2AJ0A

Solution structure of apocada
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
MAEKTVYRVDGLSCTNCAAKFERNVKEIEGVTEAIVNFGASKITVTGEASIQQVEQAGAFEHLKIIPEKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable cadmium-transporting ATPase
publication title Structural basis for metal binding specificity: the N-terminal cadmium binding domain of the P1-type ATPase CadA
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
total genus 15
structure length 71
sequence length 71
ec nomenclature ec 3.6.3.3: Cadmium-exporting ATPase.
pdb deposition date 2005-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2aj0A00
1SB6A 2RILA 2RMLA 4DL0C 1N5TA 2IYGA 2ROEA 2EW9A 2GGPA 3TRGA 2LDIA 1YRXA 2K1RA 3FGVA 1N5VA 1KVJA 2AW0A 3MCSA 4A46A 2VV5A 2L3MA 4A4JA 2XMVA 2OD4A 1TR0A 1AW0A 3QMQA 2KKHA 2HQIA 1X0PA 4F67A 2N7YA 4Q2LA 1CC8A 2JDJA 3F44A 2XMJA 1Y9OA 2RU9A 3E8OA 2HIQA 5A6WA 3UDCA 2OMOA 3HX9A 2HLTA 4A47A 4FNHA 2LQBA 3BB5A 1TUVA 5B08A 2K7JA 1YJVA 4DPOA 1P8GA 2LXFA 4OJ3A 2RSQA 2FTRA 3CJKB 2IFXA 2OAUA 3QGPA 4NPOA 2OP5A 1Q8BA 1QUPA 1TZ0A 2ASYA 3HF5A 3HHLD 2W4PA 4Y2KA 1AFIA 1URRA 2N4CA 1OPZA 3KKFA 4QOTA 1YG0A 1FVQA 2XMKA 1N5SA 2XMMA 5B0AA 3GZ7A 2AJ0A 1YJUA 2VH7A 3CJKA 5K9FA 1Q8LA 1X7VA 2XMWA 3BN7A 1V3ZA 4Y2IA 3VTIA 4Y2MA 1XBWA 1FE0A 5B0FA 3TOQA 5B09A 1VQSA 4ZA1A 1JWWA 1MWZA 1YJTA 1CPZA 3BF4A 3FRYA 2Q3PA 3KG0A 2PD1A 3TNVA 5KAKA 2GFFA 1FEEA 3IWXA 3LGMA 5B0EA 2OD6A 4HH1A 3LO3A 1WD6A 3BR8A 4DN9A 1TL5A 1TL4A 1FVSA 3KNGA 1JK9B 3BDEA 4HI1A 4YDXA 3HDSA 5B0BA 5F0WA 1S6UA 2GO8A 2GV1A 2K2PA 2KT3A 2W4CA 1Y3JA 1MWYA 1OQ3A 1Q53A 1CC7A 2AJ1A 2OFGX 2KYZA 4HH0A 3K7RA 2XMUA 3BGUA 1OSDA 2FIUA 1U7LA 2LQ9A 2HFOA 2KT2A 3LGNA 2IYIA 4FNIA 5A6PA 1IUJA 1YJRA 5B0DA 1OQ6A 2BJDA 2ROPA 2CRLA 2XMTA 1APSA 2GA7A 5IXUA 1FD8A 1P6TA 3I9ZA 2QLXA 1Y0HA 3HHLC 1SQEA 2ZDPA 4HL9A 4ZOSA 1AFJA 2BBEA 2N4DA 3HFKA 1Q4RA 1KQKA 1S6OA 4OIXA 1K0VA 1FE4A 2W4DA 2GCFA 3FMBA 2ZDOA 1GXUA 2AP6A 4HI2A 2BJEA 1R6YA 1ULRA 2FHMA 3KG1A 1LQ9A 3HHLB 2ACYA 2QYCA 3DCAA 2QLWA 1X8DA 1GXTA 2QIFA 5B0CA 1SI9A 2FB0A 1KVIA 5B0GA 2BYCA 3IWLA 4YEAA 2G9OA 4EFAC 2ROGA 5T7LB 3T9NA 3HHLA 4OJHA 1FESA 1Y3KA 3DXSX 2OKQA 3MZIA 4U9RA 4OJGA 2K7KA 2BUNA 2GGPB 2HLUA 3WDOA 1VQYA 3BM7A 4A48A 1N5QA 2PGCA 2K1RB 2OFHX 5F0UA 5T7LA 4OJ1A 1RJJA 4NL5A 2HFNA 1W2IA 4Q2MA
chains in the Genus database with same CATH superfamily
3ZO7A 4O3PA 2AV5A 5A8RB 4FF4A 5KG1A 1F1BB 2KDOA 4IDKB 1E6YA 5C42B 3KLGB 5HATA 2W9CA 2H48B 4ICLB 3AXKA 2MB0B 2G2YA 5KTQA 1U1LA 1X60A 1B0TA 5F8GA 4F3QA 2F65A 5KFBA 1GT8A 3FKBA 3CTRA 2MLXA 2V4JA 1HWUA 2OGUA 5HBMB 3UN2A 4PWDA 1HHQA 3QJPA 3HVTA 2FVQA 1SC6A 1XJWB 2ZBIA 4PXEA 5L1IA 1N0UA 4N41A 3AOAA 4JI2F 3T1YF 2CADA 4GKKF 3HO1A 2P5VA 1LW0A 3PXGa 5EWFA 1LW2B 3FMBA 1ZA1B 3HT3A 1T03B 4DFJA 2EKNA 1IVZA 4J9UE 3OUYB 5L8RC 2EWHA 2AYGA 4OI1A 2HAIA 3QSYB 2BOPA 4MYTA 4Y65A 3KJFB 4FXWA 4CI0B 4X4VA 4OX7A 3Q22A 3BBFA 3UNYA 2OPQA 2ZH8A 2MHNA 4WYLA 4IOAQ 3TJ8A 4DR3F 5DO2A 1RHKB 2L9WA 3H5SA 2NYHA 4WE1B 3J80Y 1XERA 1KNZA 1YK9A 3IGNA 3NGUA 4X62F 3SYZA 2GFFA 3R7BB 3U1LA 1T95A 1XEZA 4LRFA 1R0AB 3RG6A 3A8IA 3BGOP 3PV8A 4J37A 2GV1A 1C4AA 2UUBJ 2E9ZA 3NKYA 3RB4A 3AQPA 3D67A 5E33A 3SCIE 5I42A 3FSIA 5KG4A 4ILMA 2IY5B 1S59A 3OVBA 3FVYA 3VGSA 3OSPA 4ZITA 3PHTA 2LEAA 1WEYA 1FDDA 3T19A 2HQGA 2DNLA 2P2CB 3U1MA 3K0JA 4NMXA 2HWIA 4RPFA 3EX7B 2CZVC 2AJ2A 3H8YA 4MT1A 4USUA 4KGXB 2J9EA 3JSBA 2X3GA 2C3UA 2MQPA 3TEHB 2EXUA 5KFDA 1RWUA 3LP0B 3OHBA 2HHUA 1WC1A 2UU9J 1VMBA 4LRAA 1VQ9S 2PMZD 5IT9Y 1XR7A 1TV6B 4WWSA 1U1OA 3DLLQ 2K06A 4ZVPB 1V3ZA 4O23A 5D4OA 1LFWA 1UKUA 1DLOB 4KRWA 4U95A 5F0WA 1PILA 2GW8A 2MQMA 1OSDA 2WOMA 4ZPCA 5L1LA 1FCAA 2A2CA 2MJUA 2BANA 1M5HA 3A13A 5IXUA 1NJYA 2IRUA 5CAAA 4UQTA 3Q8RB 1FJEB 4I2QA 3KJVB 3EZOA 2X1GA 2Z2LA 4C9DA 2MY8A 1LK7A 1DHMA 1X4GA 1U2FA 3UVJA 4CTAA 3TVZA 3IRXA 2LVWA 1FRKA 1SJFA 3PW7A 2E5LJ 1F9FA 2DNZA 4HEA9 1HQ2A 3TR5A 4CLUA 2ASLA 3NNHA 2Y1LB 1TK8A 3V4IA 5KFQA 5KT3A 3NCPA 3M2UA 3GSIA 1ZAWA 2QV6A 2CVIA 3H59A 1HD0A 3Q89A 2ATCB 5DLFA 4P75A 1SL1A 3NWGA 1VQSA 3JTOA 1Q0NA 3P49B 3EXYA 2BE2A 2IVYA 2BDPA 4IH5A 3Q83A 1IWGA 1QSYA 3PRVA 4DX8H 1PO6A 8RUCA 5CD4H 1RT5B 2AT1B 4DMZA 2ZKTA 2C2OB 4B02A 2ALYB 3PX6A 3B4DA 1DAXA 2IRYA 1SIWB 3E3XA 2D3ZA 2MZJA 1B3TA 2DGWA 4G6VB 3H4BA 3NEKA 4M8LA 4QR1A 1T9WA 3I5CA 1ITPA 2O3DA 1KVIA 3DXBA 2WONB 4ED4A 4RW7B 1FFSB 3ENQA 1SKSA 4A8XA 1FXDA 4PUOA 4YS2A 2K1RB 3T1HF 3MAAB 3Q8SB 1Q79A 1NM2A 2MSSA 1UFKA 5HVHA 2WVEA 2F4VJ 5F3ZA 3L95X 1HI1A 3HI9A 1R8PA 3D6TB 4ZKAA 3G6ES 1MMNA 3PTWA 2CYYA 1ACMB 4ID8A 3L09A 2BRLA 2MGZB 2DO4A 5BXIA 2V4RA 3EVMA 4LF7F 5F9NA 5F8NA 4LUBA 3M7VA 4EBEA 2ZNYA 1KTVA 3OVAA 2XY5A 3D3BJ 4OI6A 1XNRJ 1ZPWX 1IKYB 4K5SA 2V9WA 1E6VA 2X1AA 4BC7A 4HI2A 3CJ3A 3GFYA 3KDNA 2VFSA 4CO5A 1U1NA 2R7RA 2AZ1A 1CQNA 1HNIB 3VV2B 3R5CA 2VASA 4NX9A 3Q8VA 1TKZA 2DNQA 2WW4A 1BQMA 3GJSB 1IM6A 1S77D 2N3LA 4X66J 1N52B 1BY9A 4DFPA 5J2NA 2L9NA 3QBCA 2QA1A 3SQGB 2E1MC 3TVKA 1FKAF 4C8LA 2CPHA 4Y6IA 1GX6A 4DG1A 1S4FA 3W1YC 4R5PA 2RKIA 1FRHA 2P6TA 1D9AA 2YXLA 1X5TA 3MECB 2DJWA 3TX8A 4OYZA 3H98A 2IIHA 3HHKA 1U09A 3TAMB 4MAKA 4TY9A 4FN5A 4X4UA 1CPZA 3LA0A 1SC1B 2OSRA 4KPYA 4I6YA 2RIJA 2R42A 3MD3A 2F9JA 1NSKL 2KZMA 4DS4A 1RT2B 2ILYA 3BKUA 3P8BB 3MR3A 4OZ5A 1YLXA 2R7SA 5IC6B 2BJEA 4OX9F 5AE2A 2RDIA 2X51A 4A8OA 3FBEA 1D1UA 3CVKA 1GXTA 3VAIA 4TU8A 1FX2A 4LFBF 2KI2A 1YJ9S 4FP9A 4DR4F 5J2PB 2VFRA 1F60B 3RRKA 4MKYA 2X1BA 1O0PA 1SJ4P 1HWJA 4LBPA 1SQGA 2XZWA 5L1KA 1VRTA 5HSPA 1QVGR 2CDRB 3A1YG 1N54B 3QLHB 4NMLA 3AY0A 3RTVA 1VQOS 2B9WA 3F56A 4OJ3A 4XDDA 4F50A 4AYBD 5ETSA 1SV5B 1ZBTA 2JHEA 4LREA 3HSZA 2F40A 2DYAA 5HMZA 2ADBA 4V19J 4LFAF 3FRYA 1FRXA 2HEKA 2I1RA 2QO3A 4DV7J 1U6FA 5H9EJ 4HI1A 1IKVB 1TL4A 4K4UA 3A8EA 4TKTA 5K8OA 2FVRA 4GVBA 1NKBA 3EGZA 5D6GA 3N79A 4Q8FA 1TP7A 2YH0A 4LF6F 1WHWA 2QLXA 2Y8YA 4ZOSA 2N82B 1LV5A 4DR5F 3IS9B 4R0EA 3GLJA 3BO2A 4EZ6A 5H9FJ 1S10A 3M9NB 4CO3A 4UW2A 3OSNA 4F26A 3OFGA 3TW0A 3ETOA 4NEYA 3M2RA 3LP1B 1YGYA 2DBBA 3PCOB 4HACB 1IBMJ 1TL3A 3K5NA 2HS0A 2COLA 1ROFA 3MUVP 1RHMB 2Q66A 4M5DB 3ONQA 4Q8EA 4UQGA 5K5MA 1FNXH 1FA0A 4FS1A 3PM9A 1MROA 1Q5YA 5GAEU 4PG8A 2BJ9A 1GFWB 4JV0A 2GMLA 2MKSA 1Q8KA 4DN9A 3RUBL 4NLXA 1FDAA 2EG1A 1FT8A 2QX0A 2WSCC 1EJ7L 4J9RA 2IYIA 4ATNA 2JH3A 4RUCA 4KHMA 3MHYA 2LXIA 1SC3B 1QAIA 2E7WA 2Z58B 3ZZYA 1VRUB 2OEJA 3KG1A 3T5KA 4JOUA 1RAJA 2JVOA 3BSAA 1Q7LB 2MZTA 3WDOA 5F0UA 1JXEA 4RBUA 5HMWA 1KS2A 1Q95G 1YRXA 3L3CA 1NDPA 2VV5A 3UE2A 3HZEA 4NZ6A 1BE4A 4AD6A 4U7CA 3FRZA 2CQIA 1VQ8S 4D3GA 2NYIA 2C3MA 5B08A 2Y0BB 1N34J 2NSBA 5C25B 3CCTA 2GC8A 3UWTA 4M95A 3F41A 2XMMA 1RTHA 3DOKB 1HW8A 1BQXA 1RBLA 3S01A 1SH3A 4NXMF 2VPZB 2KJWA 3P5TL 2B7BB 5IOLA 4DPXA 1KR4A 2XI3A 3BDEA 2DR9A 3HDSA 2H54B 2C2MB 4C7QA 5K8MA 4I56A 3GB0A 3R7SB 1WOSA 1XTZA 4FXDA 1WC0A 1Y0HA 1WC5A 1RWPB 3QYYA 1WEZA 1N32J 1IKXA 4YR3A 1J5OB 4YDDB 4ECTA 2IM2A 2OJ3A 3M8YA 3POTA 3ZZ0A 1YBAA 2U2FA 4H4KA 2Z57B 2BX6A 2YWFA 1EQ0A 1RAFB 3PYEA 5D3GA 1DY3A 4WZMA 3AJ1A 4M5GA 2C1EB 2ZD1A 2VG7A 3QMQA 3GQCA 2IBKA 3MAHA 4JYAF 1P8GA 2UUAJ 3JYTB 3KLEB 2ZJQQ 2WB1D 4WK3A 1MN7A 2VFUA 5EN1A 4X84A 1O51A 2BV3A 2LQ5A 4Q45A 3CW2C 3EE3A 2HURA 3MOJB 1WSRA 2L48A 2JC0A 4YDXA 2L41A 2CQBA 3DU5A 1C0TA 4CO2A 4ECUA 3GIMA 3UI3A 3UVJB 3THPA 5CYMA 3J81Y 1QY7A 1TL1A 2DGSA 4DCJB 4DV5F 1S9GB 3PEHA 1YIJS 4DZDA 3WIUA 3TUJC 1I1GA 4UZBA 2BYCA 2DEJA 4ZVGA 3M8ZA 4JI7F 2W24A 4ELUA 3W2VA 4MFBA 3V81A 3O6QA 1SJQA 2DPJA 2UUCF 3M8PA 4BCAA 4ED7A 3Q8UA 5KFHA 3CUNA 5C5JA 3QWPA 5HK4A 2EFPA 4YMEA 2D7SA 3L7PA 4RW8A 3C15A 3MD1A 2AKWB 1KD1T 5AT1B 2V34A 2W4PA 4GRSA 4QWCA 1FVQA 4M5MA 4OYPA 1UWBA 2Q3PA 4RUBA 2R8IA 3ITHA 1HW9A 2AQ4A 3J7YU 2EFGA 1S0MA 2YVSA 4JI6F 4GKJF 3FEZA 1HNWJ 5IZHA 2VFVA 1NK8A 4QU6A 4P2MA 5LXYA 2DHXA 1Y00A 2QEXS 3AFGA 4JI0F 1FI4A 3G9CA 2RRBA 4QIGA 5F8HA 3IN5A 4NWBA 5KFYA 5E5NA 4QWEA 3R5AA 5ETNA 3EZ5A 1FESA 3CC2S 5HP1B 2PI4A 4C3LA 2CNLB 2FJXA 4EUVA 3SV3A 3T9ZA 3OFFA 2FJBB 2KT5A 2VKZG 3NBPB 3RAMA 1Y5LB 1N5TA 3KFWX 1HMVA 2CXEA 3HCXA 2RF2B 3UR3C 3BR9A 3FDSA 1U48A 4E2FB 1JLBA 1T9VA 1V5VA 3L4BC 2E5HA 3MFHA 1WF0A 4RR5A 1LEOA 2GX8A 4IR9A 1RDRA 2OAUA 4UOCA 3ZTOA 2MSTA 3VF0B 3KK2A 2DTJA 4FYWB 2CPFA 4DS5A 1N33J 1OIAA 2W01A 5KFAA 1B7YB 2DR5A 2R7TA 3MUTP 2U1AA 3PYDA 2XSJB 5F41A 4AL5A 2BOAA 3AAWB 1REVB 4IRDA 3RYLA 1NEEA 1OQ3A 5D15A 1XMOJ 4HH0A 3RRGA 5LT5A 3MM6A 4MKAA 3K5OA 2VC1A 1T9XA 4QPXA 2YPZA 2KXFA 2CDQA 4P7TA 2G4BA 1Q4RA 1SC4B 4RZRA 3K2YA 1ZAVA 1Y5IB 1NK5A 4CIOA 3OV7A 1IXKA 3RU0A 5GMKa 2QRRA 3BREA 1N8RT 3QJLA 5D0RA 2PGCA 1R8AA 2UUTA 3M32B 4C8NA 4B3RJ 3T6BA 4F7VA 3F44A 2ABYA 1WI8A 4F4WA 1VJWA 2XYGB 1IBLJ 4IQXA 2JC1A 1VQPS 2JVRA 3CCRS 3HHNB 1CJUA 4ECYA 2P9CA 3HMJG 5CYQB 2VA3A 3CMAS 4ZCKA 2B7CB 3R5DA 2R7WA 4DLEA 2JEGA 1ZH5A 2H65B 1K73T 3DLKB 1M90T 2CQ2A 1WG1A 3HHLC 5EUHA 1H6KX 2CQCA 1R8BA 3TZXA 4IO9Q 4KV8A 4RW4B 3UN5A 4RJVA 3UD4P 1N6QA 1W7WA 1HWLA 5DLGA 2QE5A 3O8WA 4FDFA 4CM2A 1OJ4A 1N5QA 2ROEA 1R6VA 3D54A 2GJIA 5HMYA 5KFVA 2P9EA 4DUZJ 3I56S 4DR2J 2DXDA 2I5JA 4WFZA 3J7A1 4ZHRB 1BXNA 4B17A 3SDEB 4GMKA 4PQAA 3K59A 2W25A 4WJBA 1JJHA 2N4CA 5KFZA 3IBWA 2MZSA 2F4FA 4G1QA 1BC6A 4DI6A 3NRBA 3Q2SC 4W4MA 2B5JB 4P10A 2M0GB 2E44A 4JV2A 1PYTA 2QA4G 5CXTA 2DGOA 1DJ0A 1Q53A 2VDIA 4YB5A 2HVDA 2UVVA 1RTJA 4IOBA 2DHSA 2NXNA 1VGYA 1SQEA 2XYHB 1PAEX 5HL7Q 3UN3A 4CLPA 5E7OB 2FPHX 2NUHA 3N28A 4ZDNA 2FB0A 2XQCA 4FYVB 1LXNA 3DXSX 4EEYA 3MM5B 4PKDB 2ZOGA 4CLKA 4Y2MA 2RHSB 1RHJB 2DRAA 2YWWA 4IO1A 4FF1A 4ECVA 3W2WA 4J5OA 2HQIA 1C1CA 1UEKA 4F0KA 5FDLA 1YJVA 4ECQA 3CULA 2KHCA 4Q0BB 4X4OA 3OTEA 1DFDA 1OPZA 3R5GA 2WCXA 2KG0A 1S5ZA 3VAMA 1HHTP 3J7AN 1TKXB 3VQTA 2OPRA 2GVDA 2DEIA 1T02A 4OZ1A 3FZBA 4IYQA 5EDWA 1RP5A 2WVDA 1TL5A 2WBRA 2N3OA 3HSJA 1HL6A 3PACA 2AX0A 5DG7A 5F9LA 1QAXA 1VS3A 3QQCD 1SUQB 2ZDPA 1TK5A 4LFCF 1FF2A 4P2SA 3PYFA 1TELA 2ZJRQ 5T41A 2DISA 4XK8C 3QIPA 4OX8A 4QWAA 2V63A 1U02A 2ILZA 5E3QA 3PW0A 2KYXA 4NCAA 2UVWA 4OJGA 2FUG9 2X7IA 4N8NA 2MXYA 3KLIB 3GR1A 1OS5A 2VBZA 1RTIB 3VQSA 2YNIA 3S8SA 3P96A 3AH6A 2YNGA 1NSPA 4MIAA 3MCSA 3M1VA 1UL3A 1MNEA 2LFVA 3A12A 4UUWA 3N6LA 2HAFA 2R8KA 4BS2A 4B3MJ 3GIRA 2B8PA 4KIAA 2UXDF 4G1IA 2D9PA 4CO0A 4WTYA 1F9EB 3MEDA 4DU8A 2RQMA 1MWZA 4PQUA 2MEWA 2W9BB 1F5AA 4PWWA 4IUFA 5J2QB 2DGVA 2BKNA 2FIUA 1AA1B 3OTOJ 1KN6A 4WXWA 4JI5F 5GAGU 4K50A 1IQZA 4CLWA 3ET6A 1RGVA 3FZ2A 1N48A 2C22A 1U2RA 1LWFA 2HPUA 2HGMA 4H4MB 2C3YA 4F04B 2QLWA 3EGVA 3OL9A 1CEZA 3MMBA 4DQRA 4DR6J 3IG1B 1RTDB 4BDPA 2LDIA 4P7VA 4DL2A 3M4XA 3MMAA 4DF8A 4X4TA 5D4PA 2HK3A 1TUVA 1F3VA 5GVQA 1W2BR 1WOPA 2F8HA 2HYIB 3Q24A 5G0RA 3G6XA 3JB9k 4ANEA 3MOZA 5A2QU 1R31A 5E0OA 4GC6A 5J2MB 1B70B 4ED8A 3GPAA 1XIQA 1L3KA 2ZZTA 3HFZB 5SZTA 3G96A 5KG0A 4QWDA 5HO4A 2ZM6J 2AZ3A 4TU7A 3TO8A 1FJGF 2BJ3A 5A8KA 2B6AB 1CSJA 3DFEA 2GHWA 5T7LB 4TY8B 3ZFVA 2YKNA 1KLMB 4Q2MA 2ZFHA 1V3SA 2HS4A 3DYAB 2N7YA 1NK4A 4D3HA 1HLWA 2EC2A 2KFNA 2WB4A 4HDHA 2ZH9A 3DRPA 3HHLD 4EYHB 3HXMA 2M5YA 4N5SA 1CJTB 1RT6A 4KSEB 1T9UA 3BGFA 4EWTA 3MM7B 2H51B 4L75A 1RT3A 3AA9A 1G4CA 3RAQA 1QVFR 3JXOA 4IG0A 3SSRA 4C8OA 1OQ6A 2XWYA 2NSCA 3IGVA 2J0SD 3B82A 2ZH5A 4FF2A 1S6PB 2PE8A 2Z0GA 3MPWA 3V5RA 1FKPB 5AXKA 2QC3A 5D8HB 1RAGB 2K7KA 1XMQJ 1QAJA 3BM7A 2CJYB 2LCWA 2HFNA 2QN6B 1SB6A 1SIZA 3EGWB 4OQJA 2ZH1A 2GGPA 3PJ9A 3FQLA 4KFBB 1KVJA 2ZNZA 1HNXF 3KJQB 2HBRB 1C2PA 4OV1A 3GR0A 3C6UA 3QFHA 4USJC 5HQ8A 4HTIA 4NRTA 1FERA 3M6VA 1UAWA 1F3FA 4KHPJ 3G82B 3DNCA 4JI4J 1FJCA 3U02A 1N5YB 3TX0A 2ASDA 3C16A 3Q8QB 1SJ1A 4LR8A 5J1EA 1DQAA 3K7RA 2ZHAA 3WHIA 4Z7YA 2JLGA 2E5GA 4JV5J 1WDDA 4KH1B 4YUDA 1P6TA 4OYWA 2MJNA 3QT5A 2QJ3A 2LQ8A 5IT0A 2VJVA 2WHOA 3W5YA 3HHLB 4I7FA 2PFFB 1Z4UA 2QIFA 1F5CA 1U6ZA 2WBMA 4RNHA 4ZVEA 3E2EA 3S1TA 3I82A 4KO0A 2H9ZA 3PW4A 3DI6B 3NGKA 3ZTSA 3UD5A 1QJHA 1GTEA 2D3UA 4CLSA 3W9JA 4DUYJ 2DXEA 2JDJA 2RJZA 4WP3A 5A0YB 2RE1A 4N8OA 2FC8A 2ZE2B 1WJ9A 4FBUA 3GYXB 2Y1JA 2DKOB 1YJWS 3PY8A 2XMKA 2MZ1A 3M8QA 4AQYJ 1S1XA 5HROA 3FFIA 2A2DA 3V2UC 5HVFA 2ZUGA 2QG9B 3BGRA 3B8HA 3D66A 1MSWD 4LF4F 4ITSA 5ETKA 2C2KB 4MK8A 4CLLA 2AJFE 3A3PB 1MU2B 3NLCA 4LSLA 1JKHA 3HULA 1DBDA 4RWXA 2DNNA 1RXOB 4ZN1A 3K8VA 4UUXA 5LMUF 2FY8A 3W66A 3ZZPA 4Z37A 3BGLA 3D2WA 3RAXA 3L9ZA 4OZLA 3CCUS 4ES2A 3IXQA 2J0XA 1Q82T 1Q8IA 4YQWA 4LIWA 2RHQB 3D0HE 1YJNS 2J7KA 2UXBJ 3CJ8A 2GJ2A 5CCLA 1X5OA 2B4VA 2VKRA 3G8TA 4IFVB 1NNDA 4ZP8A 1JXVA 4IRCA 1GMWD 3W8PA 5EWGA 2BJ1A 3D1OA 5A8RA 2VQEJ 2YX1A 4IDKA 5C42A 3KLGA 3HK2A 2BW2A 4C0HA 1JXLA 3H42A 1DTTB 4ICLA 4UY8T 1HYSB 1ZM4A 1OYEA 1PSDA 3QO9B 1S72S 1H0HB 1S1TB 3RBZA 3RBDA 3RZAA 4K2JA 5HJYA 2OHDA 2XG8A 4ZVTB 2ZZMA 2N7CA 1NSAA 3KXDA 4JI8J 4O4GB 5HBMA 1HBMB 2E1CA 3CSKA 2O01C 3T1AA 2QL7B 1OY9A 3W65A 2FLLA 1MG7A 1SI9A 1YVFA 1LW2A 3H40A 3DRSB 4DV4F 3TQEA 4FPRA 1T03A 3W60A 2NZCA 2CJBA 4Y28C 5KFLA 4J9KA 3D7SB 4DL6A 1JLEB 3OUYA 1HNZJ 4FKXA 3VVTA 3UDEA 2FZGB 3SV4A 3QT8A 1S0VA 2EBEA 1BQNB 2GZOA 1GTHA 5D0HA 4OI2A 3SFUA 4WYWA 2KFYA 1H2UX 3MGJA 5I3PA 2YNHB 5MAOA 3NCQA 2ZH6A 1FRIA 4I68A 1GAOA 2KRBA 2XMWA 3UW1A 3CJQA 4LF5F 2HBZB 4ZPDA 4WE1A 2WSEC 2PD1A 1WHYA 3RBXA 4M5NA 2CQHA 4FS2A 3NP5A 2PEBA 1RAOA 5AXNA 3GFHA 3SCJE 3GYNA 1R0AA 2B51A 2HW3A 1ZZNA 1R0CB 1UZHA 3CF5Q 3D9BA 2QMUB 3DDKA 2IA6A 3CJTA 4ECRA 2RS8A 4NI2B 2QLBB 2J7UA 1TKDA 3T9NA 1RT1B 2HHPA 1X4BA 4MJKA 1WWHA 4HYKA 1SXLA 4YB7A 3PYGA 2RDDA 1JJ4A 1Z2ZA 2PDAA 2DNKA 1J5EJ 3G86A 3UDLA 6FDRA 4L6V3 3LP0A 1IR0A 3EZUA 4NPOA 3QGPA 5HLFB 5DJBA 1N36J 4USWA 1TV6A 3VTIA 3EGNA 2CQDA 2UXCJ 4F4XA 5BJRA 3W5ZA 2FQQB 1HARA 2FHOB 1T05B 1DLOA 5JJBA 4LRBA 4Y3CA 1T3OA 2ZBQA 3PNIA 4UOHA 4LF8F 1RAHB 3FCVA 4XO0A 3MM9B 3TI0A 5C2GA 3MR5A 4DQQA 3DLGB 3N4WA 1FXLA 4IFYB 2VIHA 2GVZB 3KJVA 1UPPA 2WZ1A 3N01A 1S4EA 2FVCA 2EFQA 4ZP6A 1GH8A 3MZIA 2DNYA 3NS7B 2WW8A 4CLTA 2J9CA 4OJ1A 2OLWA 4DZ6A 1WSVA 3KWMA 1V5IB 2LA4A 2VPYB 2BXJA 4TXSA 1S9EB 3WX8A 3CDWA 3C3LA 2XYPB 1QE1B 4ZVRB 4F36A 2J6TA 4P2XA 3TARA 3JSMB 2QSWA 3CJRA 2A18A 3DRRB 3LO3A 3LPEA 2HNYB 3W63A 1AT1B 2E7VA 2M52A 1X5PA 1RT4B 4K0KF 2VHGA 1JIHA 3CDUA 3QGIA 1U7LA 1REGX 4DQPA 5KFUA 1KOHA 2CPDA 1RYSA 1IBKF 1RT5A 2BBEA 2CA9A 1UVKA 3BPDA 5BYRA 4LT6A 1ZETA 1H2VZ 2QYCA 5GAHU 1I51B 1I94F 4KKOB 1ICEB 2RQKA 4DDFA 4HKQA 3V6DB 5LMNJ 1VOMA 2BUNA 2FHKA 2VONA 2WONA 2OFHX 3HPOA 1JNZB 3VAKA 4RW7A 1K9MT 3W3SA 2HQFA 3BO3A 2HHHF 2XS2A 4I6AA 3LTOA 2K1RA 2VA2A 3MAAA 5HAOA 4BWMA 1VQKS 3PJXA 4J7CA 3UQSA 2H4WB 3KHRA 1U1KA 3OR2B 1IR1A 3EPIA 2EVZA 5KOXA 4DV6F 1NK6A 4L3NA 3C8YA 2OP5A 1Q8BA 2Y9HA 1VC6A 1S1VB 1X9WA 4DFMA 2QA4S 2V6AA 3QAUA 2RT3A 4ZP7A 5KFIA 3CMQA 4F4YA 3QNWB 2MGZA 1FDNA 3VHQA 1NPPA 1JB0C 4NA3A 5F8MA 2RD5C 2DGQA 1H74A 1M5KC 3QRRA 2VODA 1DURA 3R2CJ 4P71A 2APOA 3K17A 1IR2A 1CULB 1YJ7A 4NXNJ 5AE3A 3NNCA 1IKYA 2P8IA 2CNNB 1RBAA 2CPJA 2I38A 3S6EA 4DPTA 5RUBA 1WF2A 2V8DA 2FJDB 4YY3F 5H9EK 1EHWA 2KXNB 1TUWA 1OSCA 1HNIA 3JQJA 1RWWB 2YKMB 3GYGA 1Q78A 4NCBA 5K8NA 4DPWA 3FEXB 3G8SA 4NCGB 2Y1RI 2VBXA 4TQRA 2OD4A 1PCAA 1L5UA 2V4QA 3CIZA 3SQGA 2JZ5A 2J6UA 3NWRA 4RNMA 2BJ7A 2O67A 1BHNA 3UDVA 4PG5A 3MECA 3MR7A 1K1QA 1Z2LA 4OZ3A 3GV5B 8AT1B 5GADU 1U1PA 3TAMA 2XWXA 1NAQA 2LU2A 3DLBA 3R97A 1CBKA 2V5HG 4UT4A 4DR1F 4UOGA 2BM0A 1RT2A 1D9DA 2V68A 4F2RA 1RISA 2EK6A 4EO6A 2OEKA 1R8HA 2HQCA 2A0FB 5ETQA 4DPUA 4K7QA 1X4AA 2XEXA 3M6UA 2F9DA 3TZYA 5HROB 4MIWA 4W90B 1WKLA 2R7QA 5J2PA 4UY85 1AW0A 4NLTA 4C0BA 1SBRA 2ALZA 3M8SA 4CNZA 3QRQA 1LWCB 2RU9A 1RWVB 3TVYA 2IC3B 3NY0A 1U8SA 4CCHA 4WF9Q 3QLHA 4Y2KA 4HHHA 2MY7A 2HWTA 2EBGA 2ATLA 1SV5A 4P6QA 5EX0A 1RKJA 2I9SA 4GO7X 2XTJP 2GO9A 4CYUB 2VOOA 2J5AA 2ZBPA 4PEOA 3MUMP 1IKVA 4TN2A 2VG6B 4YHHJ 2ZH3A 1FK9B 2IHR1 3EWGA 3CWJA 2DGUA 2M8DB 2W8LA 2GA7A 1JJCB 2O66A 2LDYA 2ZITA 3HSDA 1PBUA 4CRJA 4DR7F 1GNKA 3TUZC 2ZOMA 3IBCB 1FO1A 3GONA 1NZAA 2KHDA 3IS9A 4O4RA 4P2FA 1DQ9A 1Y3KA 1VIOA 5CHCB 4X64J 4ECWA 2P9GA 1TVRB 2JNJA 1TMMA 4NA2A 2NXCA 1B4SA 3LP1A 3BYPA 4DV1F 3I5AA 3LQVA 1S48A 3HSGA 4URSA 4HACA 1Y9OA 3KK3B 4P73A 2EPIA 4M5DA 1L3SA 2OIHA 3DMJB 4HLBA 4URGA 3H5YA 5B0AA 1XNQF 2YKOA 4Y2IA 5CZXA 1LWXA 4PXCA 3CGIA 4AFFA 3IWXA 3KHLA 1WD6A 1HQEB 1FFWB 1X4EA 5B7WA 1LWEB 3TUIC 2LECA 2FGCA 3LGNA 1EETB 3GE9A 4LR7A 1NSQA 3AOBA 1AZSB 3HFKA 3UNGC 2QMWA 5HJXA 4OYOA 5K20B 4J90A 1WTFA 1VRUA 4DUYF 3QGHA 2ZH2A 3K8WA 1BUXA 1C1BB 3G6YA 2MMYA 1V9OA 2JEIA 1D8ZA 1DARA 4ZN3A 2PEHA 2R2TA 2OH2A 1FRJA 1S0OA 4EYIB 2L08A 4EMDA 5DDOC 4I67A 2UP1A 5GAHI 3PDNA 3O1LA 3FBCA 3A3OB 5KT6A 4TNOA 4QIFA 5C25A 2QL5B 1X7VA 4FKYA 1V3RA 2XS7A 3DOKA 1S12A 4LSNB 5B0EA 3VGTA 5ETVA 3MAQA 3AD7C 4K4XA 2KH9A 1RZMA 2VF3A 3WC2A 1I6JA 2QFJA 4C98A 1BWEA 2CJKA 5LJ5Y 1VC0A 1Q16B 2B3TB 4KPCA 3MI7X 1RB0A 2YKPA 4O44B 2W4DA 1RBOB 4YB1P 1FKOB 2PFDA 2BACA 5B0CA 1DRZA 4AE5A 3GG0A 1YX2A 1J5OA 4KGMA 4YN3B 4FVCA 3MTJA 2BA9A 1T9YA 1ZTTA 2G2OA 2VQEF 4TYBA 1PAUB 4RX6A 1JJ2R 1P1LA 1IKWB 2RRAA 2VPXB 4JI2J 5D0GA 1HWKA 2CJQA 3T1YJ 4GKKJ 1S1WB 2PO4A 1PJ6A 5IWAF 2HHXA 2VL1A 1IJEB 2WVBA 4EBCA 1QTNB 1RKIA 3JYTA 3KLEA 5KFWA 3CJ5A 3DU6A 1YJTA 2VG5B 2ZZNA 3HD1A 2BW7A 4DV0F 3ZTPA 3OBIA 4USKA 3LW5C 5LOQA 3KOAA 1P9YA 1UVLA 5GADI 1FD8A 3LUYA 1JLAB 4DR3J 3DLHA 2GHVC 3IC1A 1H7WA 3BYRA 1HPZB 3K58A 2AGPA 2V2ZA 1I5OB 5JMNA 1S9GA 5CA5A 5KFJA 4X62J 3GJTB 2RUGA 3U1NA 4WFYA 4WKRA 5LXRA 4NOHA 2JSXA 2YWGA 5F8LA 3BV8A 1RSCA 3KHHA 2EI5A 3FJ2A 2V2KA 5L1JA 5IM0B 2VICA 1VFJA 1PJ5A 4FYXB 1UCNA 5LJ3Y 3QAEA 5E2QA 2B8QA 3D6HB 3B6BA 3NAIA 3DLEB 5BYQA 1NJXA 2ZVSA 2ZC3A 3I0SB 2R2SA 2ADCA 1QUPA 4WFBQ 1YRUA 3Q0AA 5DZ6A 1PC5A 2BRKA 4PXBA 2M88A 2X3DA 4NRUA 4EBDA 3TA1A 2IM1A 5JXSA 4AXIA 2GMHA 3V6HA 4J9SA 3CCWA 2HSEB 4DLGA 3UO0A 2HFOA 7AT1B 4B9NA 1SJRA 4M1KA 1RHRB 3I0RB 3JAMU 1YITS 3DM2B 4P9SA 4Z7CA 1TTHB 1TUGB 5KT7A 3VR1A 3I32A 4IQMA 2RS2A 5F8JA 3SIPB 4XPEA 1B99A 3S7RA 3PO5A 4ED1A 1CJKB 3ZXWA 4U9RA 1S7HA 1PGZA 3PJWA 3SZ2A 2FLPA 2MKCA 3ILLA 4B3SF 5HP1A 2HHQA 2MPUA 1EZZB 3NBPA 3ZTRA 3N6NA 1CC8A 4JI3F 2F63A 2J76E 1KHVA 2RF2A 2EG2A 1Y11A 4S0MA 4OLPA 2BMBA 1HQUB 2W2PP 4EK2A 2VB6A 3ZZUA 4H4OB 2C3OA 1Q5VA 3EVOA 4ZA1A 1JWWA 3MR6A 1U26A 3MPYA 2XSJA 4F2SA 3BBBA 2HMIB 4NLRA 3OTBA 4LIRA 1GQEA 1REVA 3TP2A 2FHJA 4DX5A 3HVAA 1URNA 4FNIA 3TAQA 4M5LA 4DWIA 3MEKA 3I9ZA 2AD9A 3RBEA 3J81j 3HHEA 1GK8A 4PYDA 2Z56B 3QT6A 3TANA 3DOLB 3M2VB 3IP0A 1NBEB 3KNAA 2HFUA 3CCVS 4QW8A 1P9QC 3BSNA 4KGKA 1ZYQA 3KUGA 2ZEJA 3GV8B 3GCXP 2E66A 1RABB 3M32A 3M30B 4BLGA 2M3DA 4X2BA 2DHHA 2J8AA 1YI2S 2CKWA 3NGSA 4QPTA 4DV2F 2DCLA 2DNPA 1FD2A 4CNYA 4Y2AA 3LP2B 4CH1A 5DG8A 4KYZA 3N6MA 4QJVA 1UVJA 3T1HJ 6FD1A 5KAKA 1NHKL 2BABA 4OZNA 1U8WA 4YR0A 5CYQA 1QTMA 1VDHA 5ETRA 5AJ3F 4PWUA 2Y1IA 5MLCV 4DPYA 3D1QA 2FVSA 3W9HA 1WF1A 3EUNA 2GMJA 5E3PA 3DLKA 2W8KA 4IG3A 1X8DA 2AU0A 4RW4A 3SSQA 5KG7A 4TLQA 3BQ1A 4LF7J 1W2IA 3V4MA 5T14A 3RJMB 2LYVA 2NCKL 4R25A 3MEEB 3SI8A 3ZNUA 4ZPVR 2IPOB 3RRHA 4RW9B 5A6WA 2OMOA 4DSLA 4ZVHA 3PR4A 4ZHRA 3E01B 4C97A 2LEBA 3CJKB 4O3OA 3SDEA 2CPZA 3U7JA 3O2IA 2F3JA 3ZZZA 3PKYA 1F0XA 3EICA 4L76A 4ZVOB 4URQU 1VBZA 1LXJA 4PG6A 1BGXT 4C48A 1FTCA 3BO4A 5ETOA 2AJ4A 3MURP 1WDTA 1OWXA 1EP4B 1C0UB 1NPRA 4HR2A 2B5JA 4U8YA 4LF9F 5FLXU 2PA3A 3B4MA 4KGZB 5BR8F 2HNZB 3H5UA 4CZCA 4DV3F 4CH7A 2H5EA 3GJQB 3TEGA 5KFEA 3OR1B 1JLGB 1M1GA 4JI1F 1DTQB 2I8EA 4EGLA 1EARA 5CCMA 4WFXA 1SVDA 3D6MB 2HVEA 2W2MP 2VQFF 3N5FA 2BM1A 2DHGA 1QAYA 3MM5A 4ES3A 1KQFB 1X31C 1A0OB 1U45A 2B4UA 3MF5A 1WOOA 4USVA 2Q6BA 5EX3A 4X4RA 3NGDA 3TZWA 3KLFB 1SPBP 5K8PA 4C3KA 2HZAA 2RSQA 4GC7A 4OX9J 3BN4A 1AUSL 2GHPA 4OZ0A 4LFBJ 3SXLA 1NKEA 4Q0BA 1AUDA 4DR4J 1WORA 4G65A 1JMTA 3UPFA 1FEEA 1TKXA 3CEDA 4KQZA 4Q43A 5L9NA 1H3DA 2IJFA 2ZWPA 2OPPB 2EKYA 2LLZA 3US5A 4USHA 5KFTA 1U6BA 2IRXA 5L46A 3MFIA 1ELOA 1KFDA 4USMA 4NA1A 3GU0A 4LBIA 1SUQA 1ZOTA 4X65F 2IBOA 1CS4B 2V69A 4LFAJ 4GVLA 5KFFA 1XR5A 5DM6Q 2ZVIA 3W5XA 4M63A 4NZ0A 1R43A 4FPIA 4H54A 4DL0C 2IYGA 1RLDA 4V19X 3KLIA 3CD5A 4NLVA 1RTIA 2IA0A 2YNFB 4LF6J 1FDBA 3NG8A 1R3NA 2CPEA 3ZZTA 3OPKA 5CQGA 4DR5J 3PW2A 4CLFA 2K3IA 5KT4A 1L3UA 4U67Q 2XI2A 3HF5A 4MMOA 5BYSA 4QOTA 1MLAA 3WIVA 1CG2A 3H20A 4TVAB 2R7VA 2ZUAA 5K14B 3DOMB 5KG5A 4Q7AA 4RUAA 3THVA 3K5LA 5DETA 2R7UA 2HQ3A 4KT0C 1BD6A 3AD9C 2W9BA 4TQSA 4DF4A 4DFKA 1FEHA 4YR2A 3V6JA 5J2QA 3IFEA 1GX5A 5KFRA 2K3KA 2POKA 3J80U 3GWCA 4F4ZA 2FVPA 1UEUA 4RW6B 4H4MA 4F8RA 2XGQA 2J6SA 4XDCA 5C24B 2IAJA 4DN0A 1N56A 3AJDA 4C2MA 2CWKA 3IG1A 1NK9A 1GMVA 3A8KA 3DLJA 1RTDA 2LXUA 4OI3A 4C8MA 4KH0B 4B9SA 1Y10A 3NOGA 2NQPA 1XBWA 1NB7A 1HR0J 4KB7A 2BKPA 2C42A 4CDIA 4QIWD 4DOZA 1PYSB 2XS5A 2J8SA 5J2MA 1U0HB 2J7WA 1UPMB 2DT9A 2XB2D 4RU9A 4WIQA 5IT9U 4CT8A 3JS9A 4LRCA 3THTA 5KFXA 2FHJD 4K4YA 2QLJB 2LP4A 2RDJA 2DPIA 3KYLA 2WRMA 5A8WB 3CCQS 2OI2A 3O5TB 3GIJA 4NXMJ 2B6AA 3C6TB 2E9RX 2ROGA 4O0NA 4G3IA 1HIYA 3MMCB 4LF1A 1YTYA 5T7LA 1NUEA 4TY8A 1EKSA 2KM8C 1KLMA 3IR7B 4ES1A 5I3UB 4CP5A 3WZ0A 3CT9A 2UUBF 1FNOA 2JL9A 3L7UA 1ZM9A 1WEXA 3HVWA 3DYAA 4B3OB 3VZIA 2W7AA 4J9PA 3VVUA 4E0DA 2GIQA 1NDKA 2KB2A 1CJTA 4ED6A 3MM7A 5KFCA 2C2RA 1FNMA 2LEPA 4JYAJ 2F5GA 1JLFB 3D6FB 5AXMA 2NLWA 1H2TZ 4XPCA 2UU9F 4ZVQB 4DL7A 2DCUB 3M8WA 9ATCB 1FHTA 2VU5A 1UA1A 2AP6A 3Q23A 4ED2A 2XO6A 1S6PA 5KFNA 4YEAA 2MZQA 1FKPA 2OSQA 4NYPA 2XGPA 4PG7A 2R4FA 3BQ2A 5KFMA 3JSYA 2AW0A 2HQDA 2G1HA 2HNDB 1TR0A 5JUMA 3ENWA 3SSSA 4ZIVA 4KFBA 4DV5J 1UJ4A 1K8AT 3K89A 3PIPQ 3VAJA 1C4CA 5HQLA 2CUYA 1OYDA 3QGGA 2DH7A 1HBNB 2AJ0A 3M6XA 4JI7J 4LF2A 5K9FA 1UW4A 4WU2A 2RQ4A 3G82A 3KTQA 3NMAA 2UUCJ 2I2YA 3BR8A 3H25A 2IM3A 3QT7A 1T3NA 2XBPA 2E5LF 2H5IB 2P6SA 2K2PA 3Q8YA 1N5YA 1X9SA 4K4SA 3IBFB 5IC4B 3IR5B 4WXOA 2KN4A 2FZKB 3SBMA 1H73A 4ID5B 2HG4A 2D9OA 3VAFA 3PVXA 3TA0A 2E9TA 4ZLNA 3HHLA 4ZJLA 2Q6CA 2V50A 3CJ0A 1RCXB 3BSCA 5D78A 2B9XA 3I4HX 4DL3A 2ZHOA 3CB4A 5LSRA 2GJFA 4JI6J 4GKJJ 2RNEA 3DI6A 2WVFA 4UOFA 3G2XA 7FD1A 2YWHA 1PG5B 1VLYA 2V2VA 3WQPA 4JI0J 2HWHA 1SKWA 3IM9A 3AA8A 5A0YA 3MM8B 1D0EA 3I55S 2B56A 1S1UB 2ZE2A 3AB2B 1J27A 3IO1A 1N0VC 4X4PA 3VWSA 4OL8A 4LR9A 2OPSB 3TJ9A 2B9EA 3IAS9 2AYEA 1F2HA 4IG3B 3OLBA 3RB6A 1D09B 2BJ8A 2XMAA 4B3TJ 4NLQA 2Z2MA 2CAJA 2F4VF 1NKCA 1MU2A 5ITHA 5ADZA 1JLQB 3AB4B 2NR0A 1HBUB 3BJYA 3CO0P 3FCHA 2QSFA 1TFYA 3IM8A 3GCWP 9RUBA 1GEHA 4ZCMA 2XLIA 1JLCB 4F02A 1HBOB 4WIIA 1VQ4S 4ZJOA 1WG4A 3EDQB 2ZWOA 3FGVA 1EKRA 3CPWR 4IFVA 4EI2A 3M6WA 4A47A 1NHUA 5EHHA 2YQ1A 2LXFA 3DGPB 1XNRF 2FTRA 3R3TA 1VC5A 2RQCA 5LSLA 3TYTA 4I2PB 4HVZA 1DTTA 1ZM3A 1HWIA 2FJAB 5FIIA 1HA1A 1HYSA 3DDNA 3QO9A 5M2PA 4DSEA 1RUSA 1S1TA 3D4JA 1S6UA 4C11B 4X66F 5KFGA 3BS9A 2MQOA 1FXRA 1UFWA 3F73A 4O4GA 4A8KA 3QZ7A 2CZ4A 2G0CA 1YBUA 1HBMA 1AXQA 4NASA 2H5JB 2KO1A 1Q81T 4I4BA 3KLHB 2CPIA 3X1LB 4GO5X 4NLWA 1RT7B 4ZK7M 1XN9A 2OKQA 4DX7A 3DRSA 3E51A 3KK1B 3C14B 1QLNA 5AXLA 4C0OC 2JX2A 4AT1B 3ELHA 2WK4A 3GIKA 1JLEA 3MR2A 4RBVA 2IMWP 3W61A 4PRFA 4ZMMA 3AJ2A 1BQNA 1OO0B 3LOUA 3QZ8A 3EXCX 2YY3A 4K59A 2OTJS 1YG0A 1NK7A 2YNHA 2VH7A 1VBXA 4YB6A 3OL7A 1HD1A 2JEJA 2FLOA 3MDFA 1HNVB 4PG4A 1KWMA 1LKZA 4OYBA 4ZCLA 2NS1B 2GQ2A 3OL6A 1IUJA 1WKKA 3ZZRA 2ROPA 3G6VA 1AFJA 5D0EA 1GMWA 2Y8WA 2RH3A 4LQ9A 1U49A 5DRKA 3DCAA 1X4DA 1CJVB 3OTDA 4PPZA 4NI2A 2BQUA 4CM0A 4PXDA 1T11A 2HGNA 1RT1A 3AD8C 4DV7F 1YRTA 3LAMA 1PYOB 5EWEA 2KKHA 1UETA 4KGVB 4A8SA 2DK2A 4XTTA 2SXLA 2QGFB 4N7TA 1RU1A 4RNNA 3CD7A 3HD2A 1WNEA 3PKMA 1RACB 5HLFA 1UZDA 2R2RA 5HANA 4MKBA 3K5PA 4HH1A 3OFEA 1FVSA 2RRNA 4NLPA 1S6QB 2M9KA 5J1NA 2UV8A 1B7FA 4R8UB 1IBMF 2D1CA 1MWQA 1T05A 2CPXA 4NYOA 1U4BA 3NMRA 2DH8A 3W62A 4NLYA 2R3VA 5C2CA 3MM9A 1X4HA 4DCOB 1ZS6A 5I4MA 3L7OA 1S76D 4TLRA 3DLGA 3QSIA 4RKUC 4ED3A 2A6MA 4IFYA 3F0NA 2GVZA 2HFVA 4ZPAA 1SH2A 1U1MA 2NPFA 3JQKA 4OHWA 4HHUA 1N88A 2XNQA 4Q44A 4LQ3A 3MEGB 3PX4A 2KM8B 4LFCJ 3OL8A 1S9EA 1H72C 2DGXA 1K0VA 4OV6A 2E1PA 2OTLS 1QE1A 2KG1A 3GZ7A 2AGQA 4IR1A 4N76A 1KRPA 5KOWA 1ZZFA 3HFVA 2HZVA 3JSMA 2DNGA 1YWXA 2R8JA 2MKYA 3DRRA 2C2EA 3VAHA 5DM7Q 2FD2A 1KTQA 3BGUA 1U25A 2HNYA 4IH7A 1RT4A 1TKTB 4TYAA 1IQTA 1JX4A 1VLOA 4U7UK 5KFPA 2UXDJ 2C2DA 1N34F 3ZZOA 3ZC4A 4K2XA 2AGOA 2Y3YA 1ZAXA 2IAJB 3BEGB 3VGUA 4KKOA 3R1HA 2LU1A 2Q79A 5D77A 3V6DA 2YPYA 3J81U 3TRGA 1E6YB 5FD1A 2BR0A 2W9CB 4JI5J 3MCMA 3R8YA 3I5BA 4F0HA 2DD8S 4ZIWA 1T0TV 2FYXA 2E1RA 4QYZK 4PYAA 3CDBA 3N0VA 4J9MA 2R7XA 2IFXA 4ZVUB 4HDGA 3OR2A 1VK3A 1N32F 3FSXA 4QR2A 4F4AA 1DZ5A 4WP8A 5LM7E 2V4JB 4OYAA 1S1VA 4BWJA 5DGBA 3M9OB 3HHDA 4L3KA 4PWDB 3HVTB 4F3MA 2E29A 5IQQA 4CO1A 2CQGA 3HJFA 4USTA 1G7CB 3BZQA 2PC6A 1LW0B 3LH2S 4AL6A 3CJ4A 1FE4A 3J7ZT 1VQ6S 2UUAF 1LQ9A 1JQGA 1XC9A 4NZ7A 4F25A 1CULA 5B0GA 5L38A 2OUGA 3TAPA 4OZJA 4A8WA 3OTCA 2YX7A 2HHWA 3GSDA 2L3MA 2YKMA 1WACA 3ISZA 2OPQB 2DR7A 4A8YA 2XMJA 4NCGA 3K5MA 1CQMA 3N5BA 1FJGJ 4FNHA 1HR0F 3PX0A 4FYYB 1VQ7S 3FK4A 2W2NP 1NHVA 1VBYA 3D5MA 3DRXA 2H4YB 3ISNC 3A4TA 1I3OB 1XK8A 4XAKA 5DZ7A 1OPIA 2CVEA 1NJWA 2O1PA 2GAHC 3GMGA 2ZH4A 1M5VC 3N9UC 1O8BA 2RVJA 1N4LA 4OHYA 5B0BA 5I42B 1RE1B 1U0SA 3FBFA 2AJ1A 4B9LA 1VQLS 1F6TA 2BQRA 3FUYA 4DX6A 2MKHA 2V8GA 2D3OR 1UVNA 2NREA 2CQ4A 3OQ2A 3IRWP 4ANCA 3QRPA 4QIEA 1GMUA 3QWUA 1VBKA 2V8VA 2Q43A 5IS2A 3I9V9 2UV8G 2E5IA 2C28A 1KFSA 5A2QY 4RNFA 2MKIA 2FGOA 3O44A 3C2PA 3O3LA 3X3UA 2DNRA 2CG4A 4OMFG 4Q2LA 3R5BA 3CDAA 1YBTA 3SFGA 4Z2XA 1HNWF 2ZKUA 2LKZA 1F5BA 4ER8A 1LWCA 2GQCA 2I0XA 2QZ8A 2IC3A 5M2UA 1TZ0A 3RW6A 5IV4A 3KJNB 1NZ8A 1YZ6A 3T41A 3EYZA 4ILLA 2PIIA 1K0TA 1NMEB 3G71S 3LGMA 1BMQB 3HKZD 2B43A 2VPWB 2ZOFA 2WOMB 3MMJA 3HLUA 3RR8A 2W4CA 4DXLA 1HNXJ 4CYUA 4ZVSB 2BANB 2XMUA 5FJ4A 1QSLA 4HT7A 4CLYA 3TWZA 3V6KA 3MCOA 2VG6A 4I2QB 2CQ3A 1FK9A 2YBVA 4H4KC 1RAIB 1R6YA 1XWLA 5M2RA 4CTAB 3IRXB 1Q1KA 1N33F 4M5HA 3CCMS 1G3OA 2OMLA 3CMES 5AE1A 3PO4A 4ALZA 3RGIA 3V4IB 1TVRA 4WFAQ 4CQ1A 3ULHA 3M2UB 4F67A 1XMOF 1IWAA 3EJMA 2Z2YB 4EO8A 3FBBA 3KK3A 2GNKA 1VQ5S 3DMJA 4C8ZA 1B0VA 2G0JA 2BE2B 5E3RA 5KG3A 2RAQA 4ZPBA 1RWMB 3I4PA 1P1TA 4LSZB 4ECZA 2AYBA 1HQEA 1S79A 4NLUA 1LWEA 3KUHA 2HHSA 4B3RF 2MQLA 4NLDA 1X4FA 2PMWA 1RU2A 1YKWA 3U27A 1EETA 3W7BA 2UZAA 2IVMA 1MMDA 4AUKA 1IBLF 1UVIA 1AZSA 3ENVA 5LSOA 2YWEA 2BKOA 3VZHA 4PUOB 4C8KA 2ZJPQ 1T94A 4LF4J 2PN6A 1C1BA 2RMLA 2V8HA 2J0WA 3C66A 2CJXB 3ICLA 4A46A 5D4NA 2ASJA 5LMUJ 4P52A 2XY6A 4ECXA 1KSPA 5KFSA 2AX1A 3K57A 3OHAA 2W2QP 3MPDA 1PC4A 1VISA 2KFZA 3FQKA 1WC6A 4YP3A 3RB3A 3OD2A 2GS8A 2DIUA 2DVIA 5IQ6A 1TFWA 4MK7A 3LAKA 4EZ9A 4B3TF 3D1HA 3SMZA 3BF4A 2FJWA 2ZH7A 3QPIA 2IVFB 3BPSP 1KKHA 2YH1A 2KU7A 2W2OP 2DY9A 2M70A 4PR6A 4ED5A 4LSNA 2YTCA 4LVOP 1NH7A 2KYZA 2HS3A 4DQSA 3NGTA 2I6WA 3AT1B 4DUZF 3FMWA 1Y4ZB 2M7SA 1E6VB 4DR2F 5CD4A 3GP9A 3JSRA 1YDLA 2N4DA 4FBTA 2QA2A 4NYZA 2BVZA 2JFKA 1D8YA 2W1BA 1PJ7A 4DBQA 4O44A 3UR0A 1TKZB 2Y0SD 1FKOA 1BQMB 5GAEI 4QIVA 2WSFC 1T7PA 4A48A 4QR0A 4R0JA 4OYMA 5J2NB 4UF4A 1SH0A 2AJQA 2XMVA 4DG1B 4DUTA 3CC4S 4R5PB 2RKIB 1RCOB 2E5JA 1IKWA 4G1PA 2PMHA 2IJRA 4B08A 1S1WA 4DV4J 2OELA 2DXFA 2MHEA 2VD3A 3PIOQ 1EQMA 3KMSA 3OT9A 5IV3A 4L74A 3PEJA 2VG5A 2GO8A 5IFMA 4CO4A 1XMBA 4F4KA 1UEVA 1RYRA 1VJQA 4FZVA 3M9MB 3OXFA 3EDRB 2HRUA 1M5PC 2VZ9A 3OJUA 4RU2A 2EEYA 4WBFA 2XLJA 1JLAA 2FHMA 1KP6A 4FYDA 4LF5J 1HPZA 3BKTA 3OLAA 4E98A 3NCRA 3MCNA 3OVSA 3ISND 2XHCA 1U47A 3CJ2A 4PPDA 1SL0A 1RA7A 1VRTB 2C2ZB 5DDPC 4RBTA 1RQ0A 2QFIA 1TAUA 2CFXA 5KFKA 2KXHA 2A3JA 3PW5A 2HIQA 5IM0A 3R6GB 4RL1A 2F7VA 3P3DA 1NH8A 3PG9A 3G87A 3DLEA 1Q7YT 3BSOA 4KJIA 3I0SA 4IH6A 1EIYB 4CT9A 1Q8LA 3BN7A 2G1DA 5B09A 2NXUA 1K44A 2XZDB 2HZCA 4MIBA 1NDLA 4GVBB 3J7Z5 1MWYA 4O3SA 1NO8A 2J9DA 3NOCA 3ILJA 2V0NA 1NK0A 1UVMA 3C46A 3BDPA 4ANDA 3DN9A 1X4CA 4A8MP 3AODA 3I0RA 2DR6A 4B3MF 3DM2A 3M05A 3Q86A 1V6HA 2IM0A 3A3NB 3M2RB 3KMQA 2UVUA 5THWA 1K1SA 2CIMA 1TQLA 3T3FA 3LWLA 1CJKA 3T5JA 1TL3B 3TZZA 2XCAA 3D28A 4LF8J 1GXLA 4J9QA 2G0IA 3SEOA 2HBQB 1P27B 2MTLA 2KTQA 2LMIA 1RHUB 3OTOF 2HLTA 3CD0A 3IMQJ 3R6LB 2A1BA 1MROB 3H0PA 4I69A 3DHXA 2RU3A 1VHFA 5DQGA 3DRYA 4ZLJA 4MKVA 4DJBA 1HQUA 2C2NA 3PRDA 4H4OA 2PSZA 1G6BA 1WI6A 4DR6F 2OO4A 1S99A 2Z2ZA 3H5XA 2XC9A 3KUEA 1QUVA 2OEMA 2HVHA 3W64A 2HMIA 1YJRA 5B0DA 1KQGB 1TK0A 3QATA 3CXCR 5ETTA 5HQMA 5KFOA 1ULRA 3GJRB 5SUHA 2HRTA 3VCDA 2XNRA 3WX4A 3HP6A 3DOLA 1RAAB 1VCTA 1WKJA 4ILRA 2QMXA 3M2VA 1YHQS 2HHTA 1X5SA 3AOCA 3SQOP 4K0KJ 3J7YI 4JP8A 5C7PA 3R1LA 4OLOA 4QWBA 5I3QA 4PCQA 1IBKJ 2B4PA 1NDCA 4J9LA 3M30A 1RWKB 3WC0A 3T5HA 2ZM6F 4RLEA 1RTHB 2FJVA 2ZC4A 1I94J 2YKQA 5G4DA 1QD1A 3TOQA 1VIXA 3JTNA 4WPAA 1FJ7A 1NJIT 3LP2A 5F3TA 2HHHJ 4QYZJ 3P6YC 1FRMA 2BEFA 3G4SS 1W26A 1VQNS 2V94A 2OFGX 1NB2A 1XR6A 3R9LA 3GV7B 1J2VA 3BH6B 1S0NA 2XMTA 4DV6J 3RW7A 1IKXB 1HHSA 4DQIA 2KVQE 4WP9A 1OY8A 5A76A 3WBZA 4NEZA 1GXUA 5HVGA 3QFWA 3POTB 1MW7A 2YX4A 3IR6B 1VHIA 1M1HA 3IWLA 2HBYB 4USIA 2FC9A 3NS6A 4K4VA 4V1Ak 2K8GA 5D3GB 1K47A 4NL5A 1D9FA 1T9TA 2RILA 2ZD1B 4DL5A 2VG7B 3QJJA 4OYXA 1RI7A 4O3RA 2MKKA 3NS5A 1PIEA 4RWWA 1OY6A 2Z30B 3MEEA 3R27A 3HX9A 3EM1A 1HFEL 2QL9B 2NZ4A 2DB1A 3IAM9 4RW9A 3TUPA 4KC5A 1W25A 3CJSA 1TAQA 3AQOA 3E01A 3CJKA 1S9FA 4N56A 4YY3J 3T5LA 1Q86T 4OI0A 3OXGA 4ETXA 3KG0A 3W8GA 1C0TB 2WTFA 1RHQB 2NXJA 2AMCB 1XMQF 5CYMB 1ZPVA 1TL1B 1EP4A 2JWNA 3BQ0A 1HI0P 1C0UA 3CIMA 1FWKA 2YWKA 1UMJA 4DHVA 2HNZA 1NCLA 4J9VA 3GIIA 4PZVA 2XLKA 4RNOA 1TU0B 3OR1A 3W2VB 1JLGA 1NRKA 4LVNP 4MFBB 3V81B 4KHPF 3TQ1A 4BBYA 1IBCB 3C19A 1A6LA 1DTQA 4JI4F 4U6PA 2DITA 3M8PB 2E7XA 3AHPA 5H1SV 4EU0A 4WTOB 1S97A 4KAIA 4AXJA 1YSJA 2ZBRA 4RW8B 5CYJA 3C15B 4DR1J 5D4LA 1AB8A 3BH7B 2IMOA 4J9OA 4FF3A 2KRRA 4JV5F 3KDOA 2VUGA 5E3AA 3KLFA 2J9DE 4ZPTR 3W9IA 4MYUA 3P5BP 1UWBB 1EB0A 2J0QD 1U2CA 4O0IA 4E8UA 3ITHB 3DKDA 4I64A 3QIDA 2XULA 4B9MA 5L9XA 2B9YA 4M94A 3M8RA 2XY7A 3JTPA 2M2BA 4ZJQA 2HK2A 4YFUA 3ILOA 2CRLA 1UP1A 4NLSA 2OPPA 3I96A 3RB0A 3HKWA 4W98A 2YQ0A 2HGLA 1FTRA 4OIXA 1UJ6A 2EFNA 4PABA 2MYFA 2B0GA 1U1RA 4JV1A 2CZ9A 1D3WA 4EFAC 4AQYF 3FEYB 3P45B 1CS4A 1HMVB 4B9UA 4F0MA 1APSA 2HIYA 2CPYA 2WAQD 2ZBCA 4M5KA 2MDAA 1JLBB 4J91A 1MN9A 5J1PA 3NAHA 3DC2A 1TMJA 3E8OA 3UDCA 1MMLA 2YNFA 3CCES 4DR7J 3AXMA 1EAYC 1VK8A 4OI4A 3KK2B 4ED0A 1AFIA 2W7OA 4Q5VA 3KG4A 2VDHA 4X4SA 3NNAA 1RAEB 3PRBA 4A8QA 5DQHA 4A8FA 3MM6B 5K14A 3DOMA 2UXBF 4DV1J 1CC7A 2AWZA 3CCSS 2KZZA 3OFHA 2BE9B 2KT2A 4IRKA 2MQNA 1F2GA 3CCJS 2PT0A 2UVRA 2NUUG 1S57A 2AEMA 2GCFA 3ZTQA 3UCUP 1XNQJ 2YQ3A 3OW2R 4MK9A 4QBUA 5DQIA 5DDQC 2A6OA 4RW6A 5A6PA 1VYAA 5C24A 1SKUB 1ZTWA 2X1FA 4CWBA 2V67A 3KLVA 3UCZP 4WFNQ 2DNOA 4JI8F 2M8HA 1SQFA 5LL6d 2IDLA 4DPOA 3H2VE 3EVWA 2MLZA 4K4TA 2ASYA 2B4OA 1LNQA 3FC9A 4WZQA 1CJUB 2KVIA 2H3EB 2D3O1 4MH8A 4LRDA 8ATCB 2QLFB 5GMDA 3KHGA 1SCJB 1U1QA 1LOUA 3Q8PB 1TL7A 4NLGA 1S49A 2BQ3A 1HNZF 1HKAA 2G2ZA 1U0HA 4LJMA 4W92B 1KQSR 4LMZA 4KV8B 2CNOB 1KQKA 1N6QB 1RADB 3HZGA 3P4UB 2L9DA 2ZDOA 1EX8A 3GG1A 4FVMA 2F1FA 3PR5B 1DQ8A 4OJHA 5A8WA 1BLUA 1VQYA 3C6TA 4PAAA 1XQIA 2YKAA 2EW9A 3MMCA 2R2UA 2I5JB 2DH9A 4IKAA 2MQQA 1KDNA 3MWBA 3EMTA 1NPKA 5I3UA 5GAGI 3LPYA 4I0WA 2AHOB 2NPIA 5HN0A 1KOOA 2MKJA 2EC0A 4G1QB 2AYMA 3KKFA 4B9VA 4B3OA 2HFZA 1WC4A 1UJ5A 2CQ0A 3GTYX 1M1KT 1UTAA 4QYRA 1KLNA 5DS7A 1QSSA 4ZPWR 4HHJA 1IN0A 3B54A 1A7GE 3I6PA 1JK9B 3I31A 1RTJB 2PA8D 3FSYA 1ZM2A 2KL8A 4ETZA 2NXEA 4TU9A 1WHVA 2VBWA 5IWAJ 4X4NA 3CO9A 1X9MA 4OHXA 4OHVA 1JLFA 5KT5A 1S6OA 2DNMA 4OYIA 1J5EF 3PZPA 4ZLPA 4DCPB 3UFCX 4CLZA 2MZRA 3MXHP 1UW9A 3H4DA 4QQBA 2G13A 2VJUA 1N36F 5E41A 4DV0J 4F3OA 3W2WB 4L72B 3CCZA 2UXCF 3BBCA 3R7NB 2AF6A 2GAGC 4U7UD 2GIRA 1C1CB 4A4JA 5FDLB 3LGHA 3BB5A 2HNDA 2JLEA 2HRYA 4ZVFA 1R7IA 4C4WA 2OPRB 2GVDB 1M5OC 1YZ7A 4YOEA 4NLOA 1RTZA 2LQJA 4U8VA 4K4WA 1FRLA 1HBNA 5CH7B 3OJSA 2CJ9A 3ILIA 3I87A 2MQ8A 4LBHA 5ETLA 2KT3A 2AIRB 1QM9A 1Y3JA 1ZA2B 5JVHQ 4IOCQ 3ETMA 3DGVA 3CD6S 4BC9A 2W9AA 4DSFA 3R5JB 3QIPB 4MTPA 1KBRA 4ID5A 2KJVA 3GFXA 1O5JA 5F8IA 3ADAC 2R8GA 4U96A 2YNIB 4KHRA 3HT0A 4ENOA 2CJAA 2HLUA 2YNGB 2ACYA 3M1VB 2XZTB 3NGRA 3PFOA 1R8CA 4B9TA 2AEJA 5GMEA 2ZHBA 4C6AA 1FFGB 2CG8A 3GFZA 4ELVA 3OXLA 2DNHA 3DDIA 4OHZA 2M4MA 1L3TA 1URRA 3MEDB 4PQUB 4WCEQ 1VI7A 1UA0A 2DRBA 3MM8A 1S1UA 3TNVA 4K4ZA 4B3SJ 3IWNC 3UD3P 5LMNF 5IT4A 2OPSA 4M5IA 1SKRA 1WC3A 1B64A 2EFVA 4I6WA 4JI3J 2R7OA 4Y2CA 3ET6B 1VRQC 1JNRB 2XHWA 2QTWA 2V8PA 1LWFB 4Y0FA 4C3MA 2Z4PA 3PFEA 2QYGA 4WU3A 2VOPA 3MPVA 2D69A 2ERRA 3A8JA 3MMBB 1JLQA 1AROP 6AT1B 1HBUA 4WK1A 2Q1LA 2BE7D 3D0GE 4ZCIA 1RJJA 1JLCA 3PHEA 3VGVA 4CH0S 1HBOA 4JB8B 3MMAB 2HKEA 1QDUB 1AYEA 1IM4A 2UUWA 2FJEB 1NJZA 3CE8A 5G0RB 2K7JA 5HMXA 2CNKB 2XCPA 1FWLA 3UCGA 4UTGA 3JAMY 1PKUA 3B78A 2PI5A 3DGPA 4NXNF 1UWAA 1NXIA 2R8HA 2HVIA 1L3VA 1WUUA 1FX4A 4I2PA 1PBAA 1S7IA 5ETMA 2OD6A 2EFOA 1RK8A 2HVZA 5CABA 1WG5A 4Y00A 4DU7A 4C8YA 2V9KA 2C3PA 3MTKA 3H90A 2JFDA 4RUHA 5DDRC 3VALA 3NL0A 3HJVA 4C11A 3MPUB 4DL4A 2FLNA 5A8KB 4UZCA 4DV2J 4HL9A 2JOQA 2F8MA 4HTJA 4ZLLA 1RWXB 1SL2A 4RO0A 2XO7A 4O3NA 2XM3A 2IJNA 1WHXA 2W7PA 4BHQA 2YKNB 4ZP9A 2G9OA 3KLHA 2ACMA 2MLYA 2VC0A 3D3CJ 3HVRA 3SCLE 1RT7A 3FNNA 5AJ3J 4FXVA 2XSFA 4N77A 1X0FA 1RA6A 2CWXA 2RB7A 2VFTA 1M5SA 5U47A 3KK1A 3C14A 1WELA 1X0PA 2HFSA 3DRPB 1KHWA 3LANA 2AEFA 4OFZA 5DGAA 3G8QA 2IDEA 4QCLA 1RT6B 1CVJA 3D0IE 1BWVA 1N5SA 1NU4A 2FDNA 5JVGQ 1RT3B 2HHVA 3DHWC 3H2UB 1FWPA 1G2EA 4JBCA 3TA2A 3CDEA 2GIFA 3NXZA 5ETPA 2D41A 3T6JA 1M0SA 3Q2TC 4WKYA 1HNVA 4IG0B 5KG2A 3VAGA 1OMSA 3JQMA 2DHAA 4KY3A 4ZS6A 2DY1A 5DG9A 2JRSA 3LF0A 4OZ2A 3SCKE 4XIUA 3BKFA 1CLFA 2CQPA 1HI8A 3HM9A 2GGPB 1CJVA 1KEKA 4LF9J 5HI7A 5BR8J 1RWOB 2LA6A 4KTQA 2O5DA 3C6UB 4P74A 2DO0A 4YHHF 1Y5NB 4DV3J 2LQBA 4M5JA 1R27B 2D74B 5CZVA 4JI1J 1Y7PA 2DIVA 2Z8QA 7FDRA 3ENAA 3CNQP 1UFLA 4L73A 4AL7A 4Y34A 2WVCA 5B0FA 5KG6A 3C16B 2VQFJ 4ECSA 2JLFA 1O6XA 3KNGA 5J1EB 4X64F 5KT2A 1LFPA 5H9FK 4O3QA 1U24A 1RWNB 4QW9A 2E1AA 1KC8T 1S6QA 4K8RA 1VR6A 4X4QA 4R8UA 4ELTA 3EPGA 2FY1A 1H98A 1H7XA 3GILA 4ERDA 4I7FB 2JJ4D 4J9NA 1NLKL 4NE9C 4KO0B 3H2LA 3FCWA 4DSKA 4DSIA 3R2DJ 2F8EX 1T8EA 1B0PA 1F9HA 3ZNJ1 1KVKA 1YQHA 2V2QA 1N5VA 1A9NB 5E3CA 2R9LA 5FLXY 1KONA 1IJFB 2H1YA 1TL7B 3MEGA 1RLCL 3M8QB 4X65J 1WTBA 1S1XB 2FZCB 2DR8A 4N47A 1LK5A 5EGYA 4QZVB 3FFIB 3CC7S 1YJUA 1SJ3P 3BGRB 4JUZA 1FE0A 1Z1ZA 2CQ1A 2DRDA 3LALA 3IA0A 5L39A 1R89A 2JEFA 4LSLB 1JKHB 3RR7A 1G1XA 4DEZA 1H38A 2LQ9A 2EK1A 2VBYA 2BJDA 1VQMS 4DSJA 4HT5A 2RUSA 2A10A 1TKTA 4K5RA 2QT7A 4KR0B 4OX6A 2GQQA 1R0BG 4I1TA 3TJAA 4KBIA 3LWMA 4P72A 4QU7A 3D68A 3CCLS 2BZ2A 2DGTA 3H7HB 4KE5A
chains in the Genus database with same CATH topology
2RMLA 2V8HA 1RTDB 4BDPA 2J0WA 4O3PA 3BSNA 4KGKA 1ZYQA 2AV5A 3C66A 2LDIA 3ICLA 4A46A 5A8RB 4FF4A 5KG1A 5D4NA 3GV8B 4P7VA 2E66A 3M32A 2KDOA 3M30B 2ASJA 4IDKB 1E6YA 5C42B 4DL2A 3M4XA 3MMAA 3KLGB 4DF8A 2XY6A 4X4TA 5D4PA 2W9CA 2M3DA 4ECXA 1KSPA 4X2BA 1TUVA 5KFSA 5GVQA 2J8AA 1YI2S 2CKWA 4ICLB 1W2BR 2AX1A 2MB0B 2F8HA 3K57A 4QPTA 3OHAA 4DV2F 1PC4A 2DCLA 2HYIB 3Q24A 5G0RA 2KFZA 2DNPA 5KTQA 1U1LA 3FQKA 1B0TA 3G6XA 1FD2A 4CNYA 4YP3A 5F8GA 3RB3A 3JB9k 4F3QA 4Y2AA 2DIUA 2DVIA 3LP2B 5IQ6A 4CH1A 1TFWA 4MK7A 5DG8A 3MOZA 3LAKA 3N6MA 4QJVA 4B3TF 3D1HA 1R31A 3SMZA 3BF4A 5E0OA 1GT8A 5KFBA 6FD1A 3QPIA 5KAKA 2ZH7A 4GC6A 2BABA 2IVFB 3CTRA 4OZNA 5J2MB 2V4JA 2YH1A 2KU7A 1HWUA 4YR0A 5CYQA 4ED8A 2M70A 4PR6A 5HBMB 4ED5A 4LSNA 2YTCA 4LVOP 4PWDA 1NH7A 3QJPA 1QTMA 3HVTA 5AJ3F 2KYZA 1L3KA 2FVQA 1SC6A 2HS3A 2ZBIA 4PWUA 2Y1IA 4PXEA 5L1IA 4DQSA 1N0UA 4N41A 5MLCV 4DUZF 3FMWA 4JI2F 5SZTA 1Y4ZB 2M7SA 5KG0A 1E6VB 3D1QA 4QWDA 3G96A 5HO4A 4DR2F 2FVSA 1WF1A 3JSRA 3EUNA 3T1YF 4GKKF 4TU7A 3TO8A 3HO1A 2GMJA 2N4DA 1FJGF 5E3PA 4FBTA 2QA2A 4NYZA 2P5VA 3DLKA 1LW0A 2BVZA 5A8KA 3PXGa 2JFKA 1D8YA 2W8KA 5EWFA 1LW2B 3FMBA 2B6AB 1CSJA 3DFEA 2GHWA 3HT3A 4IG3A 4DFJA 4DBQA 1X8DA 1T03B 4O44A 3UR0A 2AU0A 1TKZB 2Y0SD 1FKOA 5T7LB 4RW4A 1BQMB 5GAEI 4QIVA 2WSFC 4TY8B 1T7PA 3SSQA 3ZFVA 5KG7A 3OUYB 2YKNA 2EWHA 5L8RC 4A48A 4QR0A 4R0JA 4TLQA 3BQ1A 2AYGA 1KLMB 1W2IA 4Q2MA 5J2NB 3V4MA 5T14A 1SH0A 2LYVA 2ZFHA 2HAIA 4OI1A 2BOPA 4MYTA 4Y65A 2AJQA 4R25A 4FXWA 4CI0B 3MEEB 4X4VA 4OX7A 1V3SA 3SI8A 2XMVA 2HS4A 3Q22A 4ZPVR 4DG1B 3CC4S 3DYAB 2RKIB 2N7YA 4R5PB 1NK4A 2E5JA 4D3HA 3RRHA 1IKWA 4RW9B 5A6WA 2OMOA 2KFNA 2WB4A 4HDHA 4G1PA 2ZH9A 2OPQA 2PMHA 4DSLA 2ZH8A 4ZVHA 3DRPA 2MHNA 3PR4A 4WYLA 3E01B 4B08A 4C97A 4ZHRA 2LEBA 4IOAQ 1S1WA 3CJKB 4O3OA 3SDEA 2CPZA 3HHLD 4DR3F 5DO2A 3U7JA 4EYHB 2L9WA 3HXMA 2M5YA 3O2IA 2F3JA 3H5SA 4WE1B 4N5SA 3J80Y 3ZZZA 3PKYA 1F0XA 1XERA 1KNZA 4URQU 1RT6A 2MHEA 4KSEB 2VD3A 3IGNA 3PIOQ 3BGFA 1VBZA 1LXJA 3KMSA 4X62F 4PG6A 4EWTA 3MM7B 3SYZA 1BGXT 1FTCA 3BO4A 2GFFA 2AJ4A 1RT3A 3MURP 3AA9A 3U1LA 1T95A 1XEZA 3PEJA 1OWXA 1R0AB 1EP4B 1C0UB 3PV8A 2VG5A 2B5JA 4J37A 4LF9F 2GO8A 1C4AA 2GV1A 5IFMA 4CO4A 2PA3A 3B4MA 2E9ZA 3NKYA 5BR8F 3RB4A 1XMBA 3RAQA 4F4KA 1UEVA 3AQPA 5E33A 1RYRA 1QVFR 3SCIE 5I42A 3FSIA 5KG4A 2HNZB 4ILMA 4FZVA 4IG0A 3M9MB 3H5UA 3OXFA 3SSRA 4C8OA 1OQ6A 2XWYA 4CZCA 2HRUA 3OVBA 2NSCA 3IGVA 2J0SD 1M5PC 3FVYA 2VZ9A 3B82A 3OJUA 4DV3F 4CH7A 3OSPA 2ZH5A 2H5EA 4RU2A 4FF2A 1S6PB 2PE8A 2LEAA 5KFEA 3OR1B 2Z0GA 2XLJA 1JLAA 1WEYA 1JLGB 2FHMA 1FDDA 3MPWA 3V5RA 1FKPB 4FYDA 3T19A 1HPZA 4JI1F 1DTQB 2DNLA 2I8EA 4EGLA 3U1MA 3K0JA 5CCMA 5AXKA 4WFXA 3OLAA 4E98A 3NCRA 3OVSA 5D8HB 3ISND 2K7KA 1U47A 2HWIA 3CJ2A 1QAJA 3BM7A 4PPDA 3EX7B 2LCWA 2HFNA 2CZVC 1SB6A 3N5FA 1SIZA 2BM1A 2DHGA 1RA7A 2VQFF 1SL0A 3EGWB 4OQJA 1QAYA 1VRTB 3H8YA 3MM5A 2ZH1A 4ES3A 2GGPA 1KQFB 5DDPC 2J9EA 4RBTA 1RQ0A 1U45A 3FQLA 4KFBB 3JSBA 1TAUA 2B4UA 1KVJA 2ZNZA 3MF5A 2CFXA 2Q6BA 2X3GA 5EX3A 4X4RA 2C3UA 5KFKA 2KXHA 1HNXF 2MQPA 2A3JA 3PW5A 5KFDA 1C2PA 4OV1A 3NGDA 1RWUA 3LP0B 3OHBA 3KLFB 3GR0A 2HHUA 2HIQA 1VMBA 5K8PA 5IM0A 3C6UA 1VQ9S 4C3KA 4USJC 2PMZD 2F7VA 5HQ8A 4HTIA 2RSQA 4GC7A 5IT9Y 3P3DA 1XR7A 3BN4A 2GHPA 1NH8A 1TV6B 1U1OA 4NRTA 3DLEA 4OZ0A 1Q7YT 3DLLQ 3BSOA 1FERA 4KJIA 3M6VA 1UAWA 3SXLA 1NKEA 4Q0BA 3I0SA 4IH6A 4CT9A 3DNCA 1Q8LA 1AUDA 3BN7A 2G1DA 1V3ZA 4O23A 5B09A 5D4OA 1JMTA 1FJCA 3UPFA 3U02A 1LFWA 1UKUA 2NXUA 1DLOB 1FEEA 1TKXA 1N5YB 3CEDA 2HZCA 4MIBA 2ASDA 4KQZA 3Q8QB 4KRWA 3J7Z5 5F0WA 1PILA 2GW8A 1SJ1A 4Q43A 5L9NA 1MWYA 2MQMA 1NO8A 1H3DA 2J9DA 4O3SA 2IJFA 5J1EA 1DQAA 3K7RA 2ZHAA 1OSDA 2V0NA 2WOMA 4ZPCA 2OPPB 2EKYA 2LLZA 3US5A 2JLGA 5L1LA 1FCAA 2E5GA 4USHA 5KFTA 2A2CA 1U6BA 2MJUA 2BANA 2IRXA 1NK0A 3MFIA 1UVMA 1ELOA 1M5HA 1KFDA 4YUDA 5IXUA 1P6TA 1NJYA 3C46A 3BDPA 3DN9A 2MJNA 1X4CA 2IRUA 4A8MP 4UQTA 3I0RA 4NA1A 3Q8RB 1SUQA 4I2QA 5IT0A 3KJVB 1FJEB 4B3MF 1ZOTA 3DM2A 2WHOA 4X65F 3HHLB 2X1GA 2Z2LA 4I7FA 2PFFB 2IBOA 3M05A 4C9DA 1Z4UA 2QIFA 1F5CA 5KFFA 1U6ZA 2WBMA 1V6HA 2IM0A 3M2RB 2MY8A 1XR5A 3KMQA 1LK7A 2UVUA 5DM6Q 1DHMA 1X4GA 5THWA 1U2FA 4RNHA 4ZVEA 3E2EA 4CTAA 3S1TA 3TVZA 3I82A 4KO0A 3IRXA 2LVWA 2H9ZA 1FRKA 1K1SA 3PW7A 1SJFA 2CIMA 3PW4A 1TQLA 3DI6B 1F9FA 3T3FA 4M63A 3LWLA 3NGKA 4NZ0A 1R43A 4H54A 1TL3B 4DL0C 1QJHA 2IYGA 3T5JA 1GTEA 2D3UA 4V19X 3KLIA 3CD5A 2XCAA 3D28A 2DNZA 4NLVA 1GXLA 4J9QA 1RTIA 4HEA9 2ASLA 2IA0A 3TR5A 3SEOA 2YNFB 1P27B 3NNHA 1FDBA 3NG8A 1R3NA 1TK8A 2JDJA 2LMIA 2KTQA 2CPEA 3ZZTA 3V4IA 3OPKA 2RJZA 5KFQA 5CQGA 3NCPA 2HLTA 3CD0A 5KT3A 3OTOF 3M2UA 5A0YB 2RE1A 1ZAWA 2A1BA 3PW2A 2K3IA 5KT4A 2QV6A 2CVIA 1MROB 4N8OA 2FC8A 1L3UA 4U67Q 2ZE2B 4I69A 2XI2A 3H59A 4FBUA 1HD0A 3HF5A 3DHXA 3GYXB 2Y1JA 4MMOA 2RU3A 1YJWS 5BYSA 4QOTA 3PY8A 2XMKA 1VHFA 5DQGA 3DRYA 1CG2A 2MZ1A 3M8QA 1S1XA 3H20A 4DJBA 1HQUA 5DLFA 5HROA 1SL1A 2R7VA 3FFIA 2A2DA 3NWGA 3V2UC 3PRDA 1VQSA 3JTOA 5K14B 5KG5A 2ZUGA 4H4OA 3BGRA 2PSZA 4Q7AA 3B8HA 1G6BA 4RUAA 3THVA 3P49B 1MSWD 4LF4F 1WI6A 3EXYA 4ITSA 3K5LA 4DR6F 2BE2A 2IVYA 2BDPA 2OO4A 1S99A 3H5XA 5DETA 4IH5A 2R7UA 4MK8A 2HQ3A 4KT0C 1BD6A 2W9BA 2XC9A 2AJFE 1QUVA 1QSYA 4TQSA 4DF4A 4DFKA 2HVHA 1MU2B 1FEHA 3NLCA 4LSLA 4YR2A 3V6JA 4DX8H 5J2QA 1PO6A 5CD4H 2HMIA 1RT5B 3IFEA 1JKHA 4DMZA 1GX5A 2ZKTA 1DBDA 4RWXA 2DNNA 5KFRA 1YJRA 5B0DA 3K8VA 4UUXA 4B02A 1KQGB 5LMUF 2K3KA 3PX6A 1TK0A 3B4DA 1DAXA 2IRYA 1SIWB 3CXCR 2POKA 3E3XA 3ZZPA 2D3ZA 4Z37A 2MZJA 3GWCA 3BGLA 2DGWA 3D2WA 3RAXA 4G6VB 5KFOA 3H4BA 1ULRA 4M8LA 4OZLA 4QR1A 3CCUS 4F4ZA 4ES2A 3IXQA 5SUHA 2FVPA 1UEUA 4RW6B 3I5CA 1KVIA 2J0XA 2O3DA 3DXBA 2WONB 1Q82T 1Q8IA 4H4MA 4F8RA 4RW7B 4YQWA 2XGQA 3VCDA 4LIWA 2J6SA 2XNRA 3ENQA 4XDCA 3WX4A 4A8XA 5C24B 1SKSA 3D0HE 3HP6A 1FXDA 4DN0A 1YJNS 4PUOA 1N56A 2J7KA 2K1RB 3DOLA 3T1HF 4ILRA 4C2MA 2GJ2A 2QMXA 1X5OA 3M2VA 2B4VA 2VKRA 5CCLA 3G8TA 1YHQS 2HHTA 1X5SA 3IG1A 1NK9A 4IFVB 3Q8SB 1Q79A 2MSSA 1NNDA 4ZP8A 3J7YI 3DLJA 1RTDA 4IRCA 3R1LA 4OLOA 4QWBA 5EWGA 5I3QA 4PCQA 5F3ZA 2B4PA 4J9LA 3D1OA 5A8RA 2YX1A 3L95X 2LXUA 4OI3A 3M30A 4IDKA 1HI1A 5C42A 3WC0A 3KLGA 3T5HA 3HK2A 2BW2A 2ZM6F 4C0HA 4RLEA 3HI9A 1RTHB 1JXLA 2FJVA 4C8MA 2ZC4A 1DTTB 1R8PA 4ICLA 4B9SA 4ZKAA 3G6ES 2NQPA 1MMNA 1U1MA 4UY8T 1HYSB 1ZM4A 2YKQA 2CYYA 5G4DA 1PSDA 1XBWA 3TOQA 1NB7A 1VIXA 3JTNA 3QO9B 1S72S 4ID8A 3L09A 1H0HB 1FJ7A 1S1TB 4KB7A 2C42A 3LP2A 1NJIT 2BRLA 5F3TA 2MGZB 3RBDA 4QYZJ 2DO4A 1FRMA 3P6YC 3RZAA 2V4RA 3G4SS 2XG8A 4QIWD 4DOZA 1VQNS 4LF7F 2XS5A 2ZZMA 5J2MA 2V94A 2N7CA 5F9NA 2OFGX 4O4GB 1XR6A 2J7WA 5F8NA 4LUBA 2DT9A 5HBMA 1HBMB 4EBEA 2XB2D 2ZNYA 3GV7B 1J2VA 1KTVA 2E1CA 3OVAA 4RU9A 1S0NA 4CT8A 2XY5A 2XMTA 3CSKA 3RW7A 1IKXB 4OI6A 1HHSA 3THTA 4DQIA 1ZPWX 1IKYB 5KFXA 2FHJD 4K4YA 2O01C 4K5SA 2RDJA 2V9WA 1E6VA 3WBZA 2DPIA 2X1AA 3KYLA 4BC7A 1GXUA 4HI2A 3CJ3A 3T1AA 3GFYA 2WRMA 3POTB 1MW7A 5A8WB 2VFSA 2YX4A 3IR6B 3CCQS 4CO5A 1U1NA 2FLLA 2R7RA 1YVFA 1SI9A 1LW2A 3O5TB 3GIJA 3IWLA 2B6AA 3C6TB 3H40A 2ROGA 3DRSB 2E9RX 4DV4F 1CQNA 1HNIB 4USIA 4FPRA 2FC9A 4G3IA 3NS6A 3R5CA 1T03A 2VASA 4NX9A 4K4VA 3MMCB 2K8GA 1TKZA 2CJBA