODA 5JVDA 3CMEF 5C8YB 3WPXA 3WJQA 2UYJA 3WGJA 4BW0B 3CPWF 1U3PA 4ZHQA 1X7OA 3IKFA 2BO1A 3U0OA 5KMGB 5C8YA 4IHJA 2F9ZC 4FFBB 3ZP4A 3C9UA 1X7PA 4O4JA 1CK2A 5A2QM 1NJIH 4B5CA 3VCZA 5HXUA 2KTUA 2RHOA 3N4ZA 1VHAA 1KC8H 1U40A 1JY8A 2EWCA 2Z01A 3WGLA 3ELCA 3HKBA 2CW4A 1R1MA 3WPWA 2OTLF 1FSZA 1ZWZA 4YJ2A 5HY4A 5LOVA 3IKEA 4NQ3A 5IYZB 1VQKF 2VGNA 3V7QA 5HP7A 4BVSA 3S0WA 4EI8A 4TV8B 3F0EA 5BMVA 1JFFA 2RB9A 2VXYA 2Z1UA 5G4VC 3B6NA 1W42A 5IJ9B 3RYFB 4C81A 2MQEA 3E1YA 2OTMA 4KWEA 5LP6C 3OBYA 5FLXM 2HS0A 1VQ8F 4FFBA 3N2GA 5CB4A 3CCSF 1KQSF 3P4EA 3QHDA 1H7MA 1J7HA 3QUWA 4ZOLB 3NVIB 4C8IA 3M4SA 5G4UC 4O4LA 3I56F 3WJPA 3Q8HA 3TD4A 5FNVA 3RA6A 3CC7F 2OTJF 4LNUA 1W5AA 5J2TA 4U3JB 2FC3A 3OONA 3WGNA 2QEXF 1VQ5F 3HKEA 1M90H 1TVKB 4NWOB 3TD3A 4X1KA 2Q1XA 2QI2A 3N4YA 2LBWA 1FFXA 2HP0A 5MN4A 5LYJB 4BY9D 3V3TA 3JCMM 4EI9A 3JATA 4ERHA 1W59A 3O85A 3C9TA 3DC2A 3J81M 2CHSA 3DDNA 3WJRA 3CCQF 3S03A 3KE1A 3S06A 2HP3A 1PF5A 1YI2F 3CMAF 5EIBD 3G6EF 4TZZA 4TV9A 5KX5B 5GIPC 3MBMA 5GIOC 4TUYA 5EAZA 4C4WC 2LBTA 5ITZB 2FGYA 1QU9A 3VOAA 3MQWA 3F6MA 3KJKA 1JFFB 2KGWA 3IMPA 4WBNB 2HS4A 1VQLF 2H8CA 1FNKA 3HAXD 5GONB 4O2BB 5IYZA 3PLAC 3R0PA 5J2UB 1W40A 1YJNF 3V4DA 5EYPA 3ON1A 3K14A 1ONIA 1Q81H 4I55B 1VQMF 5LOVB 3CCMF 1CN7A 3J80M 1VQ9F 3C9SA 3HWUA 4O2AA 5JQGB 3G4SF 3SIVA 2QTPA 4IIJA 3ZOPA 4ZK7A 2PMPA 1YJ9F 1W5EA 3RE3A 2WALA 5ITZA 3GTZA 3LWRC 2OZBA 1OAPA 3G71F 5LP6B 5KMGA 2KG4A 3CCLF 3RYHB 1XHOA 2VAWA 2ZF8A 3E22B 3BYQA 4BT6A 5EB1B 2RHJA 1K73H 2JNBA 3OW2F 4O4HA 4IHJB 1YJWF 3IEWA 1W2BF 3CC2F 1QAHA 1RA4A 3L7QA 5HP8A 4ZI7A 4R40B 4X3LA 4BT2A 4I4TA 3HKCA 1E7KA 1U3LA 2ZAUA 5IT9M 4O4IB 4EB6B 3JARA 1VQPF 1NQ3A 3PAFA 4O2AB 5JQGA 3WGKA 2G9IA 1NMUB 3MCQA 1SA0A 3ESJA 5DCVA 1W5FA 3LWVC 2HRYA 3HKDB 1S72F 3CCUF 2IG8A 5GINC 1VQ4F 4BT7A 2UZHA 5EZYA 4O2BA 3LMEA 5JCOA 5HY0A 1W5BA 4ZOLA 4U39A 1IV4A 2ALEA 3OBWA 4I50B 5CA1A 5EIBC 1OFUA 3CG6A 2VAMA 2P6YA 3GHZA 4BT3A 4XCQA 5AVMA 2I6DA 3LWQC 3VIUA 2UYNA 3VYTC 4B46A 3VYUC 3JAMM 1UFYA 5HY2A 4LCKA 4X20A 1Q8RA 3CD6F 2CHTA
chains in the Genus database with same CATH topology
4G4VA 4RHAA 3TD5A 3S02A 2L26A 2AIZP 3CYQA 3TD3A 5EAZA 2LBTA 3S0WA 4R40B 4ZHWA 2ZVYA 4G88A 4ERHA 2ZVZA 3LDTA 2K1SA 3CYPB 2KGWA 3IMPA 4G4YA 4B5CA 4G4XA 4G4ZA 3S03A 3S06A 2ZOVA 2MQEA 4PWTA 5EB0A 1OAPA 2LCAA 3KHNA 3S0HA 2HQSC 3TD4A 3S0YA 2W8BC 2ZF8A 1R1MA 3WPWA 2N48A 4ZHVA 4ZHYB 4G4WA 3WPXA 5EB1B 3OONA 4B62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G4V A;  4RHA A;  3TD5 A;  3S02 A;  2L26 A;  2AIZ P;  3CYQ A;  3TD3 A;  5EAZ A;  2LBT A;  3S0W A;  4R40 B;  4ZHW A;  2ZVY A;  4G88 A;  4ERH A;  2ZVZ A;  3LDT A;  2K1S A;  3CYP B;  2KGW A;  3IMP A;  4G4Y A;  4B5C A;  4G4X A;  4G4Z A;  3S03 A;  3S06 A;  2ZOV A;  2MQE A;  4PWT A;  5EB0 A;  1OAP A;  2LCA A;  3KHN A;  3S0H A;  2HQS C;  3TD4 A;  3S0Y A;  2W8B C;  2ZF8 A;  1R1M A;  3WPW A;  2N48 A;  4ZHV A;  4ZHY B;  4G4W A;  3WPX A;  5EB1 B;  3OON A;  4B62 A; 
#chains in the Genus database with same CATH topology
 4G4V A;  4RHA A;  5JCO C;  2IQQ A;  2AMT A;  2HRU A;  4YJ3 B;  2HX0 A;  1UI9 A;  3LFO A;  3N2K B;  3C9R A;  4NUT A;  3T80 A;  1GX1 A;  2LCA A;  3JAK B;  1YIJ F;  1YQN A;  2YXZ A;  3D54 A;  1GZ0 A;  1DBF A;  4X1Y A;  3AGK A;  3QTY A;  3RYC A;  4G4W A;  2R6R 1;  1Q82 H;  3D01 A;  4U3J A;  3GYQ A;  1W57 A;  3HKD A;  3S02 A;  2CZW A;  4LNU B;  1SA0 B;  1COM A;  2GLZ A;  3ZO8 A;  3JAW B;  2B33 A;  5MN5 A;  4X1Y B;  2UYP A;  3VI6 A;  1ODE A;  4X1I A;  3LDT A;  4O4L B;  3CYP B;  1U43 A;  1VQN F;  3JVH A;  1VH8 A;  4I4T B;  4PWT A;  4O4H B;  3ERN A;  1Z5W A;  2RHH A;  3I7T A;  2DT4 A;  1RQ2 A;  3VTI C;  3S0Y A;  4BT5 A;  2QA4 F;  1K8A H;  3RYH A;  3CCV F;  1IV1 A;  1VQ7 F;  3M84 A;  5JVD B;  4BVT A;  3RA5 A;  1T0A A;  1TUB A;  5CA0 B;  3HTN A;  4IIJ B;  3JAS B;  3E22 A;  5LA6 A;  5JH7 A;  1DT9 A;  4ZHW A;  4DRX B;  2BTQ B;  3CB2 A;  2IAF A;  2ZVY A;  2CVL A;  5IJ9 A;  4G4Y A;  3F0F A;  3JAL B;  2ZOV A;  4I55 A;  1VQV A;  2Z1E A;  2UYK A;  3KHN A;  5EWR A;  1VQO F;  3LYB A;  3M1X A;  3IEQ A;  3MCA B;  2LBX A;  1FNJ A;  3RYC B;  5HWE A;  4ZHV A;  1RLU A;  2GZL A;  5IJ0 B;  3C8L A;  5GON A;  5EZY B;  1W55 A;  3JAK A;  1GO1 A;  4RQO A;  1PXW A;  3NMU C;  5EYP B;  4WBN A;  3N2K A;  2L26 A;  2AIZ P;  2RHL A;  2VGM A;  3EOR A;  5B8F A;  4BVQ A;  1JD1 A;  4B45 A;  1Q86 H;  1QVF F;  1QD9 A;  3E20 B;  3CCR F;  3ZP7 A;  3I55 F;  4G4X A;  2YYE A;  1W58 1;  3JAL A;  4BVR A;  3KIZ A;  4C82 A;  1X25 A;  1YIT F;  3FBA A;  2UYN B;  2KTV A;  4TV9 B;  5KX5 A;  1W3E X;  4B62 A;  3JAS A;  5LA6 B;  1QVG F;  4I50 A;  2CSL A;  3FD5 A;  3CYQ A;  1YHQ F;  4E6E A;  5LYJ A;  4HNA B;  1FFX B;  1VQ6 F;  3P10 A;  4X1I B;  3FD6 A;  5MN6 A;  4X1K B;  2NMU A;  4G88 A;  3JAW A;  2K1S A;  3HKE B;  2H6L A;  1RLG A;  2HP0 B;  1KD1 H;  2V9Y A;  2W8B C;  2Z1F A;  4EI7 A;  5LXT A;  3D00 A;  1TVK A;  2I6R A;  2H8E A;  1KNJ A;  3LWP C;  1H47 A;  2VAP A;  1CLI A;  3IR9 A;  4BT4 A;  1XBI A;  1XRG A;  3I3F A;  3F0D A;  3RYI A;  1JN1 A;  2BTU A;  3F0G A;  3V7E A;  5FNV B;  3NK7 A;  3P0Z A;  4F6R A;  2HVY D;  5J2U A;  4M8I A;  3J7A R;  3K0T A;  1IPA A;  2HS3 A;  5EO3 A;  4HNA A;  3K12 A;  1Z5V A;  2BTO A;  3HJW C;  5GAN K;  2DYY A;  4DXD A;  1M1K H;  4YJ3 A;  5GAP K;  1XV2 A;  3UT5 B;  3CCE F;  1Q7Y H;  1N8R H;  5LP6 A;  3N2G B;  5CB4 B;  1SDS A;  3WXM B;  3UT5 A;  1VK3 A;  3MDO A;  3WGM A;  4X20 B;  4C8E A;  1JJ2 F;  4TV8 A;  5BMV B;  5HY1 A;  1IV2 A;  3RYF A;  2ZVZ A;  2OHW A;  3VYS C;  4X3M A;  1K9M H;  1H48 A;  4G4Z A;  5FJ4 C;  3KJJ A;  2Q1Y A;  1RQ7 A;  5CA1 B;  3CCJ F;  2HQS C;  4F6R B;  3VOB A;  3NVK E;  3JAT B;  3K2X A;  3CC4 F;  3SIU A;  1GO0 A;  2N48 A;  3HKB B;  3RYI B;  4ZHY B;  3VO8 A;  5IJ0 A;  1YGY A;  4YJ2 B;  3LWO C;  1X52 A;  3TD5 A;  1IV3 A;  2CWJ A;  4O4J B;  5LXT B;  2AIF A;  3NK6 A;  5J2T B;  4C8G A;  2Z1T A;  3FFM A;  3HKC B;  2R75 1;  4TUY B;  4DRX A;  2GVI A;  1SZQ A;  2PHN A;  1W41 A;  3JAR B;  5HXZ A;  1KNK A;  5JH7 B;  5EB0 A;  4ZI7 B;  3CXC F;  4O4I A;  4EB6 A;  1T0K B;  4ZHQ B;  1TUB B;  5CA0 A;  3S0H A;  3CPQ A;  3FPI A;  3VMF B;  2ZOD A;  5JVD A;  3CME F;  5C8Y B;  3WPX A;  3WJQ A;  2UYJ A;  3WGJ A;  4BW0 B;  3CPW F;  1U3P A;  4ZHQ A;  1X7O A;  3IKF A;  2BO1 A;  3U0O A;  5KMG B;  5C8Y A;  4IHJ A;  2F9Z C;  4FFB B;  3ZP4 A;  3C9U A;  1X7P A;  4O4J A;  1CK2 A;  5A2Q M;  1NJI H;  4B5C A;  3VCZ A;  5HXU A;  2KTU A;  2RHO A;  3N4Z A;  1VHA A;  1KC8 H;  1U40 A;  1JY8 A;  2EWC A;  2Z01 A;  3WGL A;  3ELC A;  3HKB A;  2CW4 A;  1R1M A;  3WPW A;  2OTL F;  1FSZ A;  1ZWZ A;  4YJ2 A;  5HY4 A;  5LOV A;  3IKE A;  4NQ3 A;  5IYZ B;  1VQK F;  2VGN A;  3V7Q A;  5HP7 A;  4BVS A;  3S0W A;  4EI8 A;  4TV8 B;  3F0E A;  5BMV A;  1JFF A;  2RB9 A;  2VXY A;  2Z1U A;  5G4V C;  3B6N A;  1W42 A;  5IJ9 B;  3RYF B;  4C81 A;  2MQE A;  3E1Y A;  2OTM A;  4KWE A;  5LP6 C;  3OBY A;  5FLX M;  2HS0 A;  1VQ8 F;  4FFB A;  3N2G A;  5CB4 A;  3CCS F;  1KQS F;  3P4E A;  3QHD A;  1H7M A;  1J7H A;  3QUW A;  4ZOL B;  3NVI B;  4C8I A;  3M4S A;  5G4U C;  4O4L A;  3I56 F;  3WJP A;  3Q8H A;  3TD4 A;  5FNV A;  3RA6 A;  3CC7 F;  2OTJ F;  4LNU A;  1W5A A;  5J2T A;  4U3J B;  2FC3 A;  3OON A;  3WGN A;  2QEX F;  1VQ5 F;  3HKE A;  1M90 H;  1TVK B;  4NWO B;  3TD3 A;  4X1K A;  2Q1X A;  2QI2 A;  3N4Y A;  2LBW A;  1FFX A;  2HP0 A;  5MN4 A;  5LYJ B;  4BY9 D;  3V3T A;  3JCM M;  4EI9 A;  3JAT A;  4ERH A;  1W59 A;  3O85 A;  3C9T A;  3DC2 A;  3J81 M;  2CHS A;  3DDN A;  3WJR A;  3CCQ F;  3S03 A;  3KE1 A;  3S06 A;  2HP3 A;  1PF5 A;  1YI2 F;  3CMA F;  5EIB D;  3G6E F;  4TZZ A;  4TV9 A;  5KX5 B;  5GIP C;  3MBM A;  5GIO C;  4TUY A;  5EAZ A;  4C4W C;  2LBT A;  5ITZ B;  2FGY A;  1QU9 A;  3VOA A;  3MQW A;  3F6M A;  3KJK A;  1JFF B;  2KGW A;  3IMP A;  4WBN B;  2HS4 A;  1VQL F;  2H8C A;  1FNK A;  3HAX D;  5GON B;  4O2B B;  5IYZ A;  3PLA C;  3R0P A;  5J2U B;  1W40 A;  1YJN F;  3V4D A;  5EYP A;  3ON1 A;  3K14 A;  1ONI A;  1Q81 H;  4I55 B;  1VQM F;  5LOV B;  3CCM F;  1CN7 A;  3J80 M;  1VQ9 F;  3C9S A;  3HWU A;  4O2A A;  5JQG B;  3G4S F;  3SIV A;  2QTP A;  4IIJ A;  3ZOP A;  4ZK7 A;  2PMP A;  1YJ9 F;  1W5E A;  3RE3 A;  2WAL A;  5ITZ A;  3GTZ A;  3LWR C;  2OZB A;  1OAP A;  3G71 F;  5LP6 B;  5KMG A;  2KG4 A;  3CCL F;  3RYH B;  1XHO A;  2VAW A;  2ZF8 A;  3E22 B;  3BYQ A;  4BT6 A;  5EB1 B;  2RHJ A;  1K73 H;  2JNB A;  3OW2 F;  4O4H A;  4IHJ B;  1YJW F;  3IEW A;  1W2B F;  3CC2 F;  1QAH A;  1RA4 A;  3L7Q A;  5HP8 A;  4ZI7 A;  4R40 B;  4X3L A;  4BT2 A;  4I4T A;  3HKC A;  1E7K A;  1U3L A;  2ZAU A;  5IT9 M;  4O4I B;  4EB6 B;  3JAR A;  1VQP F;  1NQ3 A;  3PAF A;  4O2A B;  5JQG A;  3WGK A;  2G9I A;  1NMU B;  3MCQ A;  1SA0 A;  3ESJ A;  5DCV A;  1W5F A;  3LWV C;  2HRY A;  3HKD B;  1S72 F;  3CCU F;  2IG8 A;  5GIN C;  1VQ4 F;  4BT7 A;  2UZH A;  5EZY A;  4O2B A;  3LME A;  5JCO A;  5HY0 A;  1W5B A;  4ZOL A;  4U39 A;  1IV4 A;  2ALE A;  3OBW A;  4I50 B;  5CA1 A;  5EIB C;  1OFU A;  3CG6 A;  2VAM A;  2P6Y A;  3GHZ A;  4BT3 A;  4XCQ A;  5AVM A;  2I6D A;  3LWQ C;  3VIU A;  2UYN A;  3VYT C;  4B46 A;  3VYU C;  3JAM M;  1UFY A;  5HY2 A;  4LCK A;  4X20 A;  1Q8R A;  3CD6 F;  2CHT A; 
#chains in the Genus database with same CATH homology
 4G4V A;  4RHA A;  3TD5 A;  3S02 A;  2L26 A;  2AIZ P;  3CYQ A;  3TD3 A;  5EAZ A;  2LBT A;  3S0W A;  4R40 B;  4ZHW A;  2ZVY A;  4G88 A;  4ERH A;  2ZVZ A;  3LDT A;  2K1S A;  3CYP B;  2KGW A;  3IMP A;  4G4Y A;  4B5C A;  4G4X A;  4G4Z A;  3S03 A;  3S06 A;  2ZOV A;  2MQE A;  4PWT A;  5EB0 A;  1OAP A;  2LCA A;  3KHN A;  3S0H A;  2HQS C;  3TD4 A;  3S0Y A;  2W8B C;  2ZF8 A;  1R1M A;  3WPW A;  2N48 A;  4ZHV A;  4ZHY B;  4G4W A;  3WPX A;  5EB1 B;  3OON A;  4B62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...