2AJ1A

Solution structure of apocada
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
71
structure length
71
Chain Sequence
MAEKTVYRVDGLSCTNCAAKFERNVKEIEGVTEAIVNFGASKITVTGEASIQQVEQAGAFEHLKIIPEKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable cadmium-transporting ATPase
publication title Structural basis for metal binding specificity: the N-terminal cadmium binding domain of the P1-type ATPase CadA
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
total genus 19
structure length 71
sequence length 71
ec nomenclature ec 3.6.3.3: Cadmium-exporting ATPase.
pdb deposition date 2005-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2aj1A00
3HDSA 2ZDPA 4OIXA 5F0UA 4Q2LA 1R6YA 1N5VA 5B0BA 2N4CA 2OD4A 1YG0A 2ASYA 4ZA1A 2W4DA 2G9OA 3HHLC 2GO8A 4Y2KA 2ZDOA 1X8DA 1RJJA 2LQBA 3BGUA 3I9ZA 1KQKA 2IYGA 1XBWA 3TRGA 4F67A 4HH1A 1GXUA 4OJ3A 2OAUA 1X0PA 1YRXA 1Q4RA 3QMQA 2ROGA 1OQ3A 2FTRA 2RU9A 1YJRA 2BJDA 2JDJA 5B0GA 4Y2MA 1K0VA 1CC8A 3UDCA 3FGVA 1Y0HA 2W4CA 1AFJA 2OFGX 2QYCA 5B0EA 5B0AA 2AW0A 1TR0A 1TL5A 1Y9OA 2HIQA 3KKFA 4NPOA 2KT3A 3FRYA 3MZIA 2HLUA 2LXFA 4ZOSA 4HL9A 2K7KA 2N4DA 2RMLA 5B0CA 1FVQA 2BUNA 2EW9A 1APSA 1S6OA 1S6UA 2QIFA 5IXUA 2Q3PA 1URRA 2OKQA 2PGCA 2W4PA 2QLXA 1OSDA 3FMBA 3LGMA 5B0FA 2LQ9A 1KVJA 4EFAC 2FIUA 3BDEA 1P6TA 4QOTA 3BR8A 4A4JA 1U7LA 1ULRA 2HFOA 1AFIA 1YJUA 4HH0A 4Q2MA 2PD1A 1SI9A 5B09A 3DXSX 1SQEA 5KAKA 2AJ0A 3LO3A 2XMTA 5B08A 3K7RA 2HQIA 5A6WA 1IUJA 2HLTA 2KYZA 5T7LB 3LGNA 1Q8LA 1TZ0A 2K1RA 2OP5A 3HHLA 2RSQA 4FNIA 5B0DA 2AJ1A 1N5TA 1MWZA 2FHMA 2KKHA 2ROEA 2XMJA 2N7YA 3DCAA 3BF4A 1JWWA 3HF5A 3MCSA 3HFKA 2GV1A 1Y3JA 2AP6A 2FB0A 2K2PA 2RILA 4A48A 2HFNA 4A47A 3VTIA 2K1RB 3KNGA 4Y2IA 3HHLB 4DL0C 1TUVA 2ACYA 2ROPA 2QLWA 3KG0A 1LQ9A 1X7VA 2XMKA 2VH7A 1FESA 2CRLA 5T7LA 1VQSA 2XMWA 2OMOA 1FD8A 1V3ZA 2GA7A 5F0WA 4NL5A 1OPZA 2IFXA 1AW0A 4YEAA 3CJKA 2IYIA 2GFFA 1JK9B 3BM7A 4OJGA 4OJHA 4FNHA 1P8GA 1GXTA 1N5SA 1CC7A 3E8OA 1YJVA 2GCFA 4DN9A 3WDOA 1FE0A 1Q53A 4YDXA 3TNVA 1FEEA 2BJEA 1FE4A 2BBEA 2BYCA 1Q8BA 1VQYA 3IWXA 4HI2A 2L3MA 2K7JA 3GZ7A 3TOQA 3HX9A 3CJKB 1KVIA 4OJ1A 1YJTA 2XMMA 4U9RA 2XMUA 1WD6A 1SB6A 3HHLD 5K9FA 1OQ6A 2GGPA 2LDIA 3BB5A 1CPZA 3IWLA 1MWYA 3KG1A 1W2IA 2VV5A 3QGPA 4HI1A 4DPOA 3T9NA 3BN7A 2XMVA 1FVSA 1TL4A 1QUPA 5A6PA 2OFHX 3F44A 2OD6A 4A46A 1Y3KA 1N5QA 2GGPB 2KT2A
chains in the Genus database with same CATH superfamily
2I6WA 5CZXA 3MD1A 1HFEL 2XHWA 4WZMA 1VQ7S 5KG6A 1PKUA 1Q81T 4CO2A 3W65A 4C0OC 2R3VA 4ILMA 2FHOB 3KDNA 1YSJA 4DL7A 1D9FA 4Q43A 1IQZA 1F3VA 5CQGA 3NBPA 4NLUA 3NKYA 3QT8A 3HT0A 3K5OA 2I8EA 2RSQA 2F8EX 4QZVB 5ETKA 1JWWA 4CT9A 3PRDA 1SL2A 4L3KA 2XS7A 1FD2A 2E1AA 1YJNS 1OJ4A 2AWZA 4H4KA 1NH7A 2GJ2A 1G3OA 5BYQA 2RS2A 4ZVTB 1NK5A 3ZZYA 1YGYA 2ZH4A 3BKUA 1NLKL 4IFYB 5EX3A 3M8YA 2DRAA 4TNOA 2XY6A 2VHGA 7AT1B 4DG1A 4UZBA 3D68A 3PV8A 1XEZA 3MTJA 1JJHA 2PFDA 1KWMA 1NUEA 2W1BA 2JEFA 4ZLLA 4DR6F 4RWXA 4RW9B 2M8DB 5C2GA 2LECA 1JLEA 2LEBA 4O44B 2V4RA 3DLEB 2YPZA 3T19A 3MEGA 5KG7A 2IAJB 3IBFB 5GAHI 5FLXY 3CJ4A 4B3OA 3A8KA 5G0RB 1RWMB 3G8TA 5HBMA 3N9UC 5C5JA 4V1Ak 4C8NA 4DN0A 2F7VA 2FHMA 3BF4A 4YMEA 3MWBA 3CCZA 3ETMA 1LWFA 1R27B 3ZZUA 2EG1A 4NRTA 2XMWA 2DCUB 1IXKA 4BBYA 5KFNA 3W2VB 4IO9Q 4OZ1A 2V2ZA 1SKUB 3M4XA 4DL5A 4I6WA 3KXDA 2IY5B 3TX0A 5KFMA 3BQ2A 2DYAA 1U0SA 2CQ4A 3D1OA 3MMBB 3KLHB 3OL6A 1HNIA 1VRUB 4OHXA 5B0GA 3DOLA 5HLFB 3TI0A 1NHUA 1FJEB 4HDGA 4O3RA 2N3OA 1WC4A 1S6OA 2C2KB 5KFUA 2OPRA 1FTRA 3UDLA 3I9V9 3CJ8A 4X4NA 3LTOA 3QPIA 3I55S 3ISND 2B4UA 1FKOB 1TZ0A 3NG8A 3HHLA 4C3KA 1WEZA 4IRCA 2DGOA 1T0TV 5F8MA 4NLXA 1RT2A 2O5DA 3BZQA 1SH2A 1J5EF 3JAMY 3DLBA 5FDLA 5D4OA 4OHYA 5KFXA 4FNHA 2BOPA 3EM1A 1NSQA 2CNKB 1NNDA 2XY5A 1UMJA 2XMMA 4U9RA 4ES3A 2E5LF 1CULB 1RABB 3OTCA 5J2NA 1MWYA 3CVKA 3CJ5A 5D77A 2R42A 4DQPA 2HNDA 1FJGF 4EI2A 1T05B 3DLJA 3I87A 2Z8QA 1EQMA 1SC1B 2G13A 4W98A 1GH8A 4PWDA 3VAHA 2UUCF 2RF2B 1MROB 1RT5A 5F8GA 3Q23A 4USIA 2WSEC 5IOLA 5I3PA 1SL0A 3G6YA 1RHJB 2EFOA 1DY3A 1WC0A 3PJWA 1ZPVA 2W25A 2MXYA 1LW0B 3D2WA 2Z0GA 3FCVA 3AA9A 2HGNA 2ZC3A 5HQ8A 3K57A 2DHHA 2I5JB 3FFIA 2BVZA 4RW7B 3I0RB 2HMIA 2MQOA 4TLRA 2AF6A 1D1UA 3SI8A 4FBTA 3W1YC 3J80Y 1WSVA 2RB7A 2E1MC 4OYMA 4USTA 2ASLA 2Q1LA 3W5YA 1Q95G 5KT7A 4NLWA 1P1LA 2MKJA 3L3CA 1OY6A 2GIFA 2W9BB 1Y00A 2VA3A 2R2RA 2HNZB 4WFZA 1TUGB 3QT6A 3W64A 2CG8A 3W3SA 1Q8KA 3SQGB 1RAEB 1RYSA 2W2PP 1LOUA 1S48A 2B9WA 3QBCA 3T1YF 1JLCB 1QAYA 3EUNA 4CCHA 2K2PA 3DLKA 4JB8B 1XC9A 3UVJA 3GFXA 4LF7F 3I31A 1IKXA 5AJ3F 3C6UA 2Q6BA 1S1WB 4PRFA 3B4DA 4USVA 4J9MA 5F8NA 3TNVA 3BREA 1RADB 3DDIA 4GC7A 4M5LA 4DV2F 3JSBA 2ZH7A 3GJRB 4FF3A 4LRFA 1CJVA 2XY7A 4MFBB 2B0GA 4DX6A 3CF5Q 1SVDA 1B64A 1JX4A 2C3YA 2YWEA 2DGUA 5I3UA 1NCLA 1JLBB 2BOAA 4NZ7A 2XLIA 3MR2A 1FWPA 4J9NA 1FKPB 4EBDA 2IBKA 3TEHB 1L3KA 3HVRA 4DUZJ 5GMDA 3OFGA 4JI2F 3AA8A 2HLUA 4N7TA 2OPSA 4UQTA 3Q2TC 4KHRA 3OTEA 2HHHJ 5CYQB 1PAEX 2HNYA 5E3CA 2LQ8A 2YKMA 1FWKA 1VQ6S 4JBCA 4Y2CA 4NYPA 1RTHA 4RX6A 3MTKA 2JFDA 1QLNA 1TELA 4WU2A 1TKZA 2MQPA 3IM9A 4ZLJA 2BJ7A 5ETPA 5C25B 4HTIA 3CMAS 2VU5A 3DU5A 5EWEA 3HKWA 2WOMA 3IO1A 4NEYA 4PZVA 1SJRA 3J7Z5 2YKAA 1H7XA 1UP1A 3M05A 1CVJA 1VQYA 1IR1A 4GO5X 2FVSA 4OL8A 1Y10A 4KFBA 3FDSA 2XO7A 5J1EA 3BS9A 1YHQS 4WFNQ 3RRHA 4URQU 2I0XA 2KFNA 3V6DB 2WSFC 3W8PA 1TQLA 4IH7A 3MM7A 1S0NA 2L08A 3CJ2A 3KJQB 1LK7A 1RHMB 1VQNS 4WFBQ 4LFCJ 2OFGX 3DOKB 4ECWA 4PG6A 4ZP6A 4ECSA 2VBZA 3MM8A 3OUYA 1UJ5A 2IRXA 4EFAC 2KN4A 3PJ9A 5B09A 1C0UA 2OELA 3R5JB 5E41A 3BN4A 1RAIB 3POTB 2W7PA 1ZPWX 2Y0SD 5GADU 5L39A 1TVRB 2IM2A 4R5PA 3BSNA 3C66A 2KH9A 2DNGA 1H38A 2COLA 3MM6B 3U1NA 1OY8A 2PDAA 4MIBA 4L73A 1IJFB 2HWHA 1U1KA 4DFPA 1S49A 4JI5J 2M88A 2A10A 1J5OA 4F02A 2GGPA 4QPTA 4E98A 2ZBPA 1C1CB 1FFGB 2UV8G 2ZUGA 1ICEB 2NXUA 3VGTA 3Q8QB 5E3RA 2LCWA 3T1AA 1WKLA 2EC2A 4TU9A 4AL7A 1X5OA 2B8PA 1H2TZ 2R8IA 5A8WB 3KLGA 4RZRA 4YQWA 1NK9A 2NYHA 2Q79A 1URRA 3LGMA 1U1RA 3AB4B 3Q22A 1ULRA 4OMFG 4P71A 3WIVA 1SI9A 4U7CA 3HJFA 3H5SA 3G8QA 1F9FA 4ZPBA 2BDPA 3UCZP 3NS7B 1FNMA 4KGVB 4OYAA 2HEKA 3B82A 1RA7A 2OPQB 3BV8A 4M5DB 2MGZB 1TL1A 4OJGA 5IV3A 3BR9A 5HK4A 1FE4A 1FRKA 2ZITA 4ECZA 1L3VA 1NK6A 2ILYA 2KFYA 2G4BA 1CJKB 1S72S 1HBNB 2CXEA 2BEFA 2LU2A 1Z2LA 2I38A 2EK6A 3CCWA 5HSPA 1SC3B 1BC6A 3RBZA 7FD1A 2F4FA 5C24B 3AHPA 3TVYA 3R7BB 3SCIE 2M0GB 3NGRA 3I4PA 1U24A 4DL6A 1XNRF 4QIVA 4F25A 1U4BA 1DRZA 1GFWB 1Y11A 3KWMA 5C42B 2VFTA 3PW2A 3FKBA 5B0CA 3DGPA 3PYEA 5ETOA 9ATCB 5A8RB 2GMHA 3K8WA 1VLYA 4A4JA 3OXLA 1AFIA 1F60B 4NA1A 2FZCB 1LV5A 1CQNA 4MTPA 4NXNF 1T9YA 4KC5A 2KYZA 1Q79A 5K20B 1S59A 3JYTB 3MUVP 5AE2A 2DO0A 1EETB 3LQVA 5CH7B 1MU2B 3JSYA 4OX6A 4QWCA 4EBCA 2OHDA 2PMHA 3DYAB 2JLFA 1PCAA 3ZFVA 1NKEA 3FSIA 3TOQA 4ZLPA 3MPDA 1HA1A 5LXRA 3F41A 2FGCA 4DV4F 1X5PA 3PYDA 3US5A 1UEUA 4C7QA 1UWBB 3CXCR 2J9EA 2DNKA 3ENQA 4UOGA 2A3JA 3H42A 1DHMA 2XGPA 1ELOA 2MQ8A 3PW4A 3OSNA 2UUAF 1JLQA 2J6UA 2AMCB 3GMGA 3QRRA 2RNEA 2B51A 5A2QU 3KFWX 3QJLA 1GMWD 4DCPB 5JXSA 4QPXA 3RRGA 1YLXA 1RWOB 4RW6B 5AE1A 4KHMA 1R89A 1SQFA 4IG3B 2ROEA 4ZVRB 2QLBB 1EP4B 3TZWA 2NZCA 3IS9B 2M2BA 3P49B 5KT5A 3SDEB 4MYUA 2PEBA 4AQYF 1KTQA 2V0NA 3HPOA 3KLEA 1VK8A 2OPPB 4DQRA 2PO4A 2ZH1A 1V5IB 1VCTA 4B9SA 4DUYF 3T9NA 4QYRA 4GC6A 2A6OA 3MGJA 5F0UA 3AD8C 1KQKA 3DLLQ 2G0JA 1UA1A 2CA9A 2GVDA 5HMZA 1HNZF 3A4TA 2BXJA 2ZJPQ 4NLRA 2W2QP 2AW0A 4FYWB 2RRAA 3IRXB 4DS5A 4M5IA 5CYJA 1M90T 2BE7D 2GVZA 2FVRA 2ZVSA 2QSWA 2IJRA 3ICLA 2L9NA 2CPFA 3MFHA 1AUDA 5GVQA 4GKKJ 2CJBA 5L38A 4GO7X 3OR1B 4A47A 4DV7J 4YR3A 4Y2IA 2LFVA 4I7FB 1RAOA 5F0WA 4ALZA 1N5YB 4X65J 3M7VA 2CJQA 5K8PA 3MEKA 4I4BA 3KJNB 2JJ4D 4DPYA 4HT5A 4URGA 1SIZA 5KFTA 4LJMA 5RUBA 2EG2A 4LFAF 2RDIA 3CCJS 2DR7A 1RWNB 2WVEA 3H20A 2WVCA 1FEHA 4DR2F 3CIZA 1WACA 2IA6A 1HQEA 1CG2A 4ZVSB 2FJWA 1CS4B 3VV2B 2KM8B 5KFEA 1U26A 4FS2A 5D15A 4P73A 1IBKJ 4OZ0A 2MTLA 4DS4A 2FVQA 3R7SB 1VQMS 2OMLA 3NWRA 1NK8A 5HANA 3MAHA 4M8LA 3K17A 4JI3F 1HNWF 2R7VA 3RJMB 2JC0A 4ATNA 3PO5A 4IOAQ 1JXEA 1B4SA 3TJ8A 1RXOB 3TVZA 1FFWB 4X66F 2C2EA 4OI3A 2IM0A 1X9SA 2OJ3A 4DQSA 3HP6A 2YX4A 4Q7AA 3KNAA 3A1YG 4TYAA 2UUBF 3RB3A 3D0HE 1SL1A 2JLGA 3OD2A 2RT3A 2ZDPA 3A8EA 1JKHA 3HD2A 1T9XA 3LPEA 2MQLA 2CQHA 1XERA 2IHR1 4F67A 2H5IB 2X3GA 4QIEA 4KKOB 3HD1A 1JXLA 3DLGA 3P6YC 1UVJA 5JUMA 3U27A 2Y8WA 3MEDA 4DQIA 3MUMP 1DQ9A 4LF6J 5HMXA 3GV7B 3BR8A 3H4BA 3J81Y 4X4PA 2DISA 3FNNA 4C11B 3K7RA 4A8OA 3QSYB 3WX8A 3RBDA 3NMRA 1OY9A 4NASA 1NSKL 4XPEA 3W5XA 2KM8C 4IFVB 3QJPA 5DZ6A 3KMSA 3OL9A 3UD5A 4LIWA 3D9BA 2JHEA 4OX9F 2E9ZA 4DBQA 3T5KA 1XTZA 3DFEA 4NYZA 2Y1JA 1RHUB 1R0BG 2LQ5A 2V4JB 1EAYC 4OYIA 1SUQA 3BO2A 3NOGA 3R6LB 4QU7A 2DGXA 5KFRA 3ZXWA 1Q4RA 1HWIA 2FD2A 4USKA 4FPIA 3UN3A 2NQPA 2JRSA 3UR0A 2HQGA 2HG4A 3EXYA 2DR9A 2JEGA 2NXCA 4O4GB 1RT3A 4J91A 2YVSA 3QIPB 4NX9A 1RBLA 5HROA 2KO1A 1NSPA 1RLDA 1VMBA 3PDNA 4ED1A 1XWLA 4F36A 5DM7Q 1MMLA 5CCLA 3CJ3A 2DY9A 2AYGA 4CLKA 2C2NA 2XSJA 5HN0A 1S4FA 1YJTA 3GG0A 2DGTA 3DN9A 3V6HA 5LSLA 2JX2A 1JB0C 1HWLA 2QSFA 2RAQA 3R8YA 1X0FA 1E6VA 2MLYA 1TUWA 4LSLB 3UE2A 2NZ4A 4M5GA 3AJ2A 1HNXF 2Z56B 1FT8A 3TA0A 3QJJA 3AT1B 3NY0A 4ZVEA 4ZHRA 3KLFB 1PO6A 1FHTA 1IKWA 5KFWA 2ZJQQ 1UFLA 4HT7A 3LANA 5DG8A 3OR2A 3Q2SC 2QL9B 5L8RC 4DV0J 5BJRA 3NAHA 5L9XA 4X62J 2D3OR 3G82A 3AD9C 2IVFB 3QGIA 5DZ7A 3BBBA 5T7LB 2KT5A 2HFVA 1UKUA 1HHTP 3DXBA 5KT4A 3BO4A 2K1RB 4OQJA 5IM0B 3DMJA 4W4MA 1NB7A 1DBDA 3EDQB 3ELHA 5H9EK 2DHAA 2DHXA 2R9LA 4TY9A 2ZBIA 2XGQA 4C8YA 3CC2S 1H3DA 5CA5A 2DIUA 1KQGB 2VDHA 4I56A 4NMXA 1NZAA 3I9ZA 1D3WA 5CYMB 4DR1J 4HEA9 2BJDA 4JI4F 1BGXT 4GRSA 5IT4A 2HHSA 1HBOB 2QFIA 5H9EJ 3DRRB 4UOCA 4BHQA 4DFMA 4ED6A 1EX8A 2QG9B 3MMCB 1TV6B 3AOBA 1O0PA 4TYBA 3BKTA 4P6QA 2XC9A 5ADZA 3NS5A 1NDPA 1JJCB 2YKQA 2DGQA 3P5BP 3H7HB 1MNEA 1REVB 2ACYA 3HJVA 4UQGA 2JZ5A 4HVZA 2GQ2A 4DSFA 2CJYB 4E8UA 3OJUA 4DX5A 1NJYA 2PIIA 3EPIA 2DK2A 1FO1A 3A13A 4USMA 3R97A 2KVQE 1YJ7A 1U1QA 3MMAB 4WBFA 1G1XA 1U1MA 1S1UB 6FD1A 3L95X 4IFYA 1R0AA 3NCRA 3BGFA 3H5UA 5L9NA 3VQSA 2E1RA 4IDKA 4P7VA 2K8GA 1YX2A 3I32A 2FQQB 3ILLA 3PRBA 4DR3F 2VONA 1Q8IA 2RU9A 5GAEI 4YP3A 1JLFA 3VZHA 3T1HJ 4CWBA 1FX2A 3HHKA 1HWUA 3THPA 3KOAA 2GHWA 2VFVA 2DO4A 2PMWA 5LMNF 2EW9A 1APSA 3PW5A 1W26A 1OSDA 5DJBA 3MAQA 5IQQA 2BX6A 4O44A 1NU4A 3DRPA 3DLEA 3U02A 4B3SF 4I64A 4C0HA 4LBPA 1SCJB 2J9CA 3TQ1A 3O6QA 1Q7LB 3PHEA 2HZVA 2JVRA 3F73A 2CQ3A 3DOMB 2V2VA 3R5BA 2YWKA 3L7OA 5F8IA 4JI6J 4BWMA 3HX9A 2L48A 1RT4A 4JV5F 4CTAA 2AGQA 4KHPF 3PACA 4HDHA 2DHSA 2KU7A 5A6WA 1RTDB 1X9WA 2AGPA 1S9GA 3TO8A 1FRHA 5KG1A 3WQPA 1CQMA 3D1HA 2H4YB 3GFZA 3G9CA 3N28A 2UXDJ 1LW2B 4CO4A 4ECYA 4LQ3A 1N32J 1FVQA 3CD0A 5IXUA 3ENAA 3BDEA 5HLFA 2LLZA 2AV5A 1Q82T 1YWXA 2LDYA 2GS8A 1OMSA 2RKIA 3TANA 2CQBA 3CCES 2N3LA 3PNIA 5K8MA 3CCQS 4USWA 2DD8S 1YRTA 3RYLA 2B7CB 5KFKA 5DG9A 1CJTB 4K4ZA 3KUGA 2MLZA 4ECTA 4ELUA 1A7GE 1FKOA 3PVXA 2BMBA 1H74A 1NO8A 3CJSA 2F3JA 2BYCA 4ED4A 4IRKA 5KG5A 5K9FA 1RBAA 4J9LA 2OO4A 4ECVA 1LWCA 3N01A 1BWEA 4ID5B 4ETZA 2CVEA 3M32B 3I4HX 1IN0A 3WBZA 4WXWA 4B3MJ 1EIYB 2IYGA 3TQEA 3B8HA 3TEGA 2HVIA 1T05A 2BM1A 3FGVA 2KT3A 3QAUA 3V81B 1DURA 2AJFE 3EZ5A 1IBLJ 2HFOA 4DWIA 1MMNA 2YNGA 2C2MB 1UVNA 3D66A 1M5HA 1QAXA 4YOEA 2N7YA 4C2MA 4ZS6A 3GYNA 4X4RA 2PSZA 1N0UA 2F40A 4EO8A 1NSAA 1M5PC 1T9UA 2XMKA 3T5HA 2EFNA 2I9SA 1T3NA 2H65B 1IKYA 3MPUB 1B7YB 5J1PA 1RT6B 1NXIA 1I94J 4C8OA 2XYPB 3RW6A 2PN6A 2FJAB 5HAOA 2HAIA 1U2CA 3MEEB 2FLLA 4DR4F 2RVJA 2LA6A 3GTYX 2IJNA 3JSMA 3I0RA 2W9CB 2HW3A 4WJBA 2F4VJ 1VLOA 2YH1A 1NBEB 4Q0BA 2LQBA 3NGKA 1XBWA 3K59A 2V8DA 3AAWB 5KOWA 2ERRA 4Y2MA 1HNVB 3X3UA 3HCXA 1RE1B 4M5JA 1HI0P 2VOPA 2WONA 1HQUA 4ZVPB 4UUWA 3GIMA 4P2XA 3EWGA 5L1IA 4O3QA 3Q8YA 2YNIA 4MIWA 2HNZA 2VB6A 2ZE2B 5KFFA 1U6ZA 4YY3F 4X2BA 1LWEA 3SQGA 2FY8A 3NNCA 2O3DA 4IOBA 2HBYB 3NOCA 3EYZA 2QMUB 1U0HA 4DSKA 3FJ2A 4FF2A 1T3OA 3L4BC 4BS2A 4KRWA 1VRTB 4FN5A 1NDCA 3VALA 1GX6A 1FDDA 1C1BB 1KHWA 4NA2A 4M5NA 2AZ1A 2FLPA 2CPIA 3N79A 4FF4A 1ZM3A 4KTQA 2PI4A 3JSRA 1N5QA 4Q8FA 2DRBA 1VBZA 1RBOB 1UVMA 3TR5A 5A8KA 4P72A 4MFBA 4JI0F 4WE1B 2FGOA 3UDEA 3CEDA 1FERA 4DX8H 3TZZA 4DR6J 2B4PA 4KH0B 1IKVA 5J2MA 4C97A 3CCVS 1C0TA 2QLFB 3ZTPA 4NA3A 3RTVA 3HK2A 1BQMB 3V6KA 3IC1A 4ZCKA 4ZJLA 3I0SB 1S9FA 2HHVA 3B54A 1YZ6A 1R7IA 2VL1A 1PYTA 3FCWA 2AU0A 4PQUB 2HGMA 4GVBB 4R8UB 2XMJA 1FRLA 3HF5A 2MKIA 1SBRA 3PO4A 3M30B 3A3PB 1RTZA 4DFKA 3P8BB 2CQGA 1OPZA 2EVZA 3FZ2A 4FZVA 2HS3A 3OW2R 4O3NA 5JMNA 1CPZA 5D3GB 2J0SD 3OFFA 1AROP 4XAKA 4C4WA 1SC4B 5AXLA 3GR0A 2ALYB 3UD3P 2G0CA 3CJTA 3DI6A 2OAUA 3EMTA 4G1IA 4X64F 4LRBA 2B9XA 2YPYA 1X4CA 3IBWA 4LR7A 1XNQF 1LFWA 4L76A 3SFGA 3KJVB 3E01B 5B0FA 5KFVA 5T41A 4HTJA 4LR8A 5JVHQ 5J2PB 4RW4B 1QSSA 3ZTRA 4I2PB 3QRQA 3FC9A 2AEMA 3KDOA 4IQMA 3BBCA 3TWZA 1GNKA 4G6VB 1HI8A 4LBIA 3M8PB 2RQKA 2HWIA 1X4DA 4YB1P 1K73T 1J5EJ 3EVMA 3PW0A 2ZH2A 1AB8A 1AW0A 3JQJA 2ZHOA 1YJVA 3SFUA 3W62A 1SJ4P 3WC0A 5KOXA 1MN7A 3MM6A 1S6QB 2E5LJ 5LL6d 3LAKA 3DDNA 2OFHX 1FJCA 4ED8A 2OTLS 4TQSA 1X5SA 1FJGJ 1GX5A 2R7XA 1DTTB 4R25A 5I4MA 4K4YA 3L7PA 4C8MA 4B9NA 2DVIA 2VJVA 4B08A 2UUCJ 1QTNB 1H7WA 1W2BR 3W8GA 4HR2A 4EGLA 3U7JA 2V8GA 1HD0A 2ZNYA 4ZVQB 3CDAA 2FJDB 4EUVA 2AYBA 3J7YU 2HSEB 2XMTA 1JLAA 2KG0A 2DTJA 3AD7C 3FSXA 2DH8A 4PG8A 3LUYA 1KSPA 4OV1A 3PKYA 3UCGA 3O3LA 4N5SA 4RNOA 2Y9HA 4PABA 2C2ZB 4ILLA 1VISA 3GWCA 1RT1A 2H54B 3R27A 2OPQA 1F9HA 3VF0B 3ZZ0A 3R5CA 4M5DA 1RWXB 2MGZA 1NB2A 4WU3A 3AQOA 2CQCA 1X4AA 1AXQA 2UXCF 1WC5A 2F65A 3ETOA 3UR3C 4DG1B 4NCBA 2CAJA 1RJJA 1I6JA 2AYEA 4DPUA 1CJKA 1HBNA 1HHQA 4ZK7M 4ECXA 5J2QA 1K0VA 4EBEA 2G2ZA 2HPUA 5CD4A 2AD9A 1B7FA 1HMVB 2VG5B 1KHVA 4JV2A 1VC0A 2RQMA 1AZSA 1JLEB 2C42A 1PJ6A 2V9KA 1HHSA 3KLIA 3MEGB 3RBEA 5IS2A 4ZN3A 5C42A 3HT3A 1WOPA 2R2UA 2V5HG 4B3OB 3UI3A 4ED2A 3T1YJ 4L6V3 2YNHB 4OYZA 1U1OA 4DV1F 4FF1A 3ZO7A 4LF7J 4OYWA 3JYTA 5AJ3J 1U09A 3HVAA 4DPXA 3BM7A 2EWHA 2ATLA 3CD5A 3LF0A 4PPDA 5HL7Q 4JP8A 1I51B 4DV2J 2M70A 1SB6A 3MM5A 2V2KA 1RT7B 4HHHA 5DDQC 1IR2A 3CCRS 1HBUB 1UL3A 2YBVA 4FYYB 2DB1A 2E7XA 2GO8A 2VG6A 2YWHA 3OLBA 2YH0A 1EARA 2WK4A 3UNGC 1YRXA 4ZVOB 4USHA 1HNIB 4F04B 4H4KC 1TP7A 1KS2A 4RL1A 1F2GA 3I56S 3C6TB 2V68A 3DOLB 4JI2J 1U2FA 2ZKTA 3BPDA 3QZ8A 5GAGU 2D3O1 4P7TA 2LXUA 2LYVA 3VHQA 4QW9A 1VIXA 1DQAA 2VFUA 4K2JA 2OPRB 5HATA 5KFCA 1P9QC 1NJIT 2E5JA 1BHNA 4ITSA 4QJVA 3HHLB 4HACB 1N0VC 2XG8A 4ZIVA 4NRUA 4E0DA 1RT2B 2RRBA 1MLAA 4F2RA 1XIQA 4A8XA 3IS9A 3A3NB 4XTTA 2J6SA 5FDLB 4MYTA 2Z2LA 1RWUA 4TN2A 2FDNA 2VBWA 1J27A 3SDEA 1F3FA 4B9LA 3R2DJ 3M2VA 1Y3KA 1ZA2B 4I6YA 2VFSA 3D6MB 1LXNA 1TKTB 1FRIA 5ETNA 3CO9A 2HWTA 2W8KA 1P1TA 3S01A 2HVHA 3U1MA 1GMVA 1RTJA 4JYAF 1WDTA 2YXLA 2V50A 3W9IA 4PWDB 1RT5B 5IWAF 1PGZA 1T8EA 4EO6A 1M5KC 5D4PA 2MKKA 1JLGA 4B9UA 4N41A 4JUZA 1IR0A 4IH5A 3MM9B 4KPCA 2C22A 3AODA 2RRNA 1VQ8S 3VCDA 2ZNZA 4NWBA 4KGKA 1I5OB 2DBBA 3PM9A 3RG6A 4Y0FA 2AP6A 1SKWA 3HI9A 2FVPA 4CI0B 3OXFA 3D4JA 1VHIA 3CCLS 1YRUA 1M5SA 2C2RA 2IBOA 1U1NA 3FFIB 3HHLD 1TK5A 5ETRA 1N5YA 2HMIB 2UXBF 4FXVA 3VQTA 3HHLC 2BQ3A 1WELA 3W60A 3Q0AA 2BQUA 4LF4F 4IR9A 4CM0A 1B0PA 3OFEA 2UVWA 1A0OB 1N33F 2M8HA 4Z2XA 1F5BA 4ELVA 3PR4A 1KN6A 1FXDA 1VI7A 1O51A 1BE4A 1GQEA 4KQZA 1G2EA 1TU0B 3GU0A 3RB0A 2QA4S 4E2FB 1CS4A 1YJ9S 1Q16B 2HQIA 3IXQA 4OLPA 1G6BA 4N8NA 3LPYA 4Y28C 5GAHU 1WHWA 5EHHA 3NLCA 1WEYA 1WG4A 4B9TA 2IIHA 1MN9A 5A0YB 3DRXA 3PKMA 2ZD1A 4CNYA 1ZAVA 1HWKA 3QNWB 1WHXA 2FZGB 4QYZK 1S1TB 4OJHA 3C3LA 3KK3A 3C6UB 4TLQA 1ITPA 4WYLA 4TY8A 4PYDA 4LRDA 2Y3YA 3IG1A 1UAWA 4DCJB 2VV5A 4N56A 3OHBA 3JAMU 1V3SA 2LMIA 2V34A 4KB7A 5K8OA 1H2VZ 1FCAA 2ZBQA 1CJVB 4RLEA 2JNJA 2Q66A 3LWLA 5F3TA 3DDKA 2DXDA 5IT9U 2GAHC 1LKZA 4QYZJ 5I3UB 3DM2B 4J9PA 1U45A 2R7WA 3PX6A 2JWNA 5HVGA 1XNRJ 2UP1A 4DPTA 3BSAA 2FLNA 1F2HA 1M1HA 2WB1D 4K5SA 2KTQA 2ILZA 2J0WA 4LT6A 1QVGR 4AL6A 4EZ9A 3ZZTA 4OV6A 3PIPQ 2W4PA 2MB0B 5DGAA 2OPSB 1M5OC 2UU9F 1MMDA 4DV3F 3IM8A 4UT4A 2HNYB 4AXJA 1HPZA 5F8HA 2PFFB 2YKMB 5IT0A 4NXNJ 4ANDA 1SJFA 2CQ0A 2FHKA 2RHQB 1RTHB 3CE8A 3BSCA 1XMQF 1IBCB 4MAKA 4FVCA 2QZ8A 5HVFA 2EK1A 2E29A 4I69A 4X4SA 3TA1A 1N5SA 2WOMB 1Q53A 4FVMA 2KL8A 2GHPA 2KB2A 1Q8BA 1C4AA 1UETA 2PA8D 5DDOC 1S0MA 2QE5A 2CQIA 4CDIA 4DV4J 4UF4A 4KFBB 1UWAA 2CNLB 4Y2KA 2ZDOA 1NK7A 2Y1LB 4WF9Q 1WSRA 2XEXA 3QRPA 1OQ3A 2YNFA 2V4JA 3Q86A 3MM7B 4WFAQ 1N56A 3J80U 4NPOA 3IR6B 3DRSA 2UUAJ 4H4OA 2D7SA 1WORA 3PHTA 6AT1B 3MM8B 2FJVA 1U7LA 2JH3A 3H8YA 2C2DA 3W2WA 4LF5F 4CNZA 3MR5A 2Y0BB 1PG5B 3Q8UA 1KQFB 2EBEA 1WI6A 1Q8LA 1HL6A 1C0UB 5J1NA 2QLJB 2XYGB 2GV1A 3N0VA 1N6QA 2VG7B 2E5GA 4O4GA 4H4MA 3KNGA 3CNQP 3NCPA 1K1QA 1WUUA 4AT1B 3GV8B 3QSIA 4R5PB 2CPJA 2X1BA 2GIQA 4C0BA 2ZHBA 1PILA 2K06A 2RDDA 4AQYJ 5HI7A 3TX8A 3JQMA 4DL2A 4LRAA 2WCXA 1S1XA 1R43A 1OQ6A 4QU6A 4CM2A 4DUYJ 1RAAB 1J5OB 2QMXA 2GGPB 2XMUA 3GFHA 4ZJQA 1N5VA 4U96A 3S7RA 2JEIA 3H59A 2CADA 2GZOA 2IM3A 3WX4A 4NLPA 4J90A 2L9WA 2JL9A 1HNZJ 4MKYA 2QYCA 1IQTA 4B3TF 3KKFA 1S97A 3H4DA 2IA0A 4KO0B 3ENVA 2P6SA 2ACMA 3R7NB 3E3XA 2VPYB 2QLXA 3C19A 1PC4A 1FXLA 2PE8A 2B5JA 3M6VA 1X31C 4WXOA 2R8KA 5H1SV 2E5HA 3BYRA 3MDFA 1WDDA 3BH7B 3FQLA 1U2RA 5IT9Y 1UVIA 4MIAA 2NSBA 1KBRA 3QFHA 3IMQJ 2W2NP 5T7LA 3ILJA 3G87A 4P75A 1QE1A 4DSLA 4M5KA 1TL1B 2HZCA 1NM2A 1DTQA 3O8WA 1OS5A 4Y3CA 1RAGB 3K89A 2XCPA 3KMQA 4ZVFA 4TKTA 3N6NA 3QGHA 1QTMA 4LFAJ 4F4KA 4N77A 4CLTA 2ROGA 2FTRA 1IM4A 3HO1A 4DR2J 2H5EA 3CSKA 3UO0A 4QBUA 5CYMA 3M1VB 4XDCA 3ULHA 3CDUA 2CZVC 2K7KA 3N4WA 4YB7A 2IVYA 1SH3A 3H0PA 1ZAWA 1HBOA 3DGPB 3KHLA 3DRRA 1VC6A 4QIGA 2E9RX 1S9EA 3GE9A 1U8SA 3MMCA 4F2SA 4TXSA 1TV6A 4ZVGA 2ZH9A 4JI3J 1Y3JA 4LF6F 3ZNJ1 1HNWJ 3MR6A 4LQ9A 4DU8A 3FBFA 1DZ5A 2VD3A 4P2MA 4CLYA 8ATCB 1UPMB 4X66J 2GAGC 4MJKA 3E8OA 1UJ4A 5GMKa 1REVA 1NMEB 4A8YA 2HBQB 2XO6A 1ZZNA 4OJ1A 4PAAA 2LKZA 1KOHA 2HZAA 3D6TB 3IP0A 2MKSA 2UUBJ 2CJ9A 4LVOP 4B3RF 4UW2A 5E2QA 2CQ1A 1N4LA 5T14A 3MOJB 2KI2A 2DCLA 4L75A 3TVKA 2H1YA 2O1PA 3G4SS 5ETLA 4O3OA 4WTOB 2LVWA 1UFWA 4CLLA 3LWMA 1MG7A 3HHDA 2QTWA 2VFRA 1FX4A 1JLQB 5D0GA 2PEHA 2XLJA 3DXSX 3W7BA 2WZ1A 2ZWOA 1SQGA 3V4MA 3MD3A 5KTQA 3DCAA 1UTAA 1PIEA 2KHDA 1UEVA 3KG0A 4CLFA 1VQSA 2AJQA 2DGSA 2KFZA 3AOCA 3CWJA 4YEAA 7FDRA 2DEIA 4OI2A 3QO9A 2VQFF 1R8BA 2IPOB 3TUPA 1RK8A 4MKBA 5KFIA 1FF2A 4AFFA 3M2RA 3KK1A 1FK9A 3GIRA 4JI7F 3QIDA 4OX9J 3KLEB 3H2LA 2MZRA 1U6FA 1FVSA 2W2OP 1TL4A 2XCAA 1MSWD 4CIOA 1NPKA 4BC9A 1NJXA 2DXFA 3HLUA 2CJKA 2E44A 4Y34A 1RHQB 4I2QA 4NLTA 2RHSB 1RTDA 3GG1A 3RR7A 4YN3B 2GVDB 4S0MA 1DAXA 2IM1A 3FBEA 4OYPA 1V5VA 3R2CJ 2BABA 3V4IA 4LF1A 4LSZB 2QEXS 2LEPA 4LR9A 3HZGA 2NSCA 2R8HA 1LW2A 3GONA 2GVZB 1S79A 1EHWA 2J8SA 4NZ0A 3KHHA 2E1CA 1TKXB 2HHQA 2DNRA 2QX0A 3QQCD 1XR7A 2PMZD 5KFDA 5LJ5Y 4KSEB 3PZPA 3CMES 1VHFA 1W7WA 2O67A 1O5JA 2AT1B 4DSJA 2H9ZA 3QAEA 3BYPA 1BLUA 3EXCX 2MZ1A 1RCOB 1S1VB 2FYXA 1XR5A 1N52B 9RUBA 3T5JA 3HDSA 5E3QA 1RDRA 2LEAA 2VOOA 1HNXJ 3MI7X 4QR1A 2G2YA 4ZP8A 2QL7B 1UJ6A 1T94A 3M32A 3UD4P 4RNMA 1RACB 2HIQA 3BKFA 1DARA 1HLWA 3AXMA 1F0XA 1UW4A 2FUG9 1BWVA 4F4WA 3CJ0A 4RUCA 1KVJA 1TKDA 3T6BA 1L5UA 1SJ3P 2FC8A 2PC6A 3FBCA 3V81A 1FRMA 4DV6F 4KGMA 2CFXA 4YHHF 3Q8SB 1TTHB 5GMEA 4FS1A 4UOFA 1EKSA 4KIAA 2ROPA 4K4TA 3E51A 2NLWA 2D9PA 1JIHA 4WP3A 3PYFA 1IBMF 3P96A 1TK8A 2FHJD 5BXIA 2BBEA 4DLGA 1WJ9A 2CWXA 3MUTP 5D6GA 1N36F 4DR5F 4ZVUB 3OTBA 4ZVHA 2M4MA 1NHVA 3MEEA 3THTA 3VAGA 2BJ3A 1Z1ZA 4ILRA 2V2QA 4JI4J 4NCAA 3I5BA 4LF9F 1H2UX 3DLGB 3RAMA 2A0FB 1HR0F 2BR0A 4ANCA 5EN1A 1PYOB 5I42B 2GJFA 2FIUA 3EVWA 4DX7A 4LF2A 3QLHA 3S6EA 1SQEA 1T02A 5F3ZA 3BQ0A 3BGOP 3CTRA 1ZM4A 1S6PA 4YB6A 1NKBA 4PCQA 4ZMMA 3VGUA 4YR0A 4M63A 2A1BA 2GC8A 3PG9A 1A9NB 1N8RT 3P4UB 1FESA 2ZE2A 1ACMB 5M2RA 3ZTSA 1YBUA 3MPYA 3ZTQA 4ZPTR 3UFCX 3HULA 1ZA1B 2ATCB 3VR1A 3Q89A 2J0QD 4A8QA 3WIUA 4X4QA 3L9ZA 5BYSA 2ZBCA 1TL7A 4OIXA 2XYHB 1TL3A 1S76D 3AQPA 3CIMA 4L3NA 4FBUA 4ED3A 4OYBA 2NR0A 1RA6A 2AQ4A 3HVTA 4RBVA 1SUQB 3IBCB 4DR3J 1CC8A 1IWAA 2KG1A 3HHEA 1NJWA 4WE1A 2IRUA 5LSOA 5LMNJ 3RAQA 3TYTA 4ZIWA 4MK9A 4JI8F 4NCGA 1WI8A 1QAJA 1VBYA 4Y00A 5KG3A 2GMLA 1RLCL 3PEHA 2X1FA 4B3SJ 2OP5A 1X9MA 3R3TA 1RT3B 3EICA 5DG7A 3I0SA 1UVKA 2VASA 2RDJA 1VQ4S 4IR1A 2ZVIA 3AJ1A 2OEMA 3TAMB 4K5RA 3H2UB 2CUYA 2W24A 3KUEA 3M30A 4OZLA 4DN9A 4ZPCA 4TU7A 2MKYA 1SXLA 4O0IA 2XSJB 4JV5J 1ZTTA 4U7UD 4KHPJ 3S1TA 2MSTA 2XWYA 3EZUA 2P8IA 4I67A 3C16A 5HQMA 1M1KT 5ETTA 4LF8F 2FC9A 4HH1A 1JQGA 3ZZZA 2O01C 1YK9A 2E7WA 2V8HA 3BGRB 2MQMA 3KHRA 2LP4A 2F8HA 1EJ7L 2LXFA 4HL9A 3CMQA 1OIAA 3ET6B 3IFEA 3OR2B 4D3HA 2DRDA 3DC2A 1RUSA 4YFUA 3E01A 2FPHX 1RU1A 3G82B 4ER8A 2CJAA 1CEZA 3I96A 3UNYA 2XS2A 3BBFA 4J9RA 1ROFA 4CLSA 4I2PA 5F8LA 4K8RA 3J81U 3CJKA 4RW8A 1KQSR 5IQ6A 3M8PA 2F63A 3KUHA 2MZTA 1NEEA 3D1QA 3NL0A 4ECRA 4CYUB 1DQ8A 2QL5B 3SCKE 4J37A 4YB5A 2F5GA 1Q1KA 1KRPA 4CLWA 1F5AA 3D0IE 5BR8F 2JSXA 4KV8A 3PFOA 4RO0A 4DV5F 3PYGA 2E9TA 2XQCA 1S12A 1HWJA 2I1RA 5C2CA 4CH0S 3M6WA 2QA1A 3GILA 1AFJA 3HKZD 5MAOA 2XM3A 1BMQB 3C15A 4NOHA 1KP6A 1PBUA 4G65A 1FNXH 2Q3PA 2BW2A 1FKAF 4F0KA 4IO1A 2CPHA 4QIFA 3N6LA 3OTOF 5LJ3Y 1S5ZA 1X4GA 2M7SA 1YQHA 1Y5IB 2C3MA 4G1PA 2D41A 2ASDA 1OWXA 2DNQA 4PWWA 4NI2B 4I6AA 4WK1A 1C2PA 4QWEA 4Y65A 2DITA 2A2CA 4MMOA 1R0CB 5EWGA 4HHUA 3MPVA 2XSFA 4RWWA 3GZ7A 1T03A 3D6HB 5B7WA 3UW1A 3UN5A 4N8OA 2V67A 4WK3A 2L41A 4DR4J 2CPDA 2ASYA 2P9EA 5D8HB 1R0AB 2KZMA 1PBAA 4IDKB 1GK8A 2KYXA 3V2UC 4V19X 2OSRA 1YBTA 1OYEA 2XI3A 3FSYA 1MW7A 2YTCA 4QWDA 1JLFB 2CNOB 1DLOB 4O3SA 1F6TA 4BCAA 5SUHA 2BANA 1S6UA 4FXDA 1VQLS 5EX0A 2QN6B 4PXEA 1HMVA 2HRYA 1YJUA 4H54A 2VG5A 5KAKA 3LP2B 3D6FB 2ZUAA 1E6YB 2XB2D 3DRPB 1HYSA 1K8AT 4YY3J 2YX1A 5HP1B 5LT5A 2DNZA 2K3KA 2RQ4A 5C7PA 3BJYA 5MLCV 3FBBA 1ZETA 3M2UA 4F4ZA 4ERDA 2NREA 4LSNA 4DF8A 1IVZA 3V5RA 1Y5NB 2YNHA 1B70B 4KT0C 5M2PA 1HBMA 3NRBA 4PXDA 4ZCLA 1XMOF 5BYRA 3SSSA 1RT4B 3GYXB 4CTAB 2H4WB 4UY85 3VGSA 2OD4A 4MT1A 3RB4A 1RT7A 3SZ2A 1NZ8A 1S9GB 5HQLA 2XZWA 1HBUA 1T95A 2FLOA 4JI0J 3KG4A 2DXEA 1QAIA 4M94A 5KG0A 1P27B 1WC3A 1Q7YT 1NDLA 1N88A 2DGWA 2XTJP 1Z4UA 3W66A 1TFWA 1KLMB 3Q8PB 1NPPA 3C6TA 4WZQA 2C3UA 1GEHA 3BQ1A 2ZH5A 3SCLE 1B0VA 4U95A 2RKIB 3GB0A 5E3PA 2BACA 2WAQD 4U8VA 1M1GA 2A2DA 2R7TA 1VIOA 2WB4A 1RAHB 1QSLA 3V6JA 4PUOB 1QY7A 3GLJA 4HACA 1KVIA 2EI5A 1V9OA 1RTIB 1H98A 2B9YA 4ZITA 3BN7A 1Q5YA 5A6PA 3ISNC 1CJUA 2IDEA 4X84A 1QSYA 1LWCB 4XIUA 5HO4A 2YQ1A 2HFSA 3MURP 1GXUA 3D0GE 4PXBA 1IWGA 4MKVA 4YS2A 2MMYA 4N76A 4X64J 1LNQA 3FRZA 1VK3A 5CHCB 1TKTA 3D3CJ 5B0AA 4UOHA 4YDDB 1HW9A 5KFJA 1XNQJ 3PXGa 3EVOA 2FY1A 1WF1A 2W01A 2BQRA 1TK0A 2G2OA 5IZHA 3UWTA 5KFZA 5SZTA 3ZZOA 1ZBTA 1XQIA 3OXGA 2EC0A 4DHVA 2YNGB 1OO0B 2KXNB 1NHKL 2J9DE 1D9DA 3G71S 3MM9A 3LP0B 3MFIA 1TUVA 1LQ9A 1FRJA 4NXMF 2WVBA 3HSJA 2DNOA 2IFXA 2NPFA 4KPYA 5LMUF 2WW8A 1IKYB 3IR7B 2L3MA 2R2SA 1YDLA 4QR0A 3FCHA 3Q8VA 4KBIA 5FD1A 2LQJA 3GIIA 1R8CA 3JS9A 2VKRA 4RNNA 3J7A1 3W9HA 1DJ0A 3PRVA 2YQ0A 2GW8A 1UPPA 3IAM9 4R0EA 4WIIA 4RR5A 3TRGA 3JSMB 1X0PA 4Q0BB 3OT9A 4DJBA 1NPRA 2OUGA 5F41A 1Y4ZB 1D8YA 3JTOA 3ZZPA 2KDOA 3B78A 3W63A 2X1AA 1WOSA 3FEZA 2MHNA 5GAEU 1N34F 2WONB 1HQUB 3G96A 1KC8T 1OSCA 1L3TA 1Y5LB 3OLAA 1RKJA 1H72C 4OYOA 3I5CA 1N48A 3D54A 4OZ3A 2YNIB 2MEWA 3T5LA 3P3DA 1LWEB 3VTIA 2CIMA 1UZDA 2VQEF 3P45B 5ETQA 2GO9A 2H5JB 3J7AN 5AE3A 2GX8A 4NLOA 2JEJA 1U0HB 5A0YA 4C6AA 2V69A 3IWXA 4KJIA 2YY3A 2DJWA 1S1TA 2MHEA 2LDIA 4HKQA 1QUVA 3QWPA 1TFYA 2MKCA 2X51A 4JI1F 2XMVA 1S4EA 2CNNB 5E5NA 5E3AA 2UXCJ 3BEGB 3OV7A 3H5YA 3T9ZA 4AUKA 3NGSA 3OVBA 4WP8A 2HS0A 1VBKA 3H5XA 4ZP7A 5A8KB 5B0EA 3VVTA 3IWNC 1V3RA 4DR7F 2CPXA 1V6HA 3DM2A 1IKVB 5J2MB 1C0TB 3SV4A 4DLEA 1WG5A 3O2IA 2IJFA 1L3UA 2FVCA 4EEYA 5B0DA 2AJ1A 3UCUP 4Q44A 3RBXA 2RILA 4B9VA 2HS4A 4DV1J 1TMMA 4OI4A 5KFYA 2YKPA 2RUSA 2XULA 2P5VA 1LFPA 3GQCA 2OMOA 4AXIA 1VOMA 3L09A 4OHVA 1GXTA 3JQKA 5DQIA 2UZAA 2MY8A 4P2FA 5FJ4A 1Q78A 3BB5A 3CCSS 4ED0A 1YVFA 1U48A 5JJBA 3KK2B 1S57A 5I3QA 4C48A 1RGVA 4RW9A 2V63A 5CZVA 2HURA 3DU6A 2GMJA 3DI6B 5K8NA 2DT9A 1JJ2R 1BD6A 2F8MA 2PT0A 2MQNA 5ETMA 4DEZA 4G1QB 2IAJA 4ZOSA 4IOCQ 1KLNA 1UCNA 1T7PA 4A8WA 5G0RA 1WC1A 4CO1A 3IAS9 5KT3A 1RWKB 1KEKA 1F5CA 4OLOA 5CABA 3GYGA 1RZMA 3MR3A 4LUBA 4DF4A 3LGNA 4UTGA 3CULA 3VAFA 4A48A 4USJC 2R7SA 2XNRA 3W2VA 4QWBA 2YKOA 2YQ3A 1S77D 2XZDB 3M6UA 1FDBA 2CQ2A 3LALA 1WKKA 1UFKA 1RKIA 2VG7A 3CC4S 2EEYA 4RBTA 5DETA 2NUUG 3I82A 1PAUB 3EZOA 1W2IA 3ZZRA 3MMBA 4K0KF 3KLHA 4DPWA 4CH1A 2WRMA 2MJNA 1VRUA 1B99A 2N4CA 2BW7A 3P5TL 3BGUA 3PX4A 2EFVA 4U67Q 5AXNA 3R9LA 3H40A 1M5VC 3M8WA 2GJIA 5DDPC 4BLGA 3MCMA 4JYAJ 1U6BA 1Q5VA 5D4NA 5IWAJ 3RB6A 1JJ4A 3CUNA 5L46A 3NAIA 1SJQA 4NLVA 1REGX 4ZP9A 2ZM6F 5DQGA 5LSRA 3CT9A 4KO0A 2DEJA 4ZLNA 3M8QB 1KR4A 2DNLA 3BH6B 2Y1IA 3QATA 1JLAB 2B4VA 4WCEQ 1X4HA 3M8RA 4LFBF 4GKJF 4QIWD 1ZM9A 1UZHA 2UVUA 1CULA 4AL5A 4R0JA 2CPEA 2XWXA 1RT1B 3FVYA 4ID8A 4G3IA 2UXBJ 4DOZA 2RF2A 1MROA 4U7UK 4NZ6A 1WF2A 2MZJA 4MK7A 4LF4J 3N6MA 1U1LA 2DPIA 1X4EA 1Y0HA 2ASJA 1HIYA 1N33J 3QT7A 4B02A 4F8RA 5J2QB 4YUDA 5HJYA 4IUFA 5GADI 3LW5C 2WVDA 1LW0A 4PWUA 1AZSB 2D3ZA 3M1VA 3VAIA 4LVNP 3D7SB 3HHNB 3HFVA 4ED7A 4N47A 2C28A 2YKNB 3KLIB 1NDKA 4A8MP 4F4AA 3MCSA 2I5JA 2AIRB 1SV5B 5DQHA 4Z37A 4KGXB 2AYMA 2CYYA 3ZTOA 2PA3A 4RW7A 1FI4A 1QJHA 2N7CA 1YITS 3GSIA 2MZQA 3EGNA 2GHVC 1A6LA 2EFGA 3IWLA 3D67A 2JLEA 1BQXA 2OI2A 3IN5A 3MM5B 1M0SA 1VDHA 2CG4A 3AB2B 2P2CB 4CH7A 2RUGA 5D0EA 3VWSA 2GIRA 3NGTA 5U47A 2ZH8A 2B6AB 4KY3A 2J7UA 2DHGA 4L74A 2VG6B 2W9BA 2HIYA 4QWAA 1J2VA 2HBRB 3MPWA 3MAAB 2MYFA 2CQPA 1X60A 2BUNA 4OZNA 2HVZA 3FZBA 1K47A 2OKQA 3ILOA 2V8PA 3NNHA 4X4TA 4BWJA 3W5ZA 4IRDA 2UU9J 1JLCA 5KFQA 4F0HA 4DV3J 1KD1T 3LP1B 4ZPWR 3J7ZT 1S1WA 5KFLA 1GMUA 1XMQJ 1VQ5S 2VDIA 1RHRB 2UUWA 3G6XA 2IYIA 5K5MA 2MZSA 4WP9A 2WHOA 4Q8EA 2UVVA 4PPZA 1XR6A 2R7OA 1WF0A 3LH2S 1QUPA 3HFZB 1JLBA 4QW8A 2OD6A 4CLZA 3M8ZA 3BGLA 3M2VB 4IYQA 3TUJC 2G9OA 1FKPA 2DH7A 2QV6A 4K59A 4GVLA 3OFHA 3QMQA 5K14B 3L7UA 4W90B 2BA9A 2KZZA 3NEKA 3CCUS 1YI2S 2ZOFA 3H98A 2ZC4A 5CYQA 3TAPA 3W61A 1RTJB 1JNZB 2J6TA 3C14B 2A18A 4WFYA 3GR1A 4C9DA 3RR8A 4LF5J 4I1TA 2VODA 1JLGB 2AJ0A 4D3GA 1XMBA 3CDBA 4FNIA 5C25A 1KFSA 1MWZA 2KKHA 1QDUB 1BY9A 4TVAB 1VQPS 4F26A 2KVIA 2Q43A 1YTYA 2R7RA 1YKWA 1TKXA 3DHWC 3MECB 3UQSA 3H2VE 2SXLA 2FHJA 3ITHB 2DKOB 4RUBA 2EKYA 2RH3A 1GTEA 1URNA 4DPOA 3V6DA 1OPIA 2H48B 2XBPA 4P9SA 2ADBA 1YG0A 2W4DA 5LOQA 1S1VA 1WHVA 3G6ES 2KJVA 3DOKA 4W92B 4XO0A 4J9OA 3GIJA 1K1SA 1WEXA 3THVA 5ETVA 1X4FA 2QC3A 1Y9OA 1S7HA 4Z7YA 4Z7CA 4B3TJ 2VIHA 3T6JA 4IG0B 1LK5A 3OTDA 4J7CA 1DFDA 2PGCA 4RNFA 3ONQA 1P6TA 3POTA 3RRKA 1VJWA 1BQNB 2J76E 3PJXA 1TVRA 2IC3B 2Z4PA 2LU1A 1R31A 2QA2A 1HI1A 2BE2B 4ICLB 4NLQA 2QLWA 2J7KA 3TUZC 2QRRA 2ZD1B 4X4UA 3M6XA 4CP5A 2U2FA 1VFJA 4ZPDA 1C1CA 2NCKL 1U1PA 4FKYA 3KK3B 3A8IA 2EFPA 4CQ1A 4HI1A 4TY8B 1G4CA 1FJ7A 3F0NA 1PJ7A 3Q83A 3I6PA 3IG1B 3RW7A 3JXOA 4A46A 2D74B 3GFYA 4FDFA 5IFMA 1EZZB 3ISZA 3PY8A 4C8KA 2HQFA 5A2QY 5A8WA 3MHYA 2AEFA 4CT8A 2VPZB 4J9QA 1TR0A 3NBPB 3VVUA 1LXJA 1TAUA 2R4FA 3BO3A 3MXHP 4LBHA 2ZEJA 5DGBA 3R1HA 4QOTA 3M9OB 1VGYA 4WTYA 3LGHA 3A8JA 5B08A 5KFAA 3BSOA 2GNKA 5I42A 2R7QA 2M52A 1HPZB 2W2MP 4F50A 1WTFA 4DI6A 4V19J 5JVGQ 2P6TA 2B56A 2HHXA 1FWLA 3AXKA 2G1DA 2C3OA 1AT1B 4OI6A 2NXJA 3K2YA 2RJZA 5IC6B 2FJEB 5KFBA 3NP5A 2BRKA 3KG1A 4JOUA 5LM7E 5C24A 4B3RJ 4K4VA 4IH6A 3KJFB 1VS3A 5AXMA 2KHCA 3EPGA 1FDAA 4PYAA 4RPFA 1GMWA 2WBRA 2HHWA 4B9MA 3CD6S 1VC5A 1T9VA 3EGVA 3HVWA 4DUZF 3NCQA 4NMLA 3LAMA 2YNFB 2J7WA 5A8RA 2QA4G 4CLUA 5HBMB 3G8SA 2HHHF 2DR8A 3M9MB 4P2SA 2HHUA 3DRSB 1GXLA 4PG4A 3DRYA 5KT6A 2CQDA 4H4OB 4WKYA 2CJXB 2XI2A 1EETA 1LWFB 3W2WB 1R6VA 1MU2A 4DU7A 2CDQA 2DNMA 3HSGA 4LRCA 3DYAA 4OYXA 4Q45A 1SH0A 5KFGA 1H6KX 1YBAA 1Q0NA 3NGDA 1N6QB 3OJSA 4H4MB 3A3OB 5F8JA 4OZ5A 1G7CB 3D3BJ 3TAMA 2VQFJ 1VYAA 2BJEA 3D28A 2BKOA 2AJ2A 5CD4H 1W25A 2VBYA 4JI7J 1UWBA 1S0VA 2CVIA 4NLGA 1X5TA 1S1XB 2VZ9A 2BRLA 1I3OB 3MCOA 1O8BA 1RU2A 2VKZG 2QFJA 4LFCF 4M1KA 3ZC4A 4QR2A 2J8AA 2Z2YB 2AHOB 2F9JA 4M95A 1HARA 2D3UA 2W8LA 1RWPB 1TAQA 3BGRA 4RW6A 1QVFR 2X7IA 3H90A 2YX7A 4IG3A 5L1KA 1RCXB 1EP4A 3GSDA 2B5JB 2B8QA 1D8ZA 1VQOS 2HQDA 3ET6A 4M5HA 1WHYA 1PC5A 5D0HA 4EZ6A 1CLFA 2DY1A 2AZ3A 4K2XA 4K4UA 2E7VA 5J2NB 2OPPA 1JK9B 2MQQA 3SSRA 3WDOA 4JI5F 1Z2ZA 2HNDB 4J9UE 4YR2A 3VGVA 2IMWP 2CPZA 1QE1B 3AJDA 1S10A 3BDPA 4DL4A 4EYIB 4C3LA 4HHJA 1DTQB 4O0NA 3X1LB 2V4QA 4CYUA 4TU8A 3SEOA 2MPUA 3IRXA 3PFEA 3UDCA 4J5OA 3AY0A 5DM6Q 2HKEA 4O4RA 2M9KA 3R5AA 2AKWB 4LMZA 4KYZA 3TA2A 4RJVA 5G4DA 2EFQA 1AYEA 2YWFA 3SBMA 1XK8A 2CDRB 1SC6A 3ILIA 3OR1A 1NK4A 2MY7A 1UEKA 3W9JA 1WOOA 1KTVA 4DV6J 4U6PA 1AUSL 1S9EB 1RWVB 1HKAA 4JV0A 4YHHJ 4I7FA 3Q24A 3CCMS 2OLWA 2DNYA 3CC7S 4DSEA 1U8WA 3RUBL 2WSCC 1IBMJ 2ZH3A 2E1PA 2W7AA 4DL3A 2YWGA 1FE0A 3K5MA 1K9MT 4NI2A 3TUIC 1JNRB 2IVMA 1RP5A 2P9GA 2UV8A 2OEKA 4OZJA 4UY8T 1N36J 4DR5J 1X8DA 3GJSB 3LOUA 1B3TA 2QMWA 2J9DA 3GV5B 1WNEA 2M5YA 4OFZA 1TL5A 4L72B 3TW0A 3NNAA 3FRYA 3MZIA 3AOAA 4F0MA 3IRWP 4LF9J 4TQRA 1HR0J 5FIIA 2V8VA 5D78A 1LEOA 4QCLA 5KFHA 2E5IA 3CB4A 4HH0A 3DLKB 2CZ4A 4ZPVR 1ZM2A 1DLOA 3UVJB 3QYYA 1IKXB 2HYIB 3OHAA 3PCOB 1F1BB 3TZXA 2DGVA 4IKAA 3QFWA 3EGZA 3LP2A 1RHKB 1E6YA 4XDDA 3G86A 2CRLA 5DLGA 5HP1A 1CC7A 5L1LA 4HI2A 5KG2A 2WTFA 3JTNA 3QO9B 4PQAA 3QGPA 3GCXP 3M2RB 4OX8A 3KK1B 1R8PA 1FK9B 2Z57B 4MKAA 2IRYA 1KDNA 4OI1A 5HMYA 4ZA1A 2ALZA 3C2PA 4KKOA 3HMJG 3DKDA 4NLDA 4Y2AA 5DDRC 2M3DA 2KRRA 3HM9A 2JVOA 5F9NA 4I2QB 4EK2A 4F3MA 5KFPA 2ZHAA 2QIFA 3FMBA 2QYGA 1AA1B 2Q6CA 3NWGA 4C11A 1NRKA 3V4IB 2AGOA 1TKZB 3PTWA 1GT8A 4JI8J 3MMJA 3IR5B 2XLKA 1KLMA 3K58A 1GTHA 3QT5A 4ZDNA 4AD6A 4IQXA 4RUAA 3MF5A 4IFVA 1F9EB 1KKHA 2V94A 4ZCIA 4DXLA 5J1EB 3S8SA 4A8KA 2J5AA 3SYZA 1EQ0A 2OGUA 2WW4A 2JC1A 2B43A 4DCOB 2RE1A 4FXWA 1RAFB 2WVFA 4K4XA 2XHCA 3ZNUA 2HFZA 4M5MA 5A76A 1HD1A 4PUOA 5B0BA 4Y6IA 1RTIA 1UW9A 1ZS6A 2MSSA 4OHWA 4LF8J 3OUYB 3GIKA 1YJRA 2RU3A 1T11A 2BJ8A 3GJQB 4RKUC 4J9SA 3EGWB 2R8JA 2R7UA 1L3SA 1RSCA 2DNHA 4KE5A 4Q2MA 4GKKF 2C2OB 3QIPA 3TP2A 4ES1A 4MH8A 3FK4A 3EE3A 3N5FA 2CZ9A 4DV7F 2VICA 5CCMA 3JTPA 3GJTB 2ZFHA 1QD1A 1WG1A 4CO0A 4C3MA 1X7VA 2VH7A 3FEYB 2KJWA 2VPWB 1FD8A 2HHTA 2FJBB 2VUGA 2GFFA 4X65F 4X4OA 4DFJA 1P8GA 1MWQA 3LP0A 3K5PA 4WFXA 3RU0A 2K7JA 5IV4A 1EKRA 1XN9A 4JV1A 4QQBA 4F7VA 4LSLA 2O66A 4KGZB 1FA0A 3T3FA 8AT1B 5BR8J 2V6AA 3KLGB 3KLFA 4DV5J 3CDWA 2HVEA 3OSPA 2JDJA 1VR6A 2CKWA 3ENWA 1NH8A 4J9KA 2HRUA 3N5BA 3ADAC 4DSIA 2BKPA 2YWWA 1RAJA 3TZYA 3CD7A 4ELTA 2HFUA 2D69A 2LA4A 2RIJA 2Z2ZA 1IBKF 3OQ2A 2C3PA 1O6XA 3PR5B 1ZH5A 1VQKS 4ZKAA 3KHGA 3VAMA 2KXHA 3QLHB 3TJ9A 4Q5VA 2K1RA 3OTOJ 5IM0A 1S6PB 4X4VA 4GMKA 2H51B 2IDLA 4HLBA 1WC6A 2VC1A 2QO3A 1SKSA 2NPIA 1N54B 2DNNA 1B0TA 1RYRA 1X4BA 1NK0A 2BJ9A 3K8VA 2AX0A 3CO0P 4AYBD 3O5TB 4C8ZA 3DHXA 1WTBA 5EGYA 2KT2A 4OX7A 4OHZA 4PKDB 2N82B 2B9EA 3NXZA 1H73A 3DLHA 1TL7B 3TAQA 1TL3B 2RD5C 3HVTB 3SCJE 4ZPAA 3G2XA 4EU0A 1D9AA 2HRTA 2N4DA 2BJ1A 2PI5A 2FZKB 2HHPA 4MK8A 3F56A 2D9OA 1QM9A 2DH9A 2U1AA 3HZEA 3LO3A 3GP9A 1IUJA 2ZJRQ 2EKNA 3KLVA 2F1FA 4FP9A 4NCGB 2X1GA 1FDNA 1KNZA 3FUYA 1FXRA 1PJ5A 1U02A 3UN2A 3RZAA 4O23A 3FQKA 2NYIA 3MMAA 5AT1B 1S1UA 4A8SA 2C1EB 4RU9A 3Q8RB 2RS8A 5AXKA 4ENOA 1XMOJ 2KRBA 1KOOA 3EX7B 4WIQA 2Y1RI 2KXFA 2HK2A 3NGUA 5KFOA 1T9TA 1HW8A 4F4XA 2ZH6A 4OJ3A 3C16B 3JB9k 3KK2A 2POKA 2HQCA 4NYOA 4PEOA 1JMTA 3H25A 2HAFA 3R5GA 2BV3A 3IGVA 1K0TA 2BZ2A 3AH6A 2ZZNA 2HGLA 2R2TA 4C98A 4G1QA 1XJWB 3KTQA 1C4CA 4WWSA 3I5AA 5L1JA 1R8HA 4P10A 4K7QA 3PEJA 1D09B 5ITHA 3EJMA 3C46A 3DOMA 1KFDA 1K44A 4DL0C 5ETSA 1R3NA 3DNCA 2R8GA 3R5DA 2GA7A 1YZ7A 1NKCA 3UPFA 1JXVA 1FEEA 2ADCA 3CJKB 4RW8B 3OL7A 3NS6A 2XMAA 2ZBRA 1S0OA 2G0IA 1U25A 3SV3A 4YDXA 2Z30B 2ZOGA 5D0RA 4Q2LA 3VAJA 4KAIA 3IGNA 4FYDA 4K4SA 4KV8B 2G1HA 4USUA 4XPCA 2NXEA 2MLXA 2OSQA 2Y8YA 2EXUA 1RISA 2W7OA 4U8YA 4UZCA 5IC4B 3E2EA 4DV0F 4ED5A 4EWTA 3C15B 2OIHA 4X62F 2LQ9A 4CRJA 2HVDA 1BUXA 1KONA 4DQQA 2OTJS 2QT7A 1BXNA 3UDVA 5HMWA 2F9DA 1CJTA 2B7BB 3HXMA 6FDRA 3O44A 4K50A 4LREA 3HFKA 2GQQA 4KR0B 3M8QA 4A8FA 1WKJA 4NXMJ 5EWFA 1TMJA 3CDEA 5LMUJ 2GCFA 2HQ3A 1RI7A 4ID5A 4NLSA 8RUCA 1IJEB 2ZZMA 3C8YA 4BDPA 1T03B 4WKRA 4RBUA 3F44A 1KVKA 4RNHA 2MKHA 4WPAA 4UUXA 1HQEB 1RWWB 2NXNA 4DR1F 1UVLA 4NE9C 1Y7PA 2V9WA 2OEJA 1S99A 4P52A 4BC7A 5EDWA 3MCNA 3QWUA 2DR6A 5KFSA 1YIJS 4KH1B 2RMLA 2ZKUA 4PG7A 3LA0A 2B3TB 3RGIA 1H0HB 4CZCA 1N34J 4WYWA 2AJ4A 4CO3A 1SKRA 2BANB 3SIPB 5KG4A 2D1CA 2VC0A 4DZDA 2AEJA 1VQ9S 3PX0A 4C8LA 2ZOMA 2MDAA 4DZ6A 1SJ1A 4F3QA 4OI0A 2Z58B 1UA0A 3J81j 2FB0A 2HFNA 1HYSB 4F4YA 1RT6A 2ABYA 2H3EB 1LWXA 4K4WA 2YKNA 2VQEJ 1FFSB 2MJUA 2NUHA 1FNOA 3M2UB 3U1LA 1CBKA 3SQOP 3G6VA 3FEXB 4LSNB 1SV5A 2CWKA 1JKHB 1HBMB 2W9CA 1Q86T 3NMAA 4JI1J 2UVRA 4DDFA 2Z2MA 1HNVA 2DR5A 4ZCMA 3K5NA 3MEDB 2JOQA 1WWHA 4FYXB 3D5MA 1HQ2A 2W4CA 3T1HF 2HK3A 3PIOQ 3J7YI 1I1GA 2VBXA 5HJXA 2B6AA 5LXYA 4DR7J 2FJXA 3VZIA 3KYLA 5D4LA 3CW2C 5F9LA 5THWA 1VBXA 1RB0A 1ZYQA 5M2UA 1SPBP 3MAAA 4P74A 4ZJOA 3A12A 1VJQA 3B6BA 3MR7A 4I68A 3CJQA 2XZTB 1N5TA 3M9NB 4PXCA 1EB0A 3K0JA 1FRXA 4RU2A 1T9WA 4NLYA 1OYDA 3LP1A 4URSA 3CJRA 1VRTA 3R6GB 2CPYA 4O3PA 1R8AA 4JI6F 3O1LA 2J0XA 1C1BA 4EYHB 2JFKA 1YJWS 2UUTA 2EBGA 2I2YA 3R1LA 3K5LA 2DIVA 2RQCA 1ZZFA 3CCTA 4EMDA 4NEZA 1ZTWA 1U47A 3B4MA 1CJUB 2XNQA 2VJUA 2UXDF 1ZAXA 1BQMA 1SIWB 4CLPA 1N32F 3M8SA 3WZ0A 2P9CA 5K14A 5HVHA 2BKNA 1PYSB 4RUHA 1ZOTA 3WHIA 5HROB 4PQUA 5CXTA 4GVBA 3T41A 5DLFA 4R8UA 3C14A 2OH2A 3OBIA 3VAKA 4ES2A 5KT2A 4ECQA 4FPRA 2K3IA 2L9DA 2APOA 2BM0A 1NJZA 5H9FK 3FMWA 4OZ2A 3OVSA 1RQ0A 4PG5A 1P9YA 1CSJA 4ETXA 4XK8C 3MOZA 4HYKA 1V3ZA 4NL5A 4B17A 3OL8A 4ZN1A 3HSZA 2QGFB 5D3GA 1E6VB 1WD6A 3MECA 2XS5A 5FLXU 3EDRB 3ITHA 4J9VA 4ANEA 4K0KJ 3CGIA 4ZHRB 3HSDA 4B3MF 2DPJA 1R6YA 2BE9B 1GAOA 1IKWB 1S7IA 2IMOA 5H9FJ 4AE5A 3OVAA 3OPKA 3AFGA 5DRKA 2X3DA 3CPWR 4I0WA 5GAGI 2WBMA 3KJVA 4DUTA 1U49A 4LIRA 3QGGA 3SSQA 2VA2A 2ZZTA 3PW7A 3RAXA 1IBLF 5J2PA 4RW4A 5DO2A 3QZ7A 2PD1A 3TARA 2VF3A 2AX1A 4IG0A 1PSDA 2ZM6J 3DMJB 2EPIA 2HLTA 5EUHA 3DGVA 3SXLA 3TJAA 2NS1B 3SMZA 5DS7A 3WC2A 5E0OA 4CO5A 4DMZA 1IM6A 4FKXA 1BQNA 2W9AA 5E7OB 2B4OA 3GCWP 5E33A 2A6MA 3BPSP 4LFBJ 4GKJJ 1D0EA 1NAQA 2IC3A 2E66A 3GPAA 1FTCA 2DNPA 1I94F 2GQCA 5CAAA 2HBZB 2BE2A 4ICLA 1S6QA 3IA0A 4FYVB 2QJ3A 2LXIA 4ECUA 4PR6A 4F3OA 1VRQC 2VPXB 2ZWPA 1DTTA 2F4VF
chains in the Genus database with same CATH topology
4IFYA 4CIOA 1R0AA 3NCRA 4BC9A 1NJXA 5CZXA 2XBPA 3HLUA 2ADBA 3BGFA 3H5UA 1YG0A 3VQSA 5L9NA 2E1RA 2W4DA 3MD1A 4IDKA 1HFEL 2XHWA 2CJKA 4P7VA 1S1VA 1WHVA 2E44A 2K8GA 4WZMA 4Y34A 3G6ES 2KJVA 3I32A 3DOKA 4W92B 4XO0A 3PRBA 4DR3F 4J9OA 2VONA 1Q8IA 3GIJA 2RU9A 4I2QA 4NLTA 1K1SA 1WEXA 3THVA 3GG1A 5GAEI 1VQ7S 1RTDA 4YP3A 5KG6A 3RR7A 1Q81T 1X4FA 1JLFA 3VZHA 4CO2A 1DAXA 4C0OC 2IM1A 3HHKA 1Y9OA 4ILMA 1S7HA 2FHOB 1YSJA 1HWUA 2BABA 3T6JA 4IG0B 3THPA 4DL7A 1LK5A 2GHWA 2VFVA 1D9FA 2DO4A 4Q43A 3OTDA 3V4IA 5LMNF 2EW9A 1APSA 1DFDA 1IQZA 2PGCA 3PW5A 4RNFA 1OSDA 3ONQA 2QEXS 2LEPA 1P6TA 5CQGA 3POTA 3HZGA 2NSCA 5DJBA 2R8HA 3RRKA 1LW2A 1VJWA 3MAQA 5IQQA 3NBPA 4O44A 1NU4A 1BQNB 3DRPA 4NLUA 2J76E 1S79A 3NKYA 3PJXA 3DLEA 3U02A 4NZ0A 1TVRA 3KHHA 2E1CA 4B3SF 1TKXB 2HHQA 3K5OA 2DNRA 4I64A 2IC3B 4C0HA 2I8EA 2RSQA 2F8EX 4QZVB 2Z4PA 1JWWA 2LU1A 1XR7A 4CT9A 1R31A 3PRDA 2QA2A 2PMZD 5KFDA 1HI1A 2J9CA 2BE2B 1SL2A 3TQ1A 3O6QA 4ICLB 1Q7LB 3PHEA 5LJ5Y 4NLQA 4KSEB 2XS7A 1FD2A 2QLWA 3PZPA 2J7KA 3CMES 2E1AA 1YJNS 1VHFA 2JVRA 2AWZA 3TUZC 2QRRA 4H4KA 3F73A 2O67A 1NH7A 2CQ3A 2ZD1B 4X4UA 2GJ2A 3R5BA 1G3OA 1O5JA 2YWKA 5BYQA 2RS2A 1NK5A 4DSJA 3L7OA 2H9ZA 3QAEA 3M6XA 5F8IA 2U2FA 3ZZYA 1VFJA 1YGYA 4ZPDA 4BWMA 2ZH4A 1C1CA 4IFYB 3HX9A 2L48A 5EX3A 1RT4A 4JV5F 1BLUA 4CTAA 1U1PA 3EXCX 3KK3B 2MZ1A 2AGQA 2DRAA 3PACA 4TNOA 4KHPF 2EFPA 4CQ1A 1S1VB 4HI1A 2XY6A 4TY8B 4HDHA 1FJ7A 2DHSA 3I6PA 3IG1B 3RW7A 1XR5A 1N52B 4A46A 4DG1A 2KU7A 3T5JA 2D74B 3PV8A 1XEZA 3HDSA 3MTJA 5A6WA 1RTDB 1X9WA 2AGPA 1S9GA 5E3QA 1JJHA 1FRHA 1RDRA 2LEAA 3TO8A 3GFYA 5IFMA 3ISZA 5KG1A 3PY8A 1CQMA 2VOOA 4C8KA 3D1HA 5A2QY 3MI7X 4QR1A 4ZP8A 3GFZA 2JEFA 3G9CA 5A8WA 3MHYA 1UJ6A 3N28A 1T94A 3M32A 2VPZB 4CT8A 3UD4P 4DR6F 4RNMA 4RWXA 4RW9B 2M8DB 2LECA 4J9QA 1JLEA 1TR0A 1LW2B 2HIQA 2LEBA 1DARA 3NBPB 4O44B 4CO4A 2V4RA 4ECYA 1F0XA 1UW4A 3DLEB 4LQ3A 2FUG9 1LXJA 4F4WA 1TAUA 2R4FA 1FVQA 3T19A 3BO3A 3CJ0A 3MXHP 3MEGA 4RUCA 3CD0A 5KG7A 5IXUA 2IAJB 5DGBA 1KVJA 3BDEA 5HLFA 5GAHI 3R1HA 1TKDA 3T6BA 5FLXY 4QOTA 1L5UA 3CJ4A 1SJ3P 4B3OA 2LLZA 3M9OB 1VGYA 4WTYA 2FC8A 5G0RB 2AV5A 3G8TA 2PC6A 1Q82T 1YWXA 2LDYA 5HBMA 3N9UC 3V81A 5B08A 5C5JA 1FRMA 2RKIA 3TANA 4DV6F 5KFAA 2CQBA 3BSOA 3CCES 2N3LA 2GNKA 3PNIA 4C8NA 5K8MA 4KGMA 4DN0A 5I42A 2CFXA 4YHHF 3CCQS 2F7VA 2R7QA 2FHMA 2DD8S 1YRTA 3Q8SB 2M52A 1HPZB 3BF4A 3RYLA 2B7CB 4FS1A 5KFKA 4F50A 5DG9A 1WTFA 4K4ZA 4YMEA 3MWBA 4KIAA 4V19J 3CCZA 2ROPA 5JVGQ 1LWFA 1R27B 2P6TA 3ZZUA 4K4TA 2B56A 2EG1A 2NLWA 3E51A 2D9PA 4NRTA 4ECTA 4ELUA 1JIHA 2HHXA 2XMWA 1A7GE 1FKOA 2DCUB 2G1DA 2C3OA 1IXKA 3PVXA 4BBYA 5KFNA 1IBMF 3W2VB 4IO9Q 4OI6A 3K2YA 4OZ1A 3P96A 1TK8A 2RJZA 1NO8A 2FHJD 3M4XA 2F3JA 2BYCA 2BBEA 4DLGA 2FJEB 4DL5A 4I6WA 5KFBA 3NP5A 4IRKA 5KG5A 5K9FA 2BRKA 3MUTP 3KG1A 4J9LA 2OO4A 4ECVA 1LWCA 4JOUA 3N01A 5D6GA 5KFMA 1BWEA 4ID5B 4ETZA 2CVEA 5C24A 3BQ2A 3M32B 4K4VA 3I4HX 1N36F 1IN0A 3WBZA 4IH6A 1VS3A 2CQ4A 3D1OA 4DR5F 3OTBA 4WXWA 3MMBB 3KLHB 3OL6A 5AXMA 2KHCA 4ZVHA 3EPGA 2IYGA 2M4MA 1NHVA 3MEEA 3THTA 1FDAA 2HHWA 1HNIA 2WBRA 3B8HA 4B9MA 3CD6S 1VRUB 4OHXA 2HVIA 1VC5A 3VAGA 5B0GA 1Z1ZA 1T05A 2BM1A 4ILRA 3FGVA 3HVWA 3DOLA 4DUZF 5HLFB 3TI0A 3NCQA 4NMLA 4NCAA 3LAMA 1NHUA 3I5BA 2YNFB 1FJEB 4HDGA 2J7WA 2KT3A 3QAUA 4LF9F 5A8RA 2QA4G 2N3OA 4O3RA 1H2UX 3DLGB 3RAMA 5HBMB 1HR0F 3V81B 3G8SA 2BR0A 2HHHF 2DR8A 3M9MB 1S6OA 5EN1A 4P2SA 5I42B 1DURA 2AJFE 2HHUA 2FIUA 1GXLA 3DRSB 3DRYA 4PG4A 2CQDA 5KT6A 3EZ5A 5KFUA 2HFOA 2OPRA 1FTRA 4H4OB 3UDLA 3S6EA 3QLHA 4DWIA 1MMNA 2YNGA 4WKYA 1SQEA 1T02A 5F3ZA 3BQ0A 3I9V9 3CTRA 1ZM4A 2XI2A 1EETA 1S6PA 1LWFB 4YB6A 4X4NA 3W2WB 1UVNA 1MU2A 3QPIA 3I55S 3ISND 2B4UA 4PCQA 1NKBA 1FKOB 1TZ0A 2CDQA 3HHLA 3NG8A 1M5HA 4ZMMA 4C3KA 1QAXA 1WEZA 2DNMA 4YOEA 2N7YA 4C2MA 4ZS6A 4IRCA 3GYNA 4YR0A 4M63A 3DYAA 4X4RA 2A1BA 2DGOA 2PSZA 2GC8A 5F8MA 4NLXA 1RT2A 2O5DA 3BZQA 1N0UA 1SH2A 1SH0A 2F40A 4EO8A 4Q45A 1N8RT 3JAMY 1M5PC 1J5EF 1A9NB 5KFGA 2XMKA 3T5HA 3DLBA 2EFNA 1FESA 1H6KX 2I9SA 2ZE2A 1YBAA 5FDLA 1T3NA 3NGDA 1N6QB 1IKYA 5D4OA 4OHYA 3OJSA 4H4MB 5J1PA 5KFXA 1RT6B 5F8JA 4OZ5A 5M2RA 4FNHA 2BOPA 3MPYA 4C8OA 1G7CB 3TAMA 1NNDA 2XY5A 4ZPTR 2BJEA 3D28A 3RW6A 1UMJA 5CD4H 3UFCX 2XMMA 4U9RA 2PN6A 1W25A 4ES3A 2E5LF 3VR1A 2FJAB 2VBYA 2HAIA 1UWBA 3OTCA 5J2NA 1MWYA 1S0VA 3CVKA 2CVIA 3CJ5A 4NLGA 3MEEB 2FLLA 2J0QD 4DR4F 4A8QA 4X4QA 5D77A 2RVJA 1X5TA 5BYSA 1S1XB 2ZBCA 2LA6A 4DQPA 2IJNA 2HNDA 3JSMA 3I0RA 4OIXA 1FJGF 1T05B 1TL3A 2VZ9A 2W9CB 3AQPA 3CIMA 4L3NA 4WJBA 4FBUA 3DLJA 3I87A 1S76D 2BRLA 4ED3A 2YH1A 4Q0BA 2Z8QA 2NR0A 1RA6A 2AQ4A 2LQBA 3NGKA 1XBWA 3K59A 2V8DA 3AAWB 5KOWA 2G13A 3HVTA 4RBVA 1O8BA 1SUQB 1GH8A 4PWDA 2ERRA 3VAHA 2VKZG 2QFJA 2UUCF 2RF2B 4Y2MA 1MROB 1RT5A 4LFCF 1CC8A 5F8GA 3Q23A 4USIA 1HNVB 4M1KA 3ZC4A 3X3UA 2KG1A 2WSEC 4QR2A 2J8AA 3HHEA 5I3PA 1HI0P 2VOPA 2F9JA 4M95A 1HARA 2WONA 1HQUA 1SL0A 1NJWA 2D3UA 3G6YA 4WE1A 2EFOA 4C8YA 2IRUA 5LSOA 2W8LA 4UUWA 1TAQA 3BGRA 3GIMA 3RAQA 3TYTA 4RW6A 1QVFR 3PJWA 5L1IA 2YX7A 4MK9A 4NCGA 4O3QA 4JI8F 2YNIA 4MIWA 4IG3A 1ZPVA 1WI8A 1QAJA 5L1KA 2W25A 1VBYA 1EP4A 2HNZA 2MXYA 1LW0B 3GSDA 2VB6A 4Y00A 5KG3A 2GMLA 2B5JB 2ZE2B 3PEHA 5KFFA 1U6ZA 4YY3F 2X1FA 3D2WA 1LWEA 4X2BA 1D8ZA 2OP5A 2Z0GA 1VQOS 1X9MA 3R3TA 1RT3B 5DG7A 3AA9A 3I0SA 3SQGA 1UVKA 1WHYA 2VASA 2RDJA 3NNCA 2O3DA 1VQ4S 1PC5A 2HGNA 4IOBA 4IR1A 3EYZA 2ZC3A 3AJ1A 3TAMB 5HQ8A 3K57A 4EZ6A 1CLFA 4K2XA 4K4UA 2HW3A 2I5JB 3FFIA 4DSKA 4K5RA 3H2UB 5J2NB 2OPPA 3FJ2A 2W24A 1JK9B 2MQQA 3SSRA 4FF2A 3M30A 2BVZA 1T3OA 4OZLA 4DN9A 3WDOA 4BS2A 4KRWA 4JI5F 4ZPCA 1VRTB 1Z2ZA 4TU7A 4RW7B 2HNDB 3I0RB 4FN5A 3VALA 1GX6A 1SXLA 2HMIA 4O0IA 2MQOA 1FDDA 4YR2A 2XSJB 2IMWP 4TLRA 2CPZA 1C1BB 1QE1B 1KHWA 2AF6A 4NA2A 1ZTTA 1D1UA 1S10A 2FLPA 2CPIA 3N79A 3BDPA 4FF4A 3S1TA 4DL4A 1ZM3A 4KTQA 3SI8A 2PI4A 4FBTA 2MSTA 4EYIB 2XWYA 3J80Y 3JSRA 1N5QA 4C3LA 3EZUA 4HHJA 1S77D 2RB7A 4Q8FA 2E1MC 1DTQB 2DRBA 4I67A 1VBZA 1M1KT 3X1LB 2V4QA 1UVMA 3TR5A 2ASLA 4LF8F 2FC9A 4HH1A 2Q1LA 4TU8A 3SEOA 5A8KA 2MPUA 4MFBA 4JI0F 3ZZZA 4WE1B 2FGOA 5KT7A 4NLWA 3CEDA 2O01C 3IRXA 3PFEA 1FERA 3UDCA 2E7WA 2V8HA 4DX8H 1P1LA 4J5OA 3BGRB 2B4PA 2MKJA 3AY0A 5DM6Q 2MQMA 3KHRA 3L3CA 4O4RA 1IKVA 5J2MA 4C97A 2F8HA 2M9KA 3R5AA 3CCVS 4LMZA 1C0TA 2LXFA 2W9BB 1Y00A 2VA3A 4HL9A 2R2RA 2HNZB 3TA2A 4NA3A 4WFZA 1OIAA 3RTVA 5G4DA 3HK2A 1BQMB 3V6KA 2EFQA 3IC1A 3W3SA 4ZCKA 2YWFA 1XK8A 3I0SB 3IFEA 3SQGB 1S9FA 1SC6A 3OR2B 1RYSA 2HHVA 4D3HA 3DC2A 1LOUA 3OR1A 1R7IA 2VL1A 2MY7A 1NK4A 1S48A 4YFUA 2B9WA 3E01A 2AU0A 1KTVA 2FPHX 3T1YF 4PQUB 1JLCB 2HGMA 2CJAA 1CEZA 3I96A 4R8UB 2XMJA 1FRLA 1QAYA 1S9EB 4U6PA 3EUNA 4JV0A 3HF5A 2MKIA 4CCHA 2XS2A 1SBRA 4I7FA 3PO4A 4J9RA 3M30B 2K2PA 3DLKA 3Q24A 1ROFA 1XC9A 3CCMS 3GFXA 4I2PA 4DFKA 4LF7F 5F8LA 2OLWA 3I31A 1IKXA 5AJ3F 2CQGA 2DNYA 3CC7S 3C6UA 2Q6BA 1S1WB 4DSEA 4PRFA 3B4DA 1OPZA 2EVZA 2WSCC 3CJKA 4RW8A 4J9MA 1KQSR 5IQ6A 5F8NA 3FZ2A 2ZH3A 2W7AA 3M8PA 4DL3A 2YWGA 1FE0A 3TNVA 3K5MA 3BREA 2MZTA 1K9MT 4GC7A 4DV2F 4FZVA 1NEEA 3D1QA 3JSBA 2HS3A 1JNRB 2IVMA 3TUIC 1RP5A 2P9GA 3OW2R 3NL0A 4O3NA 2ZH7A 4ECRA 1DQ8A 1CPZA 3SCKE 4J37A 5D3GB