2AIZP

Solution structure of peptidoglycan associated lipoprotein from haemophilus influenza bound to udp-n-acetylmuramoyl-l-alanyl-d-glutamyl-meso-2,6-diaminopimeloyl-d-alanyl-d-alanine
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
134
Chain Sequence
CSSSNNDAAGNGAAQTFGGYSVADLQQRYNTVYFGFDKYDITGEYVQILDAHAAYLNATPAAKVLVEGNTDERGTPEYNIALGQRRADAVKGYLAGKGVDAGKLGTVSYGEEKPAVLGHDEAAYSKNRRAVLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptidoglycan recognition by pal, an outer membrane lipoprotein.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Membrane protein
molecule keywords Outer membrane protein P6
total genus 32
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2005-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2aizP01
4ZHYB 2ZOVA 4G4WA 3S02A 3KHNA 3S06A 2ZVZA 3IMPA 3CYQA 4ZHVA 2K1SA 2N48A 4R40B 4G4VA 3WPXA 2L26A 2KGWA 3S03A 2LCAA 5EAZA 3S0HA 4PWTA 1R1MA 3TD5A 4B62A 3S0WA 5EB0A 4G4YA 2HQSC 3S0YA 4B5CA 3WPWA 3TD4A 4ZHWA 1OAPA 3LDTA 4RHAA 2ZVYA 2LBTA 4ERHA 3TD3A 4G88A 3OONA 4G4ZA 5EB1B 2MQEA 2W8BC 2ZF8A 2AIZP 4G4XA 3CYPB
chains in the Genus database with same CATH superfamily
4BT3A 3ZP7A 1IPAA 1Q82H 4I55A 4X1YA 2HRYA 3Q8HA 5LOVB 2CHTA 3WGNA 4YJ3A 2RHJA 3WJQA 4G4YA 4O4IB 3N4YA 2OZBA 3KJKA 5GIOC 3FPIA 3JVHA 1SZQA 5HY2A 5LXTA 3FBAA 3TD3A 1SDSA 1QD9A 2RHLA 1NMUB 2RHOA 2HP0A 2HS4A 3J80M 4O2AA 3MCQA 3B6NA 1YI2F 3HKCA 4ZI7B 5CB4A 5KMGA 3JAMM 2KGWA 4ZK7A 3S03A 3SIUA 5LA6A 3L7QA 1JFFB 1X7OA 1IV4A 4U3JB 3HKCB 2GVIA 1IV2A 1XBIA 3N2GA 1VK3A 3RYIB 3C9SA 3JARB 3JALB 1VQKF 2HRUA 4O4IA 2LBXA 2QI2A 2VAPA 2CWJA 4TUYB 3J7AR 3RYIA 1K9MH 3MDOA 1OFUA 3RYCA 4FFBA 1GZ0A 3KHNA 4I50B 1SA0B 1CLIA 2AMTA 2OHWA 3E20B 4X3MA 1VQ4F 5LOVA 5EYPB 3ON1A 2UYKA 5JQGA 4LNUB 3TD5A 4B46A 1KD1H 3LWPC 5EB0A 2PHNA 3HKDA 5IYZA 3CCVF 5GINC 3VTIC 4F6RA 3AGKA 4ZHQA 3CMAF 4BT6A 5JCOC 4KWEA 5IJ0A 3F6MA 3GHZA 3CYPB 5J2TA 3ERNA 2ZOVA 3S02A 4LCKA 2ZVZA 4WBNB 2HS0A 2N48A 1VQ8F 1Z5WA 5JH7A 5JVDB 3V4DA 3G71F 5GONB 5IJ9B 4PWTA 1JD1A 1YGYA 4C8IA 2VAMA 5J2UB 1UFYA 2KTVA 1M90H 1U43A 2PMPA 2UZHA 4X1IA 2IG8A 5CA0A 2HS3A 3MBMA 1JY8A 4C4WC 1U3PA 3IKFA 4I4TA 3PAFA 5A2QM 1KNJA 2Z1TA 2QEXF 3F0FA 1NQ3A 1GO0A 4BT7A 1Q7YH 4HNAB 3I56F 5ITZA 3I7TA 2VXYA 4M8IA 5MN6A 4EI8A 4R40B 4ZOLB 2LCAA 3JASA 5HY1A 3NK7A 5FLXM 2Z1UA 3CCJF 5ITZB 1XHOA 4XCQA 1Z5VA 1RLUA 5B8FA 2G9IA 2ALEA 2BO1A 2HP0B 4O2AB 3VYSC 3DC2A 2AIFA 3CCQF 3V7QA 5CA0B 3ELCA 2OTJF 3ZO8A 3E22B 2Q1XA 1TUBB 2CSLA 1RQ7A 4BT2A 1VQOF 3S06A 3RYHA 3NMUC 4G4VA 3CMEF 1RQ2A 1W3EX 2Z1FA 3GTZA 5EO3A 1YJ9F 4X1KA 3BYQA 5EZYB 3GYQA 3TD4A 1W581 1YIJF 2IQQA 3OBYA 2QA4F 1IV1A 3M84A 4C8EA 5JH7B 3VYUC 4EB6B 3I3FA 3WXMB 1ODEA 4X1KB 5FJ4C 1ONIA 4DRXB 5GAPK 4NWOB 4O4HA 1YJNF 5EAZA 1YJWF 4IHJA 4YJ2A 3N2KB 1J7HA 3JATA 4O4LA 4EI9A 4O4HB 3RYCB 4C82A 3K12A 3CC4F 2DT4A 4O4LB 3D54A 5MN5A 3KIZA 3RE3A 5EB1B 1VQ9F 2CW4A 2OTLF 3NK6A 3K2XA 3JAKA 3CCMF 3ZOPA 2HX0A 3KE1A 4FFBB 3HTNA 1X52A 3IEQA 4X3LA 3RYFB 5HY4A 5HWEA 3WJRA 1R1MA 5BMVB 3CCSF 2V9YA 5GANK 3RA6A 3UT5A 5HXZA 3MCAB 4RHAA 5DCVA 3CPWF 3IR9A 1TUBA 1QAHA 2FGYA 3V3TA 3J81M 3M4SA 4TV9B 5CA1A 3RYFA 1X7PA 2ZF8A 1FNJA 5EIBC 3CD6F 2BTOA 5KMGB 1IV3A 3F0GA 3CXCF 3G6EF 5J2UA 3P0ZA 1VHAA 2L26A 1XRGA 4IHJB 3P10A 5HP7A 5HP8A 3U0OA 3F0DA 3HKDB 4EI7A 2HQSC 5CA1B 3WPWA 3VYTC 2Z01A 1CK2A 1T0AA 1RLGA 2OTMA 4HNAA 1S72F 4U39A 1H7MA 1Q86H 1VQ6F 2CHSA 1VQNF 1KC8H 1U3LA 1QVFF 2W8BC 1H48A 5FNVA 3CC2F 4U3JA 3LFOA 3CB2A 3C9TA 1FSZA 2BTQB 3QUWA 3K14A 5LP6C 1W42A 1KQSF 2UYNB 5GONA 2H8EA 3VOAA 5IJ9A 1W2BF 4F6RB 3PLAC 3QTYA 5FNVB 2GLZA 1W40A 2B33A 2CVLA 4BVSA 2UYNA 2ZVYA 1H47A 4B45A 3OONA 1Q81H 3LMEA 2MQEA 3WPXA 3CCUF 4G4WA 3HAXD 2VGMA 3NVKE 3CYQA 4ZHQB 3C9RA 1YITF 3CCRF 3C9UA 1M1KH 1VQ7F 4C81A 2H6LA 2I6DA 3JASB 5J2TB 5LP6B 1Q8RA 3HJWC 1OAPA 3N2GB 3VMFB 1SA0A 1K73H 3D01A 4X20A 3JAWB 4G4ZA 2KTUA 2H8CA 1TVKB 1QVGF 3FD6A 4TUYA 3HKBB 4ZI7A 5CB4B 2RHHA 1X25A 3JAWA 4BT4A 3VOBA 3IEWA 1YHQF 1DT9A 1KNKA 2UYPA 1U40A 3HKEB 3RYHB 1K8AH 4TV9A 3UT5B 2P6YA 1FFXA 3S0HA 2BTUA 4BVRA 4X20B 3I55F 3LWRC 1VQVA 3WGLA 1E7KA 3O85A 3QHDA 2HP3A 3HKEA 3FD5A 5LP6A 4O2BA 1JN1A 2LBTA 5EWRA 3DDNA 2GZLA 4X1IB 1DBFA 3S0YA 2AIZP 4G4XA 3RA5A 1UI9A 3IMPA 5LA6B 5KX5B 2Z1EA 3T80A 3SIVA 1W41A 4O2BB 3JAKB 1W5BA 3ESJA 4NQ3A 4E6EA 5EYPA 2IAFA 4TZZA 3WGJA 2R751 5KX5A 4YJ2B 3MQWA 5JCOA 3VI6A 3KJJA 4BVQA 3OW2F 3OBWA 1VQ5F 5IT9M 5IYZB 4IIJB 2UYJA 4ERHA 2FC3A 3C8LA 4EB6A 3F0EA 2I6RA 4BT5A 1COMA 4DRXA 5IJ0B 4ZHYB 2HVYD 3FFMA 5LYJA 1VQPF 5JVDA 3JCMM 2R6R1 4TV8B 1W5FA 1FFXB 3V7EA 3CG6A 1YQNA 4B62A 3IKEA 3EORA 4I50A 3S0WA 3M1XA 3VCZA 1W5AA 3K0TA 3E22A 1W55A 3CPQA 2DYYA 3R0PA 3LWQC 4ZHWA 2YXZA 1TVKA 1W59A 5C8YA 3WGMA 1CN7A 1GO1A 1RA4A 5EZYA 5G4VC 1N8RH 5LXTB 3JALA 5HXUA 2NMUA 5JQGB 3D00A 2VAWA 3VIUA 3LWOC 1T0KB 3CC7F 1VH8A 3JARA 3VO8A 1NJIH 4O4JA 3WGKA 5G4UC 1VQLF 2JNBA 4ZOLA 4RQOA 2QTPA 1PF5A 1JFFA 4O4JB 5EIBD 4B5CA 5MN4A 4BY9D 1XV2A 3HKBA 2VGNA 4NUTA 4G88A 2EWCA 5BMVA 5HY0A 1VQMF 3LYBA 1GX1A 2YYEA 3P4EA 4I55B 4X1YB 5AVMA 4C8GA 5LYJB 3G4SF 4TV8A 3N2KA 1PXWA 2WALA 4ZHVA 3JATB 2K1SA 4YJ3B 4BW0B 1JJ2F 4I4TB 3NVIB 1W57A 3CCEF 3WJPA 2ZODA 5GIPC 4IIJA 2CZWA 2ZAUA 2RB9A 4DXDA 1W5EA 3E1YA 3CCLF 1FNKA 4LNUA 1QU9A 2LBWA 2F9ZC 5C8YB 2KG4A 3LDTA 3N4ZA 4WBNA 3LWVC 3ZP4A 3HWUA 1ZWZA 4BVTA 2Q1YA
chains in the Genus database with same CATH topology
4ZHYB 2ZOVA 4G4WA 3S02A 3KHNA 3S06A 2ZVZA 3IMPA 3CYQA 4ZHVA 2K1SA 2N48A 4R40B 4G4VA 3WPXA 2L26A 2KGWA 3S03A 2LCAA 5EAZA 3S0HA 4PWTA 1R1MA 3TD5A 4B62A 3S0WA 5EB0A 4G4YA 2HQSC 3S0YA 4B5CA 3WPWA 3TD4A 4ZHWA 1OAPA 3LDTA 4RHAA 2ZVYA 2LBTA 4ERHA 3TD3A 4G88A 3OONA 4G4ZA 5EB1B 2MQEA 2W8BC 2ZF8A 2AIZP 4G4XA 3CYPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZHY B;  2ZOV A;  4G4W A;  3S02 A;  3KHN A;  3S06 A;  2ZVZ A;  3IMP A;  3CYQ A;  4ZHV A;  2K1S A;  2N48 A;  4R40 B;  4G4V A;  3WPX A;  2L26 A;  2KGW A;  3S03 A;  2LCA A;  5EAZ A;  3S0H A;  4PWT A;  1R1M A;  3TD5 A;  4B62 A;  3S0W A;  5EB0 A;  4G4Y A;  2HQS C;  3S0Y A;  4B5C A;  3WPW A;  3TD4 A;  4ZHW A;  1OAP A;  3LDT A;  4RHA A;  2ZVY A;  2LBT A;  4ERH A;  3TD3 A;  4G88 A;  3OON A;  4G4Z A;  5EB1 B;  2MQE A;  2W8B C;  2ZF8 A;  2AIZ P;  4G4X A;  3CYP B; 
#chains in the Genus database with same CATH topology
 4BT3 A;  3ZP7 A;  1IPA A;  1Q82 H;  4I55 A;  4X1Y A;  2HRY A;  3Q8H A;  5LOV B;  2CHT A;  3WGN A;  4YJ3 A;  2RHJ A;  3WJQ A;  4G4Y A;  4O4I B;  3N4Y A;  2OZB A;  3KJK A;  5GIO C;  3FPI A;  3JVH A;  1SZQ A;  5HY2 A;  5LXT A;  3FBA A;  3TD3 A;  1SDS A;  1QD9 A;  2RHL A;  1NMU B;  2RHO A;  2HP0 A;  2HS4 A;  3J80 M;  4O2A A;  3MCQ A;  3B6N A;  1YI2 F;  3HKC A;  4ZI7 B;  5CB4 A;  5KMG A;  3JAM M;  2KGW A;  4ZK7 A;  3S03 A;  3SIU A;  5LA6 A;  3L7Q A;  1JFF B;  1X7O A;  1IV4 A;  4U3J B;  3HKC B;  2GVI A;  1IV2 A;  1XBI A;  3N2G A;  1VK3 A;  3RYI B;  3C9S A;  3JAR B;  3JAL B;  1VQK F;  2HRU A;  4O4I A;  2LBX A;  2QI2 A;  2VAP A;  2CWJ A;  4TUY B;  3J7A R;  3RYI A;  1K9M H;  3MDO A;  1OFU A;  3RYC A;  4FFB A;  1GZ0 A;  3KHN A;  4I50 B;  1SA0 B;  1CLI A;  2AMT A;  2OHW A;  3E20 B;  4X3M A;  1VQ4 F;  5LOV A;  5EYP B;  3ON1 A;  2UYK A;  5JQG A;  4LNU B;  3TD5 A;  4B46 A;  1KD1 H;  3LWP C;  5EB0 A;  2PHN A;  3HKD A;  5IYZ A;  3CCV F;  5GIN C;  3VTI C;  4F6R A;  3AGK A;  4ZHQ A;  3CMA F;  4BT6 A;  5JCO C;  4KWE A;  5IJ0 A;  3F6M A;  3GHZ A;  3CYP B;  5J2T A;  3ERN A;  2ZOV A;  3S02 A;  4LCK A;  2ZVZ A;  4WBN B;  2HS0 A;  2N48 A;  1VQ8 F;  1Z5W A;  5JH7 A;  5JVD B;  3V4D A;  3G71 F;  5GON B;  5IJ9 B;  4PWT A;  1JD1 A;  1YGY A;  4C8I A;  2VAM A;  5J2U B;  1UFY A;  2KTV A;  1M90 H;  1U43 A;  2PMP A;  2UZH A;  4X1I A;  2IG8 A;  5CA0 A;  2HS3 A;  3MBM A;  1JY8 A;  4C4W C;  1U3P A;  3IKF A;  4I4T A;  3PAF A;  5A2Q M;  1KNJ A;  2Z1T A;  2QEX F;  3F0F A;  1NQ3 A;  1GO0 A;  4BT7 A;  1Q7Y H;  4HNA B;  3I56 F;  5ITZ A;  3I7T A;  2VXY A;  4M8I A;  5MN6 A;  4EI8 A;  4R40 B;  4ZOL B;  2LCA A;  3JAS A;  5HY1 A;  3NK7 A;  5FLX M;  2Z1U A;  3CCJ F;  5ITZ B;  1XHO A;  4XCQ A;  1Z5V A;  1RLU A;  5B8F A;  2G9I A;  2ALE A;  2BO1 A;  2HP0 B;  4O2A B;  3VYS C;  3DC2 A;  2AIF A;  3CCQ F;  3V7Q A;  5CA0 B;  3ELC A;  2OTJ F;  3ZO8 A;  3E22 B;  2Q1X A;  1TUB B;  2CSL A;  1RQ7 A;  4BT2 A;  1VQO F;  3S06 A;  3RYH A;  3NMU C;  4G4V A;  3CME F;  1RQ2 A;  1W3E X;  2Z1F A;  3GTZ A;  5EO3 A;  1YJ9 F;  4X1K A;  3BYQ A;  5EZY B;  3GYQ A;  3TD4 A;  1W58 1;  1YIJ F;  2IQQ A;  3OBY A;  2QA4 F;  1IV1 A;  3M84 A;  4C8E A;  5JH7 B;  3VYU C;  4EB6 B;  3I3F A;  3WXM B;  1ODE A;  4X1K B;  5FJ4 C;  1ONI A;  4DRX B;  5GAP K;  4NWO B;  4O4H A;  1YJN F;  5EAZ A;  1YJW F;  4IHJ A;  4YJ2 A;  3N2K B;  1J7H A;  3JAT A;  4O4L A;  4EI9 A;  4O4H B;  3RYC B;  4C82 A;  3K12 A;  3CC4 F;  2DT4 A;  4O4L B;  3D54 A;  5MN5 A;  3KIZ A;  3RE3 A;  5EB1 B;  1VQ9 F;  2CW4 A;  2OTL F;  3NK6 A;  3K2X A;  3JAK A;  3CCM F;  3ZOP A;  2HX0 A;  3KE1 A;  4FFB B;  3HTN A;  1X52 A;  3IEQ A;  4X3L A;  3RYF B;  5HY4 A;  5HWE A;  3WJR A;  1R1M A;  5BMV B;  3CCS F;  2V9Y A;  5GAN K;  3RA6 A;  3UT5 A;  5HXZ A;  3MCA B;  4RHA A;  5DCV A;  3CPW F;  3IR9 A;  1TUB A;  1QAH A;  2FGY A;  3V3T A;  3J81 M;  3M4S A;  4TV9 B;  5CA1 A;  3RYF A;  1X7P A;  2ZF8 A;  1FNJ A;  5EIB C;  3CD6 F;  2BTO A;  5KMG B;  1IV3 A;  3F0G A;  3CXC F;  3G6E F;  5J2U A;  3P0Z A;  1VHA A;  2L26 A;  1XRG A;  4IHJ B;  3P10 A;  5HP7 A;  5HP8 A;  3U0O A;  3F0D A;  3HKD B;  4EI7 A;  2HQS C;  5CA1 B;  3WPW A;  3VYT C;  2Z01 A;  1CK2 A;  1T0A A;  1RLG A;  2OTM A;  4HNA A;  1S72 F;  4U39 A;  1H7M A;  1Q86 H;  1VQ6 F;  2CHS A;  1VQN F;  1KC8 H;  1U3L A;  1QVF F;  2W8B C;  1H48 A;  5FNV A;  3CC2 F;  4U3J A;  3LFO A;  3CB2 A;  3C9T A;  1FSZ A;  2BTQ B;  3QUW A;  3K14 A;  5LP6 C;  1W42 A;  1KQS F;  2UYN B;  5GON A;  2H8E A;  3VOA A;  5IJ9 A;  1W2B F;  4F6R B;  3PLA C;  3QTY A;  5FNV B;  2GLZ A;  1W40 A;  2B33 A;  2CVL A;  4BVS A;  2UYN A;  2ZVY A;  1H47 A;  4B45 A;  3OON A;  1Q81 H;  3LME A;  2MQE A;  3WPX A;  3CCU F;  4G4W A;  3HAX D;  2VGM A;  3NVK E;  3CYQ A;  4ZHQ B;  3C9R A;  1YIT F;  3CCR F;  3C9U A;  1M1K H;  1VQ7 F;  4C81 A;  2H6L A;  2I6D A;  3JAS B;  5J2T B;  5LP6 B;  1Q8R A;  3HJW C;  1OAP A;  3N2G B;  3VMF B;  1SA0 A;  1K73 H;  3D01 A;  4X20 A;  3JAW B;  4G4Z A;  2KTU A;  2H8C A;  1TVK B;  1QVG F;  3FD6 A;  4TUY A;  3HKB B;  4ZI7 A;  5CB4 B;  2RHH A;  1X25 A;  3JAW A;  4BT4 A;  3VOB A;  3IEW A;  1YHQ F;  1DT9 A;  1KNK A;  2UYP A;  1U40 A;  3HKE B;  3RYH B;  1K8A H;  4TV9 A;  3UT5 B;  2P6Y A;  1FFX A;  3S0H A;  2BTU A;  4BVR A;  4X20 B;  3I55 F;  3LWR C;  1VQV A;  3WGL A;  1E7K A;  3O85 A;  3QHD A;  2HP3 A;  3HKE A;  3FD5 A;  5LP6 A;  4O2B A;  1JN1 A;  2LBT A;  5EWR A;  3DDN A;  2GZL A;  4X1I B;  1DBF A;  3S0Y A;  2AIZ P;  4G4X A;  3RA5 A;  1UI9 A;  3IMP A;  5LA6 B;  5KX5 B;  2Z1E A;  3T80 A;  3SIV A;  1W41 A;  4O2B B;  3JAK B;  1W5B A;  3ESJ A;  4NQ3 A;  4E6E A;  5EYP A;  2IAF A;  4TZZ A;  3WGJ A;  2R75 1;  5KX5 A;  4YJ2 B;  3MQW A;  5JCO A;  3VI6 A;  3KJJ A;  4BVQ A;  3OW2 F;  3OBW A;  1VQ5 F;  5IT9 M;  5IYZ B;  4IIJ B;  2UYJ A;  4ERH A;  2FC3 A;  3C8L A;  4EB6 A;  3F0E A;  2I6R A;  4BT5 A;  1COM A;  4DRX A;  5IJ0 B;  4ZHY B;  2HVY D;  3FFM A;  5LYJ A;  1VQP F;  5JVD A;  3JCM M;  2R6R 1;  4TV8 B;  1W5F A;  1FFX B;  3V7E A;  3CG6 A;  1YQN A;  4B62 A;  3IKE A;  3EOR A;  4I50 A;  3S0W A;  3M1X A;  3VCZ A;  1W5A A;  3K0T A;  3E22 A;  1W55 A;  3CPQ A;  2DYY A;  3R0P A;  3LWQ C;  4ZHW A;  2YXZ A;  1TVK A;  1W59 A;  5C8Y A;  3WGM A;  1CN7 A;  1GO1 A;  1RA4 A;  5EZY A;  5G4V C;  1N8R H;  5LXT B;  3JAL A;  5HXU A;  2NMU A;  5JQG B;  3D00 A;  2VAW A;  3VIU A;  3LWO C;  1T0K B;  3CC7 F;  1VH8 A;  3JAR A;  3VO8 A;  1NJI H;  4O4J A;  3WGK A;  5G4U C;  1VQL F;  2JNB A;  4ZOL A;  4RQO A;  2QTP A;  1PF5 A;  1JFF A;  4O4J B;  5EIB D;  4B5C A;  5MN4 A;  4BY9 D;  1XV2 A;  3HKB A;  2VGN A;  4NUT A;  4G88 A;  2EWC A;  5BMV A;  5HY0 A;  1VQM F;  3LYB A;  1GX1 A;  2YYE A;  3P4E A;  4I55 B;  4X1Y B;  5AVM A;  4C8G A;  5LYJ B;  3G4S F;  4TV8 A;  3N2K A;  1PXW A;  2WAL A;  4ZHV A;  3JAT B;  2K1S A;  4YJ3 B;  4BW0 B;  1JJ2 F;  4I4T B;  3NVI B;  1W57 A;  3CCE F;  3WJP A;  2ZOD A;  5GIP C;  4IIJ A;  2CZW A;  2ZAU A;  2RB9 A;  4DXD A;  1W5E A;  3E1Y A;  3CCL F;  1FNK A;  4LNU A;  1QU9 A;  2LBW A;  2F9Z C;  5C8Y B;  2KG4 A;  3LDT A;  3N4Z A;  4WBN A;  3LWV C;  3ZP4 A;  3HWU A;  1ZWZ A;  4BVT A;  2Q1Y A; 
#chains in the Genus database with same CATH homology
 4ZHY B;  2ZOV A;  4G4W A;  3S02 A;  3KHN A;  3S06 A;  2ZVZ A;  3IMP A;  3CYQ A;  4ZHV A;  2K1S A;  2N48 A;  4R40 B;  4G4V A;  3WPX A;  2L26 A;  2KGW A;  3S03 A;  2LCA A;  5EAZ A;  3S0H A;  4PWT A;  1R1M A;  3TD5 A;  4B62 A;  3S0W A;  5EB0 A;  4G4Y A;  2HQS C;  3S0Y A;  4B5C A;  3WPW A;  3TD4 A;  4ZHW A;  1OAP A;  3LDT A;  4RHA A;  2ZVY A;  2LBT A;  4ERH A;  3TD3 A;  4G88 A;  3OON A;  4G4Z A;  5EB1 B;  2MQE A;  2W8B C;  2ZF8 A;  2AIZ P;  4G4X A;  3CYP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...