2AJ1A

Solution structure of apocada
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
71
structure length
71
Chain Sequence
MAEKTVYRVDGLSCTNCAAKFERNVKEIEGVTEAIVNFGASKITVTGEASIQQVEQAGAFEHLKIIPEKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for metal binding specificity: the N-terminal cadmium binding domain of the P1-type ATPase CadA
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
molecule keywords Probable cadmium-transporting ATPase
total genus 19
structure length 71
sequence length 71
ec nomenclature ec 3.6.3.3: Cadmium-exporting ATPase.
pdb deposition date 2005-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2aj1A00
2Q3PA 2RMLA 1RJJA 1YJTA 1MWZA 2AJ0A 1FE0A 1FE4A 2HLTA 1FEEA 3QMQA 2OD6A 3HFKA 5B0BA 3FMBA 1W2IA 3DCAA 1GXUA 1Q8LA 2OFHX 5B0AA 2RILA 2N7YA 4QOTA 2QLXA 1S6OA 2XMUA 3DXSX 1U7LA 3KKFA 1R6YA 2KT2A 1VQSA 2OD4A 2QLWA 2BYCA 1SQEA 2XMVA 5B0CA 1OQ6A 2GGPB 2AJ1A 4F67A 3TNVA 2JDJA 3HHLD 5T7LA 2LQ9A 3QGPA 1CPZA 2QYCA 2XMKA 2BJEA 2PD1A 5F0WA 2ASYA 1Q4RA 1ULRA 3FRYA 3LGNA 2VV5A 1FESA 4DPOA 2HFOA 4U9RA 1APSA 3VTIA 4OJ1A 3I9ZA 4YEAA 1KVIA 1MWYA 2FHMA 4NL5A 1URRA 3HDSA 2K2PA 2ZDPA 3BGUA 2KKHA 5B0DA 2G9OA 1X0PA 3KNGA 4ZOSA 4ZA1A 1JWWA 1FD8A 3HF5A 2LQBA 5A6WA 2FIUA 1OPZA 2K1RB 4HI1A 1CC8A 1Y9OA 2W4PA 2ROPA 4A48A 2HQIA 4DN9A 1OQ3A 3BDEA 5B0EA 2N4DA 5K9FA 2OFGX 4OIXA 3LO3A 1IUJA 2ROGA 1N5VA 3T9NA 3HHLA 4EFAC 2VH7A 4Q2LA 3KG0A 3BM7A 4Y2IA 4OJ3A 5F0UA 1TZ0A 1AFJA 3HX9A 2XMJA 1Q8BA 1SB6A 1Y0HA 2K7JA 1YRXA 2AW0A 3K7RA 3TRGA 2AP6A 1P6TA 3UDCA 4A47A 1XBWA 1YJUA 4FNIA 3BF4A 1YJRA 2BJDA 1QUPA 1VQYA 2RU9A 2XMWA 2HFNA 2IYIA 3GZ7A 1KVJA 2GA7A 2IFXA 2N4CA 3BB5A 1FVQA 1JK9B 2KYZA 3IWLA 4Y2KA 3E8OA 2K7KA 2KT3A 2ZDOA 2ROEA 3MCSA 2W4DA 3KG1A 4Q2MA 2OAUA 3MZIA 2GGPA 5KAKA 1LQ9A 5T7LB 4FNHA 3LGMA 4YDXA 4DL0C 2GCFA 3TOQA 4HI2A 3CJKB 1X7VA 3WDOA 1Q53A 3CJKA 2OMOA 4OJGA 1P8GA 1V3ZA 4Y2MA 3HHLC 1AW0A 1YJVA 1S6UA 3IWXA 5IXUA 3BN7A 1TL4A 1TL5A 2HIQA 3BR8A 2GO8A 1FVSA 2IYGA 2EW9A 2OKQA 1CC7A 2GFFA 4HH0A 1YG0A 2K1RA 5B09A 2QIFA 1TUVA 4A46A 2ACYA 2BBEA 4OJHA 2CRLA 4HL9A 2L3MA 1GXTA 2OP5A 1N5TA 3HHLB 4A4JA 2HLUA 2LXFA 1N5QA 1TR0A 5A6PA 1WD6A 1Y3JA 2FB0A 1X8DA 1K0VA 5B0FA 2XMMA 1N5SA 1SI9A 3F44A 4NPOA 2PGCA 2RSQA 3FGVA 1AFIA 2XMTA 2BUNA 2W4CA 1Y3KA 5B0GA 5B08A 1OSDA 2LDIA 2GV1A 2FTRA 4HH1A 1KQKA
chains in the Genus database with same CATH superfamily
2R7WA 4WKYA 3OXFA 5LSRA 5KFCA 5HI7A 2P6TA 4ZP9A 5KT5A 5J2NB 2XGQA 4I6YA 3PG9A 3NBPA 2KU7A 4LVNP 4PXCA 2DYAA 3H4DA 4ZCIA 4O3RA 3G82A 2MMYA 2OPPA 1BWVA 2JC1A 2QLXA 2V8VA 2XMUA 1K47A 3DXSX 4PYAA 1T11A 4ZPTR 3CCWA 4UT4A 4M5HA 3HXMA 4WKRA 4RW8B 2YNFA 3C19A 3LH2S 2QE5A 4X84A 1YKWA 4CO0A 4Y34A 3HHLD 4WFXA 4DV7F 1L3TA 3NMAA 3BO3A 5IM0B 4DWIA 3A1YG 1UP1A 2DGTA 3SIPB 2ZH3A 2CZ4A 1FXDA 2JHEA 1HNIB 3HKWA 5ETQA 2HFOA 3VHQA 4L3KA 3VZIA 4A8YA 5GMDA 4RL1A 4DL5A 1WC4A 5C42A 1Z2ZA 2HVZA 3LWMA 2VIHA 4JI4F 2BM0A 1YJ7A 3HT0A 5C42B 3DXBA 4ZPCA 1VQ5S 3J7AN 3QO9B 1LW2B 1FEHA 5KG7A 2DNHA 1FKPA 3BPDA 2E1PA 4AT1B 4IRKA 1UVMA 2ADCA 2O3DA 1Y10A 2UV8A 2HQDA 4NLPA 2PO4A 1KLMB 2AGQA 1IKYA 3ZTRA 1EETA 4BBYA 3S1TA 1FDNA 1NK6A 4I7FB 1PJ6A 4NYPA 4ECTA 5KFPA 1FJGJ 3DDKA 3OV7A 1UAWA 1N5VA 1X4FA 2FHKA 2ZVIA 4IDKA 2NYHA 8ATCB 2KM8C 3THVA 1KQSR 1NUEA 2AYMA 3HSZA 1T0TV 3KG0A 2WRMA 4Y3CA 1HR0F 1QSSA 4I0WA 3RB3A 1OJ4A 1Y0HA 3PNIA 4PCQA 1NK5A 2AW0A 4DCOB 2J7UA 3I87A 4FZVA 2A2DA 1W25A 3QWPA 4LFBJ 2F5GA 4K2XA 1ZH5A 2ZH8A 3QWUA 3IFEA 4DPWA 5KT3A 1TMJA 2F40A 4QYRA 4OX7A 2EBGA 1HBMA 2HAFA 1T9WA 3M2RB 4OYWA 1TFYA 4EO6A 4ZPBA 1X5SA 2RF2A 1LWEB 3VAKA 4DF4A 3M2RA 4WXOA 3PW0A 1YI2S 3MM8B 4I4BA 4RW4B 4GKJF 4Q2MA 1VISA 3VAHA 4DR1J 3AJ1A 2XSJA 2GQCA 4QWEA 5KAKA 2CJKA 3DRRA 2NXEA 2VPXB 3I96A 3POTB 4ZVRB 2ZJRQ 4LF6J 1V5VA 4TY9A 3MPWA 2XYHB 4AFFA 2ZKTA 3HT3A 3TQ1A 2WONB 1B0PA 5L1IA 2COLA 1ZPWX 4TU8A 3M30B 3VR1A 3CJKA 1R0AB 4JI5F 2VODA 5DQIA 1GTHA 2AHOB 1N5YB 2OEJA 5CZVA 3KLIB 4IFYA 7AT1B 2ZBCA 1Q8KA 2ZM6J 1F5AA 1O0PA 2MQLA 4DR5J 2LXIA 3Q8PB 4MK7A 3VVTA 4BC7A 5F8JA 3D6HB 2H9ZA 2ASJA 4HH0A 4J90A 1ZTTA 4TLQA 5A76A 3CXCR 1N32F 5EX3A 1GXTA 5HATA 2I9SA 3TR5A 3OUYA 1JJ2R 2MPUA 2B6AA 5A2QU 4YY3F 2EK1A 2F8MA 4CLWA 1YWXA 5JVHQ 1X4DA 4X4QA 2JFDA 1PSDA 5I42B 3CJRA 1WELA 5LL6d 3K5MA 2PGCA 2UVVA 3DLLQ 5I42A 2HMIA 3GYNA 2OPSB 2HW3A 2HHVA 4J5OA 5LOQA 1N48A 4WP8A 3JSYA 1HWKA 3A8EA 1VQ8S 1RISA 1OSDA 1V3SA 4DV5F 3QRRA 2R4FA 4MIWA 2RH3A 3N6MA 1FE4A 5FDLB 2IJFA 4DJBA 2OD6A 2XM3A 1TELA 4ED0A 1W2IA 3L7OA 4RWWA 1VOMA 3N9UC 3M6UA 2GJ2A 2XS2A 4NE9C 3CTRA 4USJC 3WX4A 4JI0F 3MEDA 1F5CA 4FBUA 2BYCA 2E5GA 3AY0A 1EX8A 1ZAXA 2KVQE 2KFNA 4NRTA 2LQ9A 2CZ9A 2VG7A 4CP5A 3KMSA 2XMKA 3TAMA 2BJEA 5H1SV 1WF1A 2E5LJ 2VKRA 5KG1A 2ZH5A 2HYIB 1FX4A 3T1YJ 1E6VA 4PG4A 4UTGA 2JSXA 1ICEB 2DNKA 3DLKA 1FRJA 4X66F 3UDVA 5F3ZA 3PIPQ 4H4MB 1OPIA 2WSCC 4ECUA 1U24A 2HK3A 1URRA 3DLKB 3PX4A 3T6BA 3GP9A 4L73A 5CXTA 1YSJA 1N88A 1J2VA 2CNOB 4C0OC 2E1AA 4ECSA 1HBOA 1UKUA 1E6YA 5KFYA 4CH1A 2E5IA 1IKWA 3SCIE 3ZZUA 3GWCA 4B08A 2CQDA 3P96A 2W4PA 5U47A 4CCHA 2DITA 4LR7A 2J9DE 1WI6A 2YNIA 5GAGU 5KOXA 4W92B 1RCOB 4ZLLA 2MQPA 1NBEB 4ZK7M 1X4EA 1S1TB 3DLHA 2YY3A 5KFNA 5DLGA 2VG6B 1NKBA 2P8IA 2XEXA 4AE5A 1VIXA 4LUBA 5DG8A 1KOHA 3LP0B 1N52B 5K20B 3H42A 1RTHA 2CPIA 2B51A 2V34A 1BXNA 4KIAA 4LJMA 2V9WA 2R8KA 5FJ4A 1T03B 1YJUA 1M1KT 2BJDA 2HVEA 1VQYA 3D9BA 1SV5B 4RPFA 1BGXT 3KWMA 1JLEA 3U1MA 5CA5A 1RAHB 1C1BB 1SV5A 2XGPA 4W98A 1JX4A 4GVBB 5SZTA 2VBZA 1U8SA 3IWLA 4YP3A 3Q89A 3HJVA 1NJXA 2CPEA 1I94J 1UVNA 2B7BB 4I2PA 3DGPB 3DU5A 1N54B 1U2FA 2IPOB 2NCKL 3IXQA 2BVZA 3TVKA 5EDWA 2VL1A 3MOZA 3GFHA 4A8SA 4DLGA 4OI4A 1AUSL 2J9EA 4J7CA 3NXZA 4KC5A 4PG7A 3UO0A 2ZE2A 1T9TA 5CYJA 5AXNA 1Y5IB 1SH0A 2CPZA 1I3OB 1RT7A 4FS2A 2ZE2B 3DU6A 2JZ5A 1M1GA 3TOQA 4DQQA 4ZVQB 3IO1A 3JSBA 1IBLF 2B5JA 3D6FB 4USHA 2Y8YA 4OJGA 4DLEA 3LAKA 1AW0A 4TKTA 2HS0A 3CDAA 4RUHA 5C25B 1TV6A 2AKWB 3EVOA 3GPAA 1QM9A 4LR8A 5C25A 2GHWA 1TV6B 2FZCB 5L38A 2IAJB 3ISNC 1JMTA 2LVWA 4QBUA 3BR8A 3OFEA 5I3PA 3HK2A 4WJBA 3HO1A 1CC7A 2HFSA 2AF6A 5DS7A 4J37A 4CO1A 4E2FB 6FDRA 5IQ6A 2Q1LA 4NMXA 4F4AA 2BANB 2B4PA 2O5DA 4IFVA 3HHLB 3PJWA 3M6XA 2MQNA 4M5IA 1VBXA 3PR4A 1PGZA 3M9NB 4M5GA 1WD6A 2KN4A 3MDFA 5HMZA 1K0VA 3MF5A 2VKZG 4I6AA 1TP7A 3KJQB 2G0JA 1TKXB 3EGNA 3OQ2A 1S1VA 1CJKA 3AQPA 1QAJA 4P73A 3TA1A 1IQZA 2L41A 2K8GA 2ZITA 2H5JB 3NMRA 2Z30B 1RXOB 1Y5NB 2X1AA 2CPYA 2DR9A 5HSPA 4IR9A 3SQOP 4QYZJ 1FE0A 2HLTA 4AUKA 4PQUA 2HWHA 2R2TA 2UUWA 1RAIB 2BOPA 4WWSA 1CJTA 2J6UA 4LF8F 2VBWA 3R27A 5GMEA 1DTQA 1S6OA 2RVJA 1KEKA 1TK5A 1ZM2A 2QX0A 1SQEA 3OVSA 2DNNA 3W8PA 4LSLA 2XSJB 5A8WB 2GGPB 4CLKA 1UEVA 2W9CA 2C2KB 1GEHA 2B0GA 2CG8A 4LBHA 2V4RA 4ECQA 3JQKA 4DR6J 2HS3A 1Q4RA 1HNWJ 2Z2ZA 4I69A 2MY8A 4IG0A 3RBZA 1C0UA 2HKEA 5KFQA 2WONA 1C0TA 4ZVFA 3M8SA 2JOQA 2FHJA 3DRSB 1S1WA 3UCGA 4JOUA 3LAMA 1MWYA 2HGLA 4YDDB 4U8YA 1FKOA 2AEFA 3NNAA 4U7UK 4V1Ak 1IVZA 5E3AA 1B99A 1F6TA 1PKUA 5L39A 5L9XA 3N79A 2CVEA 2FDNA 2DNZA 1XJWB 4HT5A 1JJ4A 4B9TA 1OPZA 3CDBA 2ZC3A 3WC0A 5D6GA 4N5SA 2V8GA 2ZM6F 1U6BA 3PR5B 3DHXA 2CNNB 1U1LA 2XWYA 4BWJA 4B3SJ 5DLFA 4DN9A 1OQ3A 1R27B 1R89A 2DJWA 2HFUA 2LLZA 1O51A 4KT0C 1S9GA 2QFJA 2H51B 1NXIA 1LXNA 2GVDA 4NLVA 3J81Y 1YTYA 4CI0B 5E3CA 4OJ3A 2M4MA 2DXEA 3D68A 4DOZA 4QIGA 2HVIA 1P27B 2LU2A 2IVYA 1KVKA 2MKHA 2AP6A 1H0HB 1OYDA 3A8KA 4RU9A 1NHKL 3G6ES 3I0SB 3MR7A 1SCJB 1RT3B 2J0XA 1RHJB 4ES1A 2DH9A 4YHHF 3G6YA 1RT2B 3MCNA 2YWGA 5IWAJ 2HQFA 5KT7A 3QNWB 5D0RA 2ZJPQ 3DYAB 3IMQJ 3MM9A 5IT4A 3W62A 1XWLA 4Q44A 5J2PA 3Q8QB 1IQTA 5J2PB 4DV1J 3EMTA 3MCOA 4NEZA 4W4MA 4DV0J 5IQQA 2DGUA 3G6VA 3NP5A 4Q7AA 2CPXA 4B9UA 1I51B 1NKCA 3J81U 3F56A 1N36J 2VG7B 1YIJS 4KV8B 4WE1B 3Q24A 3RAQA 1UL3A 1Q78A 3OR1B 3VF0B 1V3ZA 3OJSA 4J9LA 4KO0A 1SC3B 1T3NA 1Y00A 1Q7YT 1H2VZ 1RADB 1FKPB 2DNYA 5CYQA 5THWA 1RYRA 4RNFA 1LKZA 1S0VA 3HJFA 3PFEA 2AYGA 1QSYA 4XK8C 3J80Y 4DFKA 3HFZB 3BGLA 1XR7A 2MKSA 2PIIA 4CZCA 4QIEA 4PKDB 3D6TB 2ZZMA 3Q2SC 4TVAB 4ZVOB 2VDHA 1NDKA 1X4AA 3VQSA 3LP2B 1QAXA 1UW4A 2DHAA 2H5EA 2LQ8A 2R7OA 2DNLA 2WCXA 3DOLB 2KI2A 3HZGA 3QIDA 1U1NA 2HLUA 5KFWA 1Y3JA 4J9VA 4DPUA 2DNMA 2HRUA 3CUNA 2QA4S 2MKIA 3T5KA 2R7TA 1FJCA 4CT9A 3IGNA 1ZZFA 2H4YB 5H9FK 1IBMF 3F44A 4OYXA 4USIA 1B0VA 1GTEA 1QE1B 3OXGA 4Y65A 5E3PA 5BYQA 3KHHA 3VV2B 1M5KC 4JYAJ 4OYZA 3PYGA 1Y3KA 1RAEB 1TVRB 2B4OA 2DNRA 4PPDA 1HHSA 5IWAF 3CF5Q 4K4TA 3MPUB 1SJFA 2LDIA 1HWLA 3UWTA 3GG1A 3KJVA 3D2WA 2B56A 4LFCF 2V63A 3KJVB 4S0MA 2DXDA 3JSMA 3PJ9A 2KTQA 1S79A 3G96A 2JLGA 3I9V9 1VDHA 4ITSA 4LFCJ 2J0SD 4B17A 3I0RB 1S57A 4CLTA 4FKXA 3PTWA 2CNLB 2KXFA 1QVGR 3ET6B 4IYQA 1FRXA 3AB4B 3M6WA 3Q23A 2P9EA 1P9YA 5CH7B 2YQ3A 4IOBA 3DMJA 3KLGB 4DL7A 4FF2A 4OYMA 1G7CB 4OV1A 4QW9A 2LEBA 2L48A 4IRCA 2CWKA 2PD1A 3Q0AA 1S9EB 2JH3A 3O6QA 4OV6A 4OI2A 2XI3A 5FLXY 4DPOA 5ETNA 3KHLA 4IG3A 1VR6A 3CDUA 4U9RA 1DAXA 3OFGA 4OJ1A 1L3KA 5A8KB 1NDLA 4LF2A 4YEAA 4IFYB 4B3RF 4YB6A 4Q8EA 1UPMB 3PHEA 4F3QA 1LNQA 2B8QA 3V6DA 3OHBA 1IKVB 1U48A 4LF4F 1JWWA 1ZA1B 1FD8A 2Y0SD 3M8QA 3WZ0A 5L1LA 1YDLA 2LQBA 1H38A 4FDFA 5C24B 1X0FA 2K1RB 2VG5B 2BM1A 3W7BA 4ED2A 1RDRA 1IKXA 3W3SA 5D8HB 3TAQA 2V2KA 1QUVA 4EYIB 2ASDA 3TUPA 2YWEA 3BDEA 3EDRB 3H5YA 3MAQA 3ZZZA 1KHVA 2OMLA 1HARA 4DX7A 2ROGA 4NI2B 4JB8B 2XNQA 3HHLA 3W65A 4PRFA 2IC3B 4DR3F 5HLFB 3DLEB 1JJCB 4DI6A 2QA4G 2OH2A 2PMHA 4F2RA 1A0OB 3FC9A 3KOAA 3DLEA 3TJ9A 1X4GA 2KL8A 2QEXS 3PM9A 4Y00A 5AE2A 2AJ4A 2ZH7A 2ZD1A 1TK0A 1EQ0A 3TO8A 2EKYA 4L74A 3HM9A 1QY7A 1GMVA 1WEYA 5H9FJ 4ZHRA 1RBOB 2IDLA 1UJ5A 3GILA 2C2OB 4P72A 2BKOA 1FFWB 2HPUA 4DHVA 4ZHRB 3UR0A 3PKMA 1KVJA 2O66A 2R42A 3FEYB 2R7QA 2FZKB 4YHHJ 4ER8A 1RBLA 2G1HA 2P5VA 4TYAA 2VONA 4DL2A 1DZ5A 2RAQA 1M5PC 1N56A 4MK9A 2AGPA 3MUMP 3NWGA 1RABB 2B4UA 5L1KA 4V19X 4UOFA 4DR2J 3RGIA 3CIMA 1KTQA 4PQAA 1UEKA 2B43A 4ZCMA 1S77D 1NB7A 4FYDA 1X5PA 2DGVA 2GMLA 4DN0A 4CLUA 1K9MT 4PG8A 3B6BA 2RNEA 2HRYA 4ID5A 3T5JA 4JBCA 4P74A 5C2GA 4PYDA 3GJQB 1JNZB 2YNGB 3PKYA 4NLGA 1SIWB 4RNOA 3H25A 4J9MA 4OI1A 1JLGA 5KG0A 1SUQA 4RBVA 3CDWA 2C2MB 3LPEA 2W9BB 5L9NA 1WC5A 3KK2B 2PEHA 4I6WA 1N4LA 2V8PA 3NGRA 2EVZA 2D69A 5B09A 1WHVA 2DBBA 3M1VA 1M5HA 1HBUA 2XMAA 4C8LA 5LMNF 4HL9A 4HR2A 4RO0A 5D0HA 2DRBA 1U1MA 3CSKA 2LQ5A 4A8OA 5HP1A 2BQRA 1X8DA 3D7SB 2QLFB 4RW6A 1PC4A 2HNYA 1RTHB 3KG4A 5GADI 1CVJA 4TY8A 2KYXA 3NNHA 3DRPA 4CO2A 4F8RA 4TY8B 4P71A 3Q86A 4USMA 2DRDA 1S49A 1S6PB 5EX0A 5JXSA 3TQEA 3HP6A 1P9QC 1HI8A 4M1KA 2GV1A 2Y1JA 4NLDA 4LF8J 1HMVA 4DV6F 1C1CA 1RT3A 5K5MA 3IA0A 2J7WA 3ZTSA 4JV2A 2PN6A 4DV1F 2HHQA 2BKPA 1C1CB 5D4OA 4UOHA 3HVRA 3CB4A 5BYRA 3QJLA 1ZAVA 4RJVA 3TWZA 2NPIA 4B3TJ 2JWNA 4YS2A 5IT9U 1HW9A 1LWCB 3L95X 2V67A 5DQGA 1FA0A 1IBKJ 2WHOA 3V81B 3X1LB 2OJ3A 3HSDA 2YNFB 1IBCB 5T7LA 5IM0A 4J9RA 3L4BC 2PA8D 4NLXA 4CO5A 4DR7F 1CPZA 4UZCA 1BQNA 2PFFB 1X4CA 1EP4A 4ILRA 3VCDA 4K0KJ 1VK3A 3O8WA 1FDDA 5T14A 4H4KC 5BR8J 1ZOTA 4NL5A 5M2PA 5JVGQ 3QO9A 5IS2A 3TANA 1X9WA 2ZDPA 3BBCA 4QU6A 4QCLA 2IAJA 4F3OA 4ZOSA 3RR8A 5HQ8A 5LJ3Y 1TL7A 3AH6A 4BC9A 1KOOA 2VBXA 2XLIA 1RAOA 3Q83A 3CJ2A 3KXDA 1W7WA 2ZKUA 3C15A 5FIIA 4OZ5A 4IFVB 2KXHA 2F4VJ 1WHWA 2JLFA 4F25A 2UXDJ 1IWGA 2LU1A 4DV5J 2DIUA 3MEEB 3NKYA 2E44A 2ACMA 3MTKA 3ILJA 5K9FA 4OZLA 3M2VB 3M8YA 1XMQF 2IBOA 3HZEA 3LO3A 3MEEA 3T9NA 3T3FA 1Q82T 1FTCA 3HCXA 2Z4PA 3JTPA 4LVOP 1B3TA 1RK8A 4F4WA 3W61A 4EGLA 1DY3A 1M5SA 5KFEA 4F04B 5DDOC 3FEZA 1RHQB 3FKBA 2G2ZA 4DPXA 5F9LA 4YY3J 2DGOA 2FHOB 2DD8S 5SUHA 1U2CA 5KFVA 2VFUA 4AYBD 3H7HB 2E9ZA 1U09A 4GC7A 3U27A 2OPRB 3C14B 4KFBB 1WG4A 1JNRB 4WIIA 3UD5A 4N7TA 2VFVA 1UFKA 1SIZA 1LWEA 4HDGA 3RG6A 2FJWA 4C48A 1HI1A 2PFDA 1DTQB 3W5XA 2MSSA 3ENWA 3GLJA 4F02A 1PG5B 4U6PA 4MH8A 4ZVPB 3MM8A 2R2UA 4PR6A 3DRYA 3MD1A 4M5JA 3KLEB 1VQPS 5IV3A 4DL0C 3NRBA 2H54B 2CJXB 3D3CJ 1VC0A 2HURA 2DPJA 5HN0A 2OSQA 2ZWOA 2GAHC 4WP9A 2KRRA 4I1TA 1UETA 2JJ4D 3HVTA 2VDIA 4Y2MA 4LF5J 2FC9A 3O3LA 4N8OA 4GKKF 3A8IA 2EG1A 3HVTB 3NGSA 5A8RA 5IXUA 3QLHA 1MN7A 5F41A 2UVWA 1OWXA 3T41A 2XZDB 3MMBB 4TU9A 3IBWA 4KAIA 4F4KA 5HVHA 1D8ZA 1GX6A 1NRKA 5KFLA 2MLZA 1M5OC 3J80U 1FI4A 2DT9A 1Y11A 2GFFA 5ETTA 4MTPA 2CVIA 2K1RA 2VG5A 1LW0A 2J76E 1LWFB 3NEKA 4OYAA 3D6MB 3KNAA 2HHTA 3CJTA 2ZNZA 2DNOA 4DBQA 2I2YA 1HFEL 2C3MA 3HPOA 3D54A 1JXLA 4U8VA 3JSRA 3QIPA 3C46A 1UFLA 1Q79A 2XMMA 2W25A 5F8GA 1S6QB 3OL8A 1WSRA 4DR1F 3J7YI 2V4JA 1RWWB 3TZXA 3MXHP 2IMOA 3CCRS 2LXUA 2W7AA 5KFXA 5LT5A 4A8KA 2QL9B 4LFAF 3C6TB 2DIVA 3MTJA 2HBRB 4NLQA 5B08A 2YPZA 2DB1A 1Y5LB 1CBKA 2NS1B 1BHNA 1QSLA 4DV2J 4B9NA 2FLLA 1FEEA 1REGX 2F8HA 2CJ9A 1JLFA 3FMBA 3NS5A 1KRPA 5GADU 1VCTA 1GXUA 2FJDB 4IQXA 4K2JA 3UD4P 2W01A 2C2ZB 2N7YA 3K89A 3FQLA 4KY3A 4OZ2A 1YJWS 3TVYA 5KFIA 2DRAA 2D1CA 3R7BB 5ETMA 1HWIA 2GS8A 1FK9B 3TUJC 5K8MA 3A8JA 3MCMA 3NG8A 2A6MA 5D0EA 4YN3B 4YUDA 1WNEA 1G2EA 4I56A 1HA1A 2L9WA 1EAYC 2I38A 3UQSA 1VQ4S 2J6TA 1TUGB 2YNHA 2FHMA 4U96A 4N41A 2DR5A 1Z1ZA 1F60B 4H4MA 4NCGA 3KLHB 5D0GA 4WZMA 2M9KA 2FVCA 4DUYJ 4PG6A 4DG1A 1Q8IA 2HZCA 3DN9A 1TFWA 2KZMA 1G1XA 2XYPB 3HF5A 4OFZA 1FNMA 4DQSA 2RQ4A 4B3RJ 1PYOB 4KE5A 3PJXA 1X5TA 1JLBA 5J1NA 3HHEA 3NGDA 4BDPA 4P10A 3HMJG 5DDRC 3M9OB 2EFQA 4ELVA 1MNEA 1JLCB 2PC6A 3GJSB 4RW9A 3SQGA 2MZ1A 1R0CB 2VH7A 4WFAQ 3DKDA 3GTYX 3GYXB 2BR0A 3IBCB 1TZ0A 3GMGA 2OELA 4OX8A 1DHMA 2BE2B 1RLDA 2RHQB 5D78A 2M3DA 2ZBRA 3FVYA 4QW8A 1Q0NA 3OLBA 4PG5A 1WEXA 3IRWP 2FPHX 1DRZA 2BW7A 2RS8A 2Q66A 1H98A 3MAHA 3MR5A 3Q22A 5G0RB 2IYIA 1HL6A 4K59A 3ELHA 4LBPA 3D0HE 5D77A 1RWPB 4EWTA 3TZZA 4ECRA 4DFPA 3W66A 1VJQA 2WB1D 3DGPA 4LREA 1D1UA 2HVDA 3M32A 1HKAA 4DV4J 4LF1A 2VBYA 1MWQA 3TA0A 4RNMA 3OJUA 1KWMA 1EARA 1T9UA 3CD7A 3IAM9 2BABA 4I2PB 4ED4A 1FRLA 1AZSA 2HNZA 4BLGA 4WCEQ 2PMZD 3KLGA 1QLNA 2N3LA 1K73T 1HIYA 2MZJA 3GU0A 3MM6B 3W63A 2F7VA 4LFBF 4ZLPA 3BEGB 3V81A 1WKKA 1RT7B 4K4VA 2LYVA 2KZZA 1ZM9A 1WHXA 2DPIA 1DURA 4KHPJ 4CTAA 1CS4B 4DS5A 3HKZD 1YJVA 4DUZF 3RB0A 4X2BA 3IWXA 4F4XA 3AT1B 1NZAA 4F0HA 1RTZA 2HFVA 1D9DA 1NU4A 2J5AA 3EPGA 3PXGa 3I5BA 3ZTOA 3B4MA 3WBZA 1BD6A 4QPXA 3KLFB 3CCES 3CC7S 1XMOJ 2JNJA 1YK9A 4LF4J 3HSJA 1ROFA 1DQAA 3NWRA 5KG3A 2Z0GA 5AE3A 1EETB 2ACYA 3PACA 3UI3A 3IS9B 1S1UA 2VC1A 3W2VB 5F8HA 1EIYB 4X4VA 2CZVC 1HNZJ 3IS9A 3H98A 1RWOB 2ZC4A 1JB0C 4KSEB 3KK3A 3I31A 2M2BA 4QZVB 4AQYF 3WX8A 4DV7J 3RB6A 2M5YA 4OI0A 2HIYA 3R5GA 1PAEX 1TL3A 1VLOA 2Z8QA 3GFXA 4ELTA 4N56A 3CMES 2NXCA 2NZCA 2YBVA 3F0NA 3IR5B 3K59A 3UNGC 2R8IA 4USKA 1NPPA 1CJVB 5T41A 4DL6A 2G0CA 4HH1A 2K3KA 5E2QA 4ECYA 1KR4A 1MSWD 3TZYA 5L1JA 4FYYB 1CJTB 3H0PA 4KBIA 2HHSA 1VRTA 3UN5A 1RBAA 2RQMA 3KHRA 1S99A 3CMQA 1A6LA 2RF2B 5AXKA 5J1EA 2R7SA 1LXJA 1RHKB 2OD4A 3W2WA 5E3QA 3DOMA 4A8FA 2YKAA 3TJ8A 4RUBA 3FMWA 1WACA 1IBMJ 4X62F 4QR1A 3U1LA 4ETXA 4ZP7A 3KDNA 2V2ZA 3Q8VA 4W90B 3H2VE 3LGNA 3SSSA 1S1WB 5HMYA 2CPHA 2X3DA 4F4YA 4JI3J 2LDYA 1Z2LA 4TLRA 1IR1A 1C0UB 3VTIA 1U2RA 1REVA 2ZBIA 4C8YA 3L7PA 3MMAB 2D9PA 2PE8A 1H73A 3KLIA 4QYZK 4ZA1A 2GQ2A 4ECZA 1RA7A 1U47A 4UOGA 3L09A 3CW2C 3MMBA 1FERA 3PHTA 4LSZB 1GH8A 1HYSB 3M1VB 4HI1A 2C42A 2W1BA 2ROPA 2RB7A 2ZHOA 4QPTA 3BO2A 4ZVUB 2ZHBA 4QWAA 4LRAA 1T7PA 1M1HA 1U0HA 5AE1A 4DPTA 3C6UB 2E1CA 4RLEA 4TYBA 1QDUB 3BN4A 3DC2A 3IC1A 5AT1B 1S7HA 4IH7A 4USTA 5ETVA 3ONQA 3QIPB 3QT7A 4OYIA 4A8MP 1S6QA 2K7JA 2KDOA 3HD1A 1EB0A 2POKA 1S1XB 4PXEA 1S0NA 1YBTA 3LW5C 5CYMA 4EBEA 4H4KA 2J7KA 1FNOA 2GMJA 2VF3A 5CYMB 1ZM4A 4NXNF 2RE1A 2ZZTA 2MHNA 3O44A 4I68A 3FEXB 1IM6A 4BWMA 2N4CA 1HPZB 2MLXA 3TW0A 2BJ8A 2ZEJA 3KDOA 1WOSA 2KYZA 3QSIA 5KFKA 4YB1P 3OL7A 2OEKA 1UWBA 2GMHA 3TEHB 4O3SA 4O3PA 1NK7A 4NWBA 2XC9A 3S6EA 2ILYA 2NR0A 2IHR1 1HNVA 4B9SA 3KTQA 4H4OB 3UDEA 4QWCA 3LWLA 4X4UA 2GJFA 4NA2A 2AEMA 5KFJA 2VASA 4YDXA 2DY9A 1RKJA 2DO0A 2APOA 1GX5A 2HHUA 3DI6A 3BQ2A 1MN9A 1PC5A 1FFGB 4ZVSB 1I1GA 3E3XA 4ID8A 2EFVA 3RUBL 5C7PA 2SXLA 3OTOF 4KJIA 4WE1A 5IT9Y 2DNQA 5I3QA 3AHPA 4O23A 2YX7A 2Z2MA 3CJ0A 2UV8G 1YHQS 2YKOA 3MR3A 1ZS6A 5HJXA 1FJ7A 2LA4A 2D3UA 1URNA 4OX9J 1HQ2A 3CJ5A 5GAGI 2HIQA 4DFMA 1XTZA 4GKKJ 3D67A 4NXMJ 1WDTA 3OTEA 3EM1A 5CD4A 2MGZA 3BYRA 3K58A 2Y0BB 3SFUA 3J7YU 2C2NA 3BYPA 2ERRA 3VQTA 1SH2A 3OBIA 4A4JA 1FDBA 2WBMA 3UCUP 4CNZA 2H48B 5ETOA 2AZ3A 3SI8A 5KFZA 4FXDA 2V0NA 2NXUA 1IXKA 2W2NP 1JXEA 1QE1A 4CNYA 1CULA 1H72C 5E0OA 4O0IA 3RAXA 2FJAB 1D8YA 2BE2A 2A1BA 2BJ3A 1AFIA 3TJAA 5LXYA 2LQJA 1OMSA 2WZ1A 2ZOFA 4KHRA 2AX1A 3M05A 4LQ3A 3M4XA 2VC0A 1DLOA 3FNNA 2UUBJ 3MECA 1KTVA 1MWZA 1GK8A 1LFWA 1VRUB 2W2QP 3P45B 2UUCJ 3V2UC 4EZ6A 4RW4A 5ADZA 2ATCB 3ET6A 4NLOA 4CLSA 3BQ1A 2H3EB 2ZOGA 4L6V3 3CCSS 5DRKA 3R7NB 1FNXH 1BWEA 2YKMB 4M5DA 1NK4A 3LPYA 3ZO7A 3KLEA 4XTTA 3POTA 1VC6A 3B78A 5CCLA 2XZWA 4PXBA 1U49A 2AJ1A 3G6XA 4HACA 3V4IB 2YPYA 5DJBA 5F0WA 3DLBA 2R7XA 3M30A 4WFYA 2FLNA 1C4CA 1WC3A 2HQCA 1SC1B 2XHCA 2XYGB 2BZ2A 1YQHA 2KM8B 4R25A 3RR7A 1R31A 1XNRJ 4E8UA 1RTJB 3CMAS 4ANDA 3V6DB 1MW7A 4Y6IA 2NLWA 3JTOA 5I3UA 5ETSA 2NPFA 2W9AA 3ZNJ1 1U1QA 4K50A 3GV7B 2XQCA 3JYTA 4O3QA 2GQQA 3CD6S 3LP1B 3JYTB 1CQMA 1FRIA 2IJNA 1KN6A 5DM7Q 2DHXA 3FSXA 3KLVA 4U7UD 1YRTA 2GIRA 2FQQB 3SV4A 3SXLA 1CSJA 2MZQA 4LRBA 3VAJA 4HHJA 4KYZA 1JLAA 3W2VA 5IV4A 3PIOQ 1OY8A 3T5LA 1IBLJ 3SZ2A 4OZNA 1KQKA 2JEGA 4JV0A 5M2UA 4O44B 4O3OA 3BQ0A 2OPSA 4WBFA 1SB6A 1SH3A 3RU0A 3CO9A 3BSOA 3QQCD 2ZD1B 3GIRA 1MMNA 3BH6B 4UUXA 3LA0A 4DXLA 5JUMA 1DTTA 3WIUA 5C2CA 1B0TA 3K5PA 2BV3A 4NX9A 2MJUA 4XAKA 2R3VA 4HLBA 4CT8A 2KH9A 2B8PA 4JI2F 2GA7A 3K17A 3M8WA 2UU9F 3BB5A 1RTIB 1FVQA 4IH6A 2BE7D 4MMOA 5LJ5Y 3MURP 2J0QD 4LF7F 3D66A 2Y1RI 3H5XA 1G4CA 2KT3A 3B54A 5KFBA 1DQ8A 1XN9A 3PX6A 3N28A 4JI1F 3WIVA 4K4UA 1BMQB 3G86A 3VZHA 3GONA 4EYHB 4DL4A 3N4WA 5KFAA 3FUYA 1NJIT 2MEWA 4HYKA 2XY7A 2CQPA 3K2YA 5D4LA 1R7IA 4ENOA 2I5JB 4MJKA 1X9SA 2MQ8A 1RWNB 3AA9A 2QG9B 3I5CA 2Y1LB 4NLWA 1WDDA 1L5UA 3BSNA 4LF9F 4B3MF 2XO6A 1NHVA 1RQ0A 4LRFA 4PPZA 3KK1A 3P4UB 3LUYA 2M8HA 1RHMB 3R6GB 4X65J 3ZNUA 2HFZA 5HMWA 2BRKA 2Y1IA 3RTVA 2OKQA 1RT5A 2ASLA 4IUFA 2W9BA 2QTWA 4Q0BA 2HAIA 2CJQA 2QIFA 1S1TA 2D3O1 1R8CA 2HBZB 1VQKS 3SQGB 1UA0A 3A4TA 2LXFA 4QWBA 2Z2LA 3EWGA 4J9QA 1KQFB 3WQPA 3VAMA 1SXLA 2FJVA 3I4HX 4M95A 2VQFF 3GIJA 4ANEA 1HBNB 4YR2A 4NPOA 2JEIA 3QPIA 2VQEJ 2RSQA 1OS5A 1DJ0A 1HBNA 1S6PA 4CLYA 4DZDA 2JRSA 2W4CA 2WVCA 5DG7A 1RB0A 3PDNA 1TUWA 3W1YC 2AZ1A 3EE3A 2CUYA 2EFPA 2Z2YB 3L3CA 2FTRA 3UNYA 3CE8A 2Q3PA 2RMLA 4A8XA 2PT0A 3NBPB 2MSTA 2XHWA 1RWUA 1Y4ZB 3UPFA 5CAAA 3BV8A 3I56S 1KDNA 1NPRA 1HPZA 2OPPB 4IKAA 3HVAA 5J2NA 5LSOA 1AZSB 1SPBP 2HNZB 1BQMA 1NSQA 1FWKA 4OYPA 4ZJLA 1M90T 1HR0J 2HHXA 2QLWA 5BR8F 4GC6A 5B0CA 4F67A 3H2LA 2VQEF 3R5DA 3D1QA 5HVFA 2DHHA 2CKWA 5I4MA 2ASYA 4M63A 5FLXU 1J27A 1MMLA 3TX0A 1RWXB 1BQNB 3SV3A 5J2QB 1PBUA 1HNIA 3EDQB 4PWDB 1IBKF 4A8QA 4ZS6A 3BGUA 2V4QA 4NASA 4PUOB 5KFSA 1UEUA 1RE1B 4PUOA 3R6LB 3K5OA 4ZVHA 1X31C 4JP8A 3AD9C 4PAAA 2OI2A 2OO4A 4EBDA 3K57A 4ES3A 3NCPA 1MU2B 1RT4A 3CDEA 3I4PA 2UUBF 3C15B 3OL9A 4LF7J 1XMBA 3S01A 1MU2A 1OYEA 3RBXA 1SJ4P 4I2QA 3P49B 3MD3A 4B3MJ 3KK3B 3FBFA 4Y2CA 2XULA 1ZM3A 4O0NA 1PILA 4B3OA 1V5IB 3JQJA 2WSEC 3BM7A 2HWIA 3PYDA 4X4TA 3SFGA 4NCBA 5KFUA 1TAUA 1RHUB 1AFJA 4MIBA 3KJNB 4RUAA 3ISND 3ADAC 1YRXA 4DS4A 4UOCA 3W9JA 4AL6A 3MPVA 1PJ5A 2M7SA 3MAAA 2WOMB 1S48A 4ZLNA 4X64J 3BBBA 5D4NA 4H54A 4M5MA 1VQMS 2CDQA 1VQ7S 2DR8A 2FLPA 2R8HA 1DLOB 3JTNA 1XMQJ 1KQGB 2V6AA 2ZBQA 1L3VA 4EUVA 3OTCA 4JI2J 1XR5A 3E8OA 3UN3A 1FD2A 4RZRA 2GC8A 3DOMB 4C3KA 2EC0A 3MZIA 3HHDA 1XNQF 1VMBA 2GGPA 1CG2A 4FVCA 2VJUA 2CAJA 2FLOA 4NYZA 3M7VA 1D09B 3OTDA 3R7SB 4WZQA 1RTDB 3B82A 3J81j 3CULA 2FD2A 3E51A 1C2PA 4N77A 1LOUA 3UR3C 3CJKB 3K8WA 5KG2A 1R0AA 4DR4J 2X7IA 2HS4A 3FZ2A 4U67Q 3UW1A 3CT9A 1F3VA 3D1HA 1KC8T 4OI3A 5CCMA 3TAPA 1J5EJ 1J5OA 3P6YC 3DNCA 3ZTQA 4DUTA 2WBRA 2Q79A 1UCNA 4FXWA 4ZVGA 2DR6A 4B3TF 1HYSA 2OPQA 1IWAA 4EZ9A 4ZN3A 2IDEA 3HVWA 4DMZA 1R43A 2W2OP 3LP1A 2BBEA 2LEAA 2AJ2A 3UN2A 4D3GA 3OUYB 1S9FA 2DVIA 3QT6A 2GVDB 3THPA 1VC5A 4LIWA 2F1FA 5IZHA 3R2CJ 5A6PA 4L3NA 1KP6A 3BO4A 3GSIA 4XO0A 1MROA 2B6AB 4OHXA 3UE2A 4OLOA 5ETKA 3IM9A 4FYWB 5HROB 2Z57B 4C0HA 2PEBA 4OMFG 2NUHA 4RUCA 4L72B 2RHSB 5K14A 3ILLA 2V50A 5HROA 2MQQA 5B0GA 5K14B 4J9KA 1M0SA 2B4VA 3ISZA 2ZWPA 3SSQA 4USUA 3HSGA 3R97A 2MZRA 4F7VA 1JLFB 4KGVB 1BY9A 4FYXB 3V6KA 1NNDA 1PCAA 1WKJA 2RILA 3CC4S 4H4OA 4OYBA 2XZTB 5E7OB 2F63A 3HHKA 1S72S 3N0VA 1OQ6A 2MQMA 4G1IA 4FKYA 3PEHA 4UW2A 1QTMA 3IGVA 3GQCA 4ILLA 3BGOP 4JI7J 3HD2A 2GVZB 4DX5A 2IJRA 2I5JA 2LMIA 5I3UB 2ZH6A 1NSKL 2GVZA 2D41A 1B4SA 1NH8A 3Q8YA 2IM2A 4O3NA 3W9IA 5GMKa 4QU7A 3GFZA 5DG9A 1JIHA 3G4SS 4ECXA 3T1HJ 3T5HA 1X0PA 2NSCA 2VA3A 1DARA 1HQEB 2IVMA 4DV3F 2XS7A 1JLGB 3FBBA 4N8NA 2QL7B 2V2VA 4GKJJ 3H8YA 4MK8A 3CO0P 3FCWA 1PBAA 1SJ1A 3A13A 1TKZB 1RT5B 2QA1A 2N82B 3L7UA 4P9SA 4EU0A 1HNWF 1W2BR 5HBMB 2A0FB 2O67A 2WB4A 2QC3A 4DCPB 4EFAC 3CCLS 2X51A 2EKNA 3AOBA 4HTIA 5MAOA 1I6JA 4UZBA 1SQFA 1NDCA 1R8PA 2R2RA 3EICA 2F3JA 4NRUA 3T1AA 1T03A 1H6KX 1V3RA 4UY8T 3H5UA 4A47A 4FNIA 3FFIB 2LECA 3U1NA 3KMQA 2ILZA 4YB7A 1VRUA 4EEYA 2XO7A 2D7SA 5EUHA 3JSMB 3GJTB 4UQGA 2QT7A 5AXLA 2KFZA 3G87A 4X4PA 1Z4UA 4YQWA 1UJ4A 1N0UA 4Y2KA 4NXNJ 1H3DA 4OL8A 3GFYA 4E98A 2KJVA 2LP4A 5L46A 2ZH4A 1J5EF 1O6XA 3D0IE 4LSNB 3MM6A 2OTJS 1UVIA 3BR9A 3PY8A 1UTAA 2FY8A 3VGTA 1F9FA 3RRGA 3OL6A 3NAIA 3AJDA 4NCAA 1VFJA 3IRXB 4C11B 3NL0A 4O4GB 2JL9A 3QATA 4MAKA 5ETLA 2WSFC 3DHWC 3M8PB 4WF9Q 1F3FA 5KFGA 5LSLA 5H9EK 2XY5A 5BXIA 4ZPAA 1UVKA 3MEKA 1F9EB 2M70A 1NK0A 9ATCB 4CLLA 5J2QA 1VBZA 1S6UA 2XTJP 5E33A 4JV5F 1S4EA 2V5HG 3BDPA 3KLFA 2X1BA 3NGKA 2MQOA 4TQSA 2FVPA 4QJVA 2D3ZA 4G1QB 2R8GA 1KNZA 2HBYB 5C24A 2KVIA 2VPZB 1NLKL 4YR3A 4I67A 4WPAA 5CZXA 3TZWA 2EW9A 3EUNA 2FGOA 2H1YA 2ZH1A 1SKRA 1S1UB 1EKSA 3TP2A 3EVWA 4OJHA 1RT4B 4KH0B 2D74B 2BJ7A 2L3MA 3DFEA 4PWWA 3VWSA 1K44A 5C5JA 4JI3F 5DGAA 2QO3A 2GHPA 3FBCA 3CPWR 2JEJA 3M2VA 2KJWA 3QBCA 4MYUA 3AFGA 4C3LA 3M6VA 3I55S 4JI7F 5B0FA 2UVRA 4QQBA 1UW9A 4IQMA 1ELOA 5KFOA 4G3IA 1XNQJ 4JYAF 3O2IA 1Q7LB 1SI9A 1IM4A 3VAIA 3DLGA 3BJYA 3MMCB 4NZ7A 1U1RA 3RB4A 1ACMB 2OUGA 1S1VB 5HQLA 1B7YB 5KFHA 3H4BA 2E66A 2AEJA 1I94F 4E0DA 4MIAA 5EGYA 1U6ZA 2CJAA 5EWEA 4PQUB 1R0BG 3M8ZA 2BACA 4URQU 3PYFA 2HQ3A 3UD3P 1T3OA 5F3TA 1S0OA 1TAQA 5B0AA 3PO5A 2FJEB 2K3IA 2YWFA 3OTBA 1U7LA 3MM5B 2J8SA 5K8OA 2DR7A 2NREA 4IOAQ 1RWMB 3W2WB 3M8RA 3VVUA 1NSAA 2DCLA 4FP9A 5G4DA 4DUZJ 4K7QA 4R0EA 4TNOA 1ULRA 1T95A 4HHUA 3SEOA 3TI0A 1K8AT 1RTDA 3DRSA 4ICLB 1YBAA 3QJPA 4ED1A 1UA1A 3QRQA 4NZ6A 3QZ7A 4U95A 1YZ6A 3C66A 1RT1A 3IR6B 3HDSA 3MMAA 5HL7Q 2QFIA 3U02A 3N6NA 1NMEB 2ABYA 2DEIA 4JI8F 1REVB 3NOGA 5AJ3F 3KNGA 2M0GB 3K0JA 4DEZA 2FVQA 1WC1A 1RLCL 4C4WA 1FF2A 2HBQB 1SVDA 2MZTA 3JQMA 2UUTA 2EFGA 4K5SA 3TUIC 4TQRA 2Q43A 4ZIWA 4Q0BB 2E5HA 1SC6A 4DSLA 4YB5A 3GIMA 1S9GB 3T1YF 1VJWA 2P9CA 2BXJA 2E5LF 2RDIA 3T19A 5HP1B 2UUAF 4KHMA 2ZZNA 1FXRA 1F2HA 2GIQA 1G6BA 3OXLA 3MI7X 4HTJA 3BKFA 3CD0A 4DX6A 2MKJA 3WHIA 8AT1B 1H7XA 4IOCQ 4RWXA 2G2YA 3LF0A 4O4RA 1RAAB 4M5LA 4CLZA 2CG4A 2XMJA 4YMEA 2VHGA 1CQNA 1EHWA 2E7XA 3TVZA 4PZVA 4QWDA 1JQGA 2V4JB 4MKYA 4IH5A 3RW7A 4C8OA 1V9OA 1WG1A 1U02A 1XBWA 3OR2A 3DM2A 1QUPA 2RUGA 2IVFB 3ZZRA 2HMIB 2F9JA 5DDQC 1UPPA 4QR0A 4LT6A 4OZ3A 3GZ7A 3KHGA 3GR0A 3LGHA 4LQ9A 2C22A 1N33J 1EQMA 4DU7A 3US5A 2C2DA 1JK9B 3CIZA 4URSA 4YR0A 3G82B 1WF0A 1D3WA 3ENQA 3ENVA 4P2MA 2ZDOA 4WK1A 2ROEA 4C3MA 5KG5A 1EZZB 1UWBB 3N6LA 1K1SA 1HQUB 5DZ6A 1JXVA 4B9VA 1TQLA 2QGFB 2MY7A 2ZNYA 1HNXJ 5T7LB 1RWKB 2XBPA 2YQ1A 1FRMA 3MEDB 1NCLA 4CLFA 3MFIA 1NK8A 2DGQA 2MHEA 1QAYA 1UJ6A 2GO9A 3KYLA 1NKEA 1KS2A 2LKZA 2B9EA 4C7QA 3OSPA 3W8GA 4C6AA 2MXYA 4KKOA 5GAHI 4WP3A 2C1EB 3HFVA 3IBFB 5CABA 2R9LA 1VQ6S 1YX2A 3SCJE 4DR6F 2CWXA 2DH8A 4RX6A 1ZBTA 4UF4A 4EBCA 1TKTA 2HGNA 1ZZNA 4X65F 1AROP 4JI1J 4KO0B 1XC9A 4M5KA 2YXLA 4QR2A 4ZPVR 3KLHA 3SMZA 4DG1B 2V69A 4OZ1A 1SL0A 1IKYB 2U2FA 3DOKA 1FDAA 2BEFA 4FBTA 2QJ3A 1DQ9A 3TX8A 2CJYB 1R6VA 1YG0A 3LP2A 4RNHA 1VHFA 1TUVA 1RKIA 1TL1A 3BPSP 5KFTA 3KFWX 3U7JA 2GJIA 2YNIB 4WIQA 3VAFA 4Q8FA 4P2SA 4B3OB 2KHDA 5GVQA 2CJBA 1N5QA 3NNCA 1DBDA 2F8EX 1JLCA 4RW9B 4CQ1A 1T05B 2AGOA 3UDLA 2FVSA 2ZBPA 4J91A 1NO8A 2DHSA 1TVRA 1F9HA 3FGVA 2BUNA 2W2PP 4LIRA 3VGSA 1RYSA 4N76A 5GAEI 1PYTA 3IN5A 3IG1A 2YX1A 1N33F 3FFIA 3CCZA 4C0BA 3NGUA 1HBMB 4GO7X 4A46A 3IG1B 3PX0A 1SL1A 2UVUA 3C3LA 4OQJA 3NS7B 1AYEA 2XLKA 2C2RA 2FGCA 3I0RA 3CC2S 2HHHF 3R2DJ 1XEZA 2E7WA 4G1PA 4DQRA 2JEFA 3M32B 3C8YA 4QOTA 2PI4A 2NSBA 5KFFA 4JI8J 2NQPA 2KT2A 1WEZA 6AT1B 2PI5A 2WW8A 1IJFB 3MM7B 4X66J 3DMJB 4KGMA 3FSYA 3BSCA 3DDNA 4LF5F 2CQBA 1N34J 1R8HA 1BC6A 1S9EA 3AOAA 4DR7J 2CA9A 1IN0A 3HI9A 2F9DA 5DETA 5DO2A 1WF2A 4IG3B 1SJQA 3I9ZA 2L9DA 1KVIA 2GNKA 3Q8SB 1JLQA 2K2PA 1J5OB 3ULHA 3F73A 1JLQB 1UWAA 2MYFA 2YVSA 3M8QB 2M52A 2OPQB 4OHYA 1UMJA 2OTLS 1IKVA 2XNRA 4FN5A 1IKXB 5A6WA 3R1HA 2MB0B 4NLRA 4A48A 4MYTA 1NAQA 3MPYA 2HQIA 1OY9A 3V5RA 1YITS 5B0EA 1T8EA 4LF9J 5HLFA 1IUJA 1ZAWA 1WTFA 4QIFA 4ZVTB 4Z7CA 5LXRA 2VJVA 1P1LA 1WOOA 4K4XA 4PABA 1PIEA 3O1LA 1Q8BA 4F3MA 4X4RA 4HKQA 4CWBA 3BF4A 3MMCA 4ZKAA 2CQ4A 4IO9Q 4C8NA 5FDLA 3W5YA 4TN2A 1DTTB 2KG1A 4JI6F 5DQHA 3ILIA 3QZ8A 3ZC4A 3I32A 3QGIA 4OX9F 3GV5B 2CQHA 3ENAA 2NXNA 1RT6A 2HVHA 3W60A 2ZHAA 2W7PA 2VU5A 3QT5A 1U1KA 1WKLA 1LQ9A 3THTA 3QGHA 4URGA 1EKRA 1LFPA 3NCQA 5F8IA 3GB0A 1BUXA 2C3OA 4QIVA 1YLXA 1NM2A 2FZGB 1S0MA 1WJ9A 3C2PA 2UXCJ 4ID5B 2YX4A 4GO5X 4LBIA 3CD5A 4ZVEA 1Q53A 4K0KF 3BSAA 4XPEA 4KR0B 1C0TB 2YKNB 2I0XA 4DF8A 2CQGA 2D9OA 2YKQA 3BBFA 3BN7A 1ITPA 1RCXB 4K8RA 1SUQB 2J9DA 3KK1B 2AJQA 2F4FA 4QIWD 1TL4A 3AXMA 2YQ0A 1HD0A 2RKIB 3PFOA 1Q86T 4JV5J 3EPIA 1A9NB 1NJWA 4HHHA 1JLBB 2C3UA 1ZETA 2R7UA 3GG0A 5BYSA 3KK2A 1JKHB 4OZ0A 4OHZA 2Z58B 2UUCF 2AWZA 2J8AA 1XNRF 3V6JA 1RWVB 5HQMA 1U0HB 2PMWA 1R8AA 3AA8A 3FBEA 4ZDNA 3TYTA 1WOPA 1SKUB 3PRDA 4ZIVA 3F41A 3S7RA 2DO4A 2RT3A 3RAMA 2DKOB 2EEYA 1U1PA 1WSVA 1BLUA 2HZVA 4ETZA 1VGYA 2E1RA 2E7VA 1JLEB 2JVOA 1R8BA 2OGUA 3QFHA 3CGIA 2N3OA 4EK2A 5FD1A 3OVBA 4MFBB 2NYIA 1SQGA 2XS5A 1XR6A 3K8VA 5LMNJ 4ZPWR 4F0MA 2W2MP 1N32J 1RT2A 1B7FA 2OFHX 2JX2A 4ZP6A 4J9OA 4WTYA 1PO6A 3GJRB 4Y28C 4RW8A 1HI0P 5EWGA 2ZJQQ 2Y9HA 1VQSA 4K4SA 2JFKA 1NSPA 2XMVA 1L3SA 4O4GA 2VFRA 2XSFA 3RZAA 3QRPA 5EN1A 3H40A 1X60A 3QYYA 3GIKA 2V8DA 4F4ZA 4YOEA 3QGPA 2W8LA 4DSFA 1Q95G 4NZ0A 4ZJQA 1B64A 2ADBA 2QRRA 3IAS9 2QV6A 3QJJA 1CS4A 2DNPA 2VUGA 4P6QA 5E3RA 3R5CA 3T9ZA 3W5ZA 4ATNA 1NEEA 4EMDA 2RRBA 1VBKA 1F1BB 1D9AA 5HANA 1FHTA 2HG4A 1LW2A 4OHVA 5B0DA 3G8TA 4RKUC 2VZ9A 4G1QA 4DV3J 1TL7B 4L75A 5IFMA 3EZOA 1TTHB 2U1AA 1TKTB 2XWXA 2AYEA 4HDHA 4Y0FA 2VA2A 4K4YA 1A7GE 4AXJA 2HGMA 4X4SA 1VIOA 3AOCA 2KT5A 1CC8A 1Y9OA 2ZOMA 3DOKB 3JAMY 3DLJA 4K4WA 1IR2A 3ICLA 3TARA 1Q16B 2CQ3A 2MZSA 5AXMA 1NHUA 1WG5A 2MGZB 3FDSA 4WFZA 1S5ZA 3G8SA 3AQOA 1S7IA 2WW4A 2Z56B 3AAWB 3ETMA 3OPKA 4OIXA 4I2QB 8RUCA 3DOLA 3MUTP 1S97A 5J2MB 4KTQA 4OLPA 4Q2LA 3MMJA 5KOWA 3R8YA 3FQKA 2MKYA 3OFFA 4GRSA 4AL5A 5F0UA 1N8RT 2EK6A 2KB2A 2CDRB 1RU1A 3JS9A 3MR2A 3H20A 4DR2F 5LMUJ 3K7RA 3AD8C 4XDDA 1JJHA 4R5PA 2WOMA 3RBEA 2RS2A 1ZPVA 1HNZF 1T9YA 2ZH2A 3PRVA 3QSYB 4JI5J 4ED7A 1FO1A 2AV5A 4PWUA 3MHYA 2H65B 1HHQA 3ITHB 4MKBA 3ZZOA 5KG6A 1VRTB 2J0WA 1VHIA 3FK4A 4F0KA 1HWJA 3ITHA 4KHPF 4CH7A 1K1QA 3OFHA 4K4ZA 3KJFB 2L9NA 4DFJA 4GVLA 3ZZPA 2K7KA 2FC8A 2GIFA 3BKTA 4MKVA 2RU3A 3J7A1 1LK7A 2W4DA 2HQGA 4ED5A 5CHCB 3SDEB 2UXBJ 4C9DA 1RHRB 3OLAA 2RRAA 2QL5B 3LGMA 2QLBB 1WI8A 2CIMA 3MM7A 2HRTA 2CQ0A 4ICLA 2FVRA 4HACB 3TEGA 4USWA 4XDCA 2DY1A 1PJ7A 3FZBA 3CJ3A 5CQGA 4WTOB 3GCXP 4GMKA 3J7Z5 3HLUA 3MOJB 1P8GA 4P7TA 2BDPA 1WC6A 2NZ4A 4N47A 2CQ2A 4DSIA 2EFOA 3VGUA 1N5YA 1RSCA 2XY6A 4R0JA 5DDPC 2DGSA 2KG0A 3G71S 2BRLA 2BMBA 3R9LA 2AIRB 2R2SA 1SKSA 2IBKA 4NYOA 5RUBA 3T1HF 3R1LA 2VFSA 1ZA2B 1XQIA 1QAIA 4NLSA 3E01A 1BQXA 2UXCF 3A3OB 1LW0B 3R5AA 2N7CA 2OP5A 1CJUB 2MLYA 3E01B 2V94A 4BS2A 2GAGC 5JMNA 4PWDA 2B7CB 2HSEB 2X3GA 3FCHA 4C2MA 5L8RC 4A8WA 3I6PA 4B9MA 4WFNQ 2KXNB 1MROB 4WU2A 4Z7YA 4CYUB 4WFBQ 1KBRA 2A3JA 2I8EA 4Z37A 1D0EA 1M5VC 4P7VA 3Q2TC 2E9TA 1TKDA 1RAJA 4C98A 4CH0S 1QD1A 3AJ2A 3D5MA 1NZ8A 2H4WB 2J9CA 3QMQA 2E1MC 2AJ0A 4OX6A 4UUWA 4EI2A 1LEOA 3CNQP 5F8MA 3HFKA 3VAGA 1WTBA 3BGFA 3DCAA 2WVFA 1NB2A 2X1FA 3SYZA 1T94A 4MKAA 1HNVB 5GAEU 2DK2A 3A3NB 2B3TB 1CLFA 3ZZYA 1GAOA 2KFYA 1HWUA 1QVFR 3CCMS 4ED8A 2G4BA 1LWXA 3ETOA 4L76A 3DI6B 2IA6A 3TAMB 5IT0A 4JV1A 2JDJA 4DL3A 3GCWP 3DRXA 3LTOA 2XI2A 3EGWB 4KGXB 4Q5VA 9RUBA 1LK5A 2LEPA 4X4NA 2VV5A 1FESA 3MPDA 1RP5A 4ZJOA 1RAFB 1E6VB 4HEA9 2MKKA 2CQ1A 3GIIA 5CYQB 1AB8A 3MFHA 5D3GB 2KKHA 3EZ5A 3KUGA 1U1OA 1YRUA 5EHHA 1SL2A 5D3GA 2G9OA 2KRBA 1E6YB 2WVDA 1NH7A 2B9WA 2CQIA 4FXVA 1L3UA 4J9PA 2AQ4A 4EO8A 1MG7A 3G9CA 2P9GA 5F8NA 1FRKA 1HBOB 1TKZA 3HULA 1IKWB 3WC2A 1TL1B 2XCAA 1HW8A 1X4HA 4ED3A 5HBMA 1YJNS 3PVXA 2N4DA 1JKHA 2QLJB 6FD1A 2AYBA 4M94A 5D4PA 2VD3A 2FY1A 5IC6B 2RQKA 4LFAJ 3A3PB 4OYOA 2P6SA 2LFVA 2BJ1A 4R8UA 1VI7A 2MJNA 4NLUA 5M2RA 4LMZA 3FSIA 1S10A 3KUEA 3TRGA 3EVMA 4DV0F 1F2GA 4YFUA 3DRPB 2UXDF 2V68A 2IIHA 2RDDA 1HD1A 1FFSB 1TMMA 2JVRA 3L9ZA 3NS6A 3TA2A 3CCVS 2IM1A 1H7WA 3SBMA 4RR5A 3T6JA 2AJFE 2L08A 2WTFA 4DV2F 1H74A 4DV4F 5G0RA 2DHGA 1HMVB 1RGVA 1C1BA 1T02A 2DEJA 3IR7B 3N01A 5HAOA 2BE9B 5LM7E 1N6QB 4B3SF 4GVBA 4DCJB 3ZFVA 4CTAB 1SKWA 1N6QA 1OIAA 4X64F 3MCSA 2R7RA 5F9NA 1MMDA 2BJ9A 2K06A 2YKPA 4NEYA 2CFXA 2YWHA 2VQFJ 1U6FA 1QJHA 2E9RX 1H2UX 4FNHA 1LWCA 3V4IA 4FF4A 2A6OA 3M8PA 1AT1B 3VALA 2RDJA 2VB6A 3IRXA 2FUG9 3QAEA 4MT1A 4C11A 1Y7PA 3D0GE 2EXUA 2IA0A 2I6WA 3CJSA 3P3DA 1RTJA 1EP4B 1OSCA 1U0SA 1KFDA 2ALYB 3CCTA 3HHLC 2CQCA 1Q81T 5H9EJ 3JAMU 1RUSA 2Y3YA 3PEJA 4HT7A 1QTNB 2FJBB 1KHWA 1NDPA 2DGXA 2RD5C 4WU3A 3GR1A 3OT9A 5DGBA 2A2CA 1KLNA 2F65A 3AD7C 3IM8A 3PCOB 4RBTA 3OW2R 2R8JA 1TL5A 1T9VA 1YZ7A 3QGGA 7FDRA 3BGRB 2BANA 2RRNA 3QT8A 4BHQA 4DUYF 1KD1T 2BOAA 3BGRA 2UU9J 4IR1A 1RI7A 1O8BA 3R3TA 1ZYQA 1GFWB 2CRLA 2ALZA 2DNGA 1WORA 2IC3A 2HNDB 2IRYA 2AMCB 3BS9A 3SCKE 3RBDA 1TR0A 4KPYA 2FB0A 5KT4A 2HNDA 2NXJA 5IOLA 2H5IB 4ZITA 3EYZA 2OLWA 1GMWA 3G8QA 4RBUA 2VICA 4F2SA 1TL3B 1C4AA 3IWNC 1CJKB 1CEZA 2HZAA 3NAHA 2BX6A 4DSKA 1FTRA 3H5SA 2XMTA 3OR2B 1CJVA 3DLGB 5HO4A 4J9NA 4R5PB 2CPFA 4NMLA 1YBUA 1OY6A 3IP0A 2F4VF 4ALZA 1YJTA 4C8MA 3EGVA 5E41A 3C14A 4KFBA 2HHHJ 1UVJA 3NGTA 1IR0A 2E5JA 1IJEB 2ZUAA 3QAUA 5ETRA 2E29A 3Q8RB 1RT6B 4M5NA 5J1EB 2EI5A 1LV5A 3E2EA 4KRWA 2FJXA 2QZ8A 3KKFA 2UP1A 1R6YA 5A8WA 2VOOA 1VK8A 1UZHA 1FJGF 2W9CB 2ZH9A 2RQCA 3SDEA 3W64A 5ITHA 2X1GA 3DRRB 4LSLB 1KKHA 2KO1A 4KGKA 4IG0B 4IRDA 2M8DB 1UZDA 2EC2A 2AD9A 1TU0B 2W8KA 3NOCA 4NOHA 1RA6A 3B4DA 5KFRA 1KSPA 1APSA 2HEKA 5K8NA 4Q45A 1U45A 1D9FA 5KT6A 1K0TA 2B9YA 3H59A 2FYXA 4LR9A 4TXSA 2W24A 2W7OA 4DQIA 1XK8A 2VFTA 1FKOB 2KHCA 1WUUA 4ZP8A 3QLHB 5KT2A 3I5AA 5GAHU 2QMXA 2QSWA 4Z2XA 2BQUA 2JLEA 2Q6BA 3GV8B 3ZZ0A 4LF6F 4DV6J 1X9MA 4OHWA 3K5LA 4DZ6A 1AXQA 2V8HA 4DSJA 2BQ3A 2RIJA 4WYLA 4JI6J 3H90A 1LWFA 2OFGX 3D3BJ 3UVJB 3O5TB 2A18A 3DDIA 1CJUA 4RU2A 3C6UA 3GYGA 3MGJA 4V19J 1S12A 3X3UA 2G2OA 2BKNA 2WVEA 3P8BB 5IC4B 1W26A 4CIOA 3I0SA 4USVA 3JB9k 1FJEB 1FXLA 2DCUB 1RZMA 3EZUA 3P5TL 4X4OA 4ECWA 2OIHA 4CYUA 1YJRA 4MFBA 2RU9A 4ZPDA 4ZCLA 3C6TA 2XMWA 2HFNA 4NA1A 5CD4H 4FYVB 1HLWA 4FF3A 1UFWA 2IFXA 1FKAF 2OSRA 5KG4A 3S8SA 2O01C 1BQMB 3ZXWA 4C8KA 2R7VA 2MTLA 1FWPA 1HQUA 4KH1B 3DYAA 3KG1A 2CPDA 3MM9B 3PZPA 3V6HA 2IM0A 2QSFA 4DX8H 2CNKB 2BW2A 5KFMA 5ETPA 3AXKA 5DM6Q 4J9SA 3OTOJ 4KV8A 1Q5YA 2GCFA 1G3OA 1YVFA 3AB2B 5B7WA 2IY5B 1FK9A 3G2XA 4HI2A 1RU2A 1XIQA 1WHYA 1X7VA 4BCAA 3WDOA 5BJRA 7FD1A 4KKOB 3D28A 4C97A 3OSNA 4M8LA 1N34F 2UUAJ 4ZLJA 5F8LA 2QYGA 1PYSB 1X5OA 2XLJA 3OR1A 2P2CB 3LANA 3CCQS 2DGWA 2YNHB 5HVGA 2MKCA 1NK9A 3BREA 4UY85 2GHVC 1UVLA 3NLCA 1T9XA 4CM0A 4ELUA 4JI0J 1KLMA 2GO8A 3KUHA 1HQEA 1B70B 1FRHA 1MLAA 5J1PA 3M9MB 4IO1A 2Y8WA 5AJ3J 3AODA 4I7FA 2UZAA 2HWTA 2IRUA 4F36A 3LOUA 4OI6A 5JJBA 4FS1A 4B9LA 4UQTA 5KTQA 3Q8UA 1KFSA 2HHWA 3EXCX 2PA3A 1OO0B 4IDKB 5J2MA 4PEOA 4Q43A 1BE4A 2HHPA 4KGZB 2EG2A 1T05A 3B8HA 2DTJA 2GZOA 5EWFA 4AL7A 2C3PA 1GXLA 3FCVA 1GQEA 1EJ7L 1N5SA 4ERDA 2UXBF 3OHAA 1TK8A 1RAGB 1F5BA 2GW8A 3H2UB 3N5FA 1VS3A 2B9XA 4P2XA 2EFNA 1VYAA 1CULB 2C3YA 4R8UB 3MAAB 2FHJD 2QA2A 1SC4B 4PXDA 2OHDA 2OPRA 1Q5VA 3MECB 2HK2A 2YH0A 1RJJA 3J7ZT 1O5JA 2YTCA 3MUVP 4ED6A 2D3OR 1DFDA 2PDAA 3FJ2A 1WC0A 2NUUG 3FRZA 5B0BA 5HJYA 3D1OA 3EJMA 1Q8LA 4NLYA 4P52A 4TU7A 2YKMA 2XG8A 1X4BA 3BH7B 4M5DB 4NLTA 3EX7B 3PW7A 2O1PA 3RRKA 2I1RA 2OEMA 1N0VC 2AT1B 1AUDA 4DQPA 4LSNA 1VBYA 1VQLS 3M2UB 1FCAA 3K5NA 2DXFA 2YWWA 3M2UA 3TNVA 5HMXA 1V6HA 2Q6CA 4NA3A 4FVMA 2QYCA 2YWKA 4DPYA 3SSRA 4RW7A 3FRYA 3OD2A 5A8KA 2WK4A 4RW7B 4FF1A 2G0IA 2XCPA 2CADA 3LQVA 4ANCA 3RYLA 2B5JB 2LA6A 3CEDA 3D4JA 5A8RB 3PW5A 1VQOS 4KB7A 2XB2D 4ILMA 3RRHA 1RACB 2J6SA 4I64A 2ZVSA 1NJZA 5K8PA 1HNXF 4NXMF 4CLPA 2A10A 5A0YA 1SBRA 1GT8A 4CM2A 2FIUA 5A0YB 4DR5F 1AA1B 2RUSA 4G6VB 4B02A 4D3HA 4XPCA 1YJ9S 2BA9A 4KPCA 1H2TZ 1GNKA 4WXWA 4CO4A 5E5NA 4NI2A 5KFDA 4F50A 2DH7A 2MDAA 2WVBA 2QN6B 1SJ3P 3BKUA 1HHTP 4Y2AA 4O44A 4ZMMA 3P5BP 1JLAB 3CJ4A 2VPYB 4OZJA 2EWHA 3MR6A 4FPRA 4Y2IA 1GMUA 3HX9A 1R3NA 3MWBA 3N5BA 4HVZA 3SCLE 2AX0A 3BZQA 3GSDA 4CDIA 1P6TA 1TKXA 2CXEA 2EPIA 3C16A 1FT8A 1VLYA 1Q1KA 3UDCA 5A2QY 3RJMB 2G13A 1S76D 3C16B 4DR3J 3ZTPA 2PSZA 3DGVA 1NPKA 4CO3A 1NJYA 2ATLA 3NCRA 1RTIA 1ZTWA 3PO4A 4ES2A 4FPIA 3V4MA 3CCJS 3R5JB 1SJRA 4J9UE 2QMWA 1GMWD 2DISA 2QMUB 4AD6A 2V2QA 3MEGB 1U26A 2OAUA 1KONA 2LCWA 4AQYJ 3GE9A 2CYYA 2IRXA 3MEGA 3CVKA 3MM5A 1S4FA 3A12A 4ZN1A 4DSEA 1PAUB 3CJ8A 3I82A 4JUZA 2C28A 2VPWB 4ZCKA 3LALA 4JI4J 1FX2A 4P75A 1VQ9S 3EXYA 4WYWA 1FWLA 3EGZA 5D15A 2CPJA 2YKNA 2OMOA 3ILOA 2YNGA 4NCGB 3PRBA 3PW4A 3PW2A 2V9KA 1XMOF 2M88A 2RJZA 4K5RA 5HK4A 4AXIA 5MLCV 3JXOA 3PV8A 1RT1B 2AU0A 3HHNB 2WAQD 3OVAA 1YGYA 2RKIA 2IMWP 2G1DA 3PYEA 3W9HA 2C2EA 3TUZC 4LRDA 1FVSA 2IYGA 1U4BA 3UFCX 1S59A 4WK3A 2YH1A 4U7CA 4DR4F 2EBEA 4XIUA 1VRQC 2ZUGA 1N36F 5DZ7A 4KQZA 1N5TA 1HBUB 2GX8A 2VG6A 4F26A 2ZFHA 4ECVA 3RW6A 4RW6B 2JC0A 4G65A 1WWHA 3UVJA 1F0XA 5LMUF 1VQNS 3UCZP 3LP0A 3VGVA 1XERA 4DDFA 2VOPA 1U25A 2IM3A 3CJQA 3QFWA 4DU8A 4X62J 4C8ZA 3R5BA 4P2FA 2HNYB 4CRJA 3CCUS 3ZZTA 1I5OB 4LRCA 1S1XA 3CWJA 1P1TA 3DM2B 4RNNA 3NY0A 1U8WA
chains in the Genus database with same CATH topology
2R7WA 4WKYA 3OXFA 5LSRA 5KFCA 5HI7A 2P6TA 4ZP9A 5KT5A 5J2NB 2XGQA 4I6YA 4LVNP 3NBPA 2KU7A 4PXCA 3H4DA 4ZCIA 4O3RA 2MMYA 2OPPA 2QLXA 2JC1A 2XMUA 2V8VA 3DXSX 4ZPTR 3HXMA 3CCWA 4WKRA 4RW8B 2YNFA 3LH2S 2QE5A 4X84A 4CO0A 3NMAA 4Y34A 3HHLD 4WFXA 4DV7F 1L3TA 3BO3A 5IM0B 4DWIA 3A1YG 1UP1A 2DGTA 2ZH3A 2XS7A 2CZ4A 1FXDA 2JHEA 1HNIB 3HKWA 4PWDA 2HFOA 3VZIA 4A8YA 4DL5A 5C42A 1Z2ZA 2HVZA 3LWMA 4JI4F 2BM0A 5C42B 3DXBA 4ZPCA 1VQ5S 3QO9B 1LW2B 1FEHA 5KG7A 2DNHA 1FKPA 4IRKA 2ADCA 2O3DA 2UV8A 4NLPA 2PO4A 1KLMB 2AGQA 1IKYA 1EETA 4BBYA 3S1TA 1FDNA 1NK6A 4I7FB 4NYPA 4ECTA 5KFPA 3DDKA 3OV7A 1UAWA 1N5VA 1X4FA 2FHKA 4IDKA 2KM8C 3THVA 1KQSR 2AYMA 3KG0A 2WRMA 4Y3CA 1HR0F 1QSSA 4I0WA 3RB3A 1Y0HA 4PCQA 3PNIA 1NK5A 2AW0A 2J7UA 3I87A 4FZVA 2A2DA 1W25A 3QWPA 4K2XA 1ZH5A 2ZH8A 3QWUA 3IFEA 5KT3A 2F40A 4QYRA 4OX7A 2EBGA 1HBMA 3M2RB 1TFYA 4EO6A 4ZPBA 1X5SA 2RF2A 1LWEB 4DF4A 3PW0A 3M2RA 4WXOA 1YI2S 1UVMA 3MM8B 4I4BA 4RW4B 4GKJF 4Q2MA 3VAHA 3AJ1A 2XSJA 2GQCA 4QWEA 5KAKA 2CJKA 3DRRA 2VPXB 3I96A 3POTB 2ZJRQ 4TY9A 3MPWA 4AFFA 2ZKTA 3HT3A 3TQ1A 2WONB 1B0PA 5L1IA 2COLA 1ZPWX 4TU8A 3M30B 3VR1A 3CJKA 1R0AB 4JI5F 2VODA 5DQIA 1GTHA 1N5YB 5CZVA 3KLIB 4IFYA 2ZBCA 1F5AA 1O0PA 2MQLA 2LXIA 3Q8PB 4MK7A 4BC7A 5F8JA 2H9ZA 2ASJA 4HH0A 1ZTTA 4TLQA 3CXCR 1N32F 5EX3A 1GXTA 2I9SA 3TR5A 3OUYA 2MPUA 2B6AA 4YY3F 2EK1A 2F8MA 1YWXA 5JVHQ 1X4DA 4X4QA 2JFDA 1PSDA 5I42B 3DLLQ 1WELA 5LL6d 3K5MA 2PGCA 2UVVA 5I42A 2HMIA 3GYNA 2OPSB 2HW3A 2HHVA 4J5OA 1N48A 3JSYA 1HWKA 3A8EA 1VQ8S 1RISA 1OSDA 1V3SA 4DV5F 2R4FA 4MIWA 2RH3A 3N6MA 1FE4A 5FDLB 2IJFA 4DJBA 2OD6A 4ED0A 1W2IA 3L7OA 4RWWA 1VOMA 3N9UC 3M6UA 2GJ2A 2XS2A 3CTRA 4USJC 3WX4A 4JI0F 3MEDA 1F5CA 4FBUA 2BYCA 2E5GA 3AY0A 1ZAXA 2KFNA 4NRTA 2LQ9A 2VG7A 3KMSA 2XMKA 3TAMA 2BJEA 5H1SV 1WF1A 2VKRA 5KG1A 2ZH5A 2HYIB 1E6VA 4PG4A 2JSXA 2DNKA 4X66F 3DLKA 1FRJA 5F3ZA 3PIPQ 4H4MB 1OPIA 2WSCC 4ECUA 1U24A 3DLKB 1URRA 3PX4A 3T6BA 5CXTA 1YSJA 1N88A 1J2VA 4C0OC 4ECSA 2E1AA 1HBOA 1UKUA 1E6YA 5KFYA 4CH1A 2E5IA 1IKWA 3SCIE 3ZZUA 3GWCA 4B08A 2CQDA 3P96A 2W4PA 5U47A 4CCHA 2DITA 2J9DE 1WI6A 2YNIA 5GAGU 5KOXA 4W92B 2MQPA 4ZK7M 1X4EA 1S1TB 3DLHA 2YY3A 5KFNA 5DLGA 2VG6B 1NKBA 2XEXA 4AE5A 1VIXA 4LUBA 5DG8A 1KOHA 3LP0B 1N52B 1RTHA 2CPIA 2B51A 4KIAA 4LJMA 2V9WA 2R8KA 5FJ4A 1T03B 1YJUA 1M1KT 2BJDA 1VQYA 1SV5B 1BGXT 3KWMA 1JLEA 3U1MA 5CA5A 1C1BB 1SV5A 2XGPA 1JX4A 5SZTA 2VBZA 1U8SA 3IWLA 1NJXA 2CPEA 1UVNA 2B7BB 4I2PA 3DU5A 1N54B 1U2FA 3TVKA 3IXQA 2BVZA 5EDWA 2VL1A 3MOZA 3GFHA 4A8SA 4DLGA 4OI4A 2J9EA 4KC5A 4PG7A 4F4ZA 5AXNA 5CYJA 2ZE2A 4IRDA 1Y5IB 1SH0A 2CPZA 1RT7A 4FS2A 2ZE2B 3DU6A 2JZ5A 3TOQA 4DQQA 3IO1A 3JSBA 1IBLF 2B5JA 4USHA 4OJGA 4DLEA 3LAKA 1AW0A 4TKTA 2HS0A 3CDAA 4RUHA 5C25B 1TV6A 1QM9A 5C25A 2GHWA 1TV6B 5L38A 2IAJB 3ISNC 1JMTA 2LVWA 4QBUA 3BR8A 3OFEA 5I3PA 3HK2A 4WJBA 3HO1A 1CC7A 5DS7A 2AF6A 4CO1A 4J37A 6FDRA 5IQ6A 4YP3A 3VAKA 2Q1LA 2AGPA 2BANB 2B4PA 2O5DA 4IFVA 3HHLB 3PJWA 3M6XA 2MQNA 1VBXA 3PR4A 1PGZA 3M9NB 1WD6A 2KN4A 3MDFA 5HMZA 1K0VA 3MF5A 2VKZG 4I6AA 1TP7A 1QAJA 3EGNA 1TKXB 3OQ2A 1S1VA 3AQPA 3TA1A 1IQZA 2L41A 2K8GA 2ZITA 3NMRA 1Y5NB 2X1AA 2CPYA 2DR9A 4IR9A 4QYZJ 1FE0A 2HLTA 4AUKA 4PQUA 2HWHA 2R2TA 2UUWA 2BOPA 2J6UA 4LF8F 2VBWA 3R27A 1DTQA 1S6OA 2RVJA 1KEKA 1TK5A 1ZM2A 1SQEA 3OVSA 2DNNA 4LSLA 2XSJB 5A8WB 2GGPB 1UEVA 2W9CA 2B0GA 2V4RA 4ECQA 2HS3A 1Q4RA 4I69A 4IG0A 2MY8A 5KFQA 1C0UA 2WONA 1C0TA 4ZVFA 3M8SA 2JOQA 2FHJA 3DRSB 1S1WA 3UCGA 4JOUA 3LAMA 1MWYA 2HGLA 4YDDB 3NNAA 1FKOA 4U7UK 5E3AA 5L39A 5L9XA 3N79A 2CVEA 2FDNA 2DNZA 4HT5A 1JJ4A 4B9TA 1OPZA 3CDBA 2ZC3A 3WC0A 5D6GA 4N5SA 2V8GA 2ZM6F 1U6BA 3PR5B 3DHXA 1U1LA 2XWYA 4BWJA 5DLFA 4DN9A 1OQ3A 1R27B 1R89A 2DJWA 2LLZA 4KT0C 1O51A 1S9GA 2QFJA 1LXNA 4NLVA 3J81Y 1YTYA 4CI0B 5E3CA 4OJ3A 2M4MA 4DOZA 4QIGA 2HVIA 1P27B 2LU2A 2IVYA 4RU9A 2MKHA 2AP6A 1H0HB 3G6ES 3I0SB 1RT3B 2J0XA 4ES1A 2DH9A 4YHHF 3G6YA 1RT2B 2YWGA 5KT7A 2ZJPQ 3DYAB 3MM9A 5IT4A 1XWLA 4Q44A 5J2PA 3Q8QB 1IQTA 5J2PB 5IQQA 2DGUA 3G6VA 3NP5A 4Q7AA 2CPXA 4B9UA 1NKCA 3F56A 2VG7B 1YIJS 4KV8B 4WE1B 3Q24A 3RAQA 1UL3A 1Q78A 3OR1B 3VF0B 1V3ZA 3OJSA 4J9LA 4KO0A 1T3NA 1Y00A 1Q7YT 1H2VZ 2DNYA 1FKPB 1RYRA 5CYQA 5THWA 4RNFA 1LKZA 1S0VA 3HJFA 3PFEA 2AYGA 1QSYA 4XK8C 3J80Y 4DFKA 3BGLA 1XR7A 2MKSA 2PIIA 2ZZMA 4QIEA 4PKDB 3Q2SC 3VQSA 1X4AA 3LP2B 1QAXA 1UW4A 2R7OA 2DHAA 2H5EA 3DOLB 2DNLA 2WCXA 3HZGA 2KI2A 3QIDA 4CZCA 1U1NA 2HLUA 5KFWA 1Y3JA 5DG7A 3CUNA 2DNMA 2HRUA 2QA4S 3T5KA 2MKIA 2R7TA 1FJCA 4CT9A 3IGNA 1ZZFA 1IBMF 3F44A 4USIA 5E3PA 1B0VA 1GTEA 1QE1B 3OXGA 4Y65A 5BYQA 3KHHA 1M5KC 1Y3KA 2DNRA 1TVRB 2B4OA 4PPDA 5IWAF 1HHSA 3CF5Q 4K4TA 2BQRA 1SJFA 2LDIA 1HWLA 3UWTA 3GG1A 3KJVA 3D2WA 2B56A 4LFCF 3KJVB 3JSMA 2KTQA 1S79A 3G96A 2JLGA 3I9V9 2J0SD 4ITSA 4B17A 3I0RB 1QVGR 2KXFA 4IYQA 1FRXA 3AB4B 3M6WA 3Q23A 2P9EA 5CH7B 2YQ3A 4IOBA 3DMJA 3KLGB 4DL7A 4FF2A 1G7CB 4OV1A 4QW9A 2LEBA 2L48A 4IRCA 2PD1A 3Q0AA 1JJ2R 1S9EB 2JH3A 3O6QA 3KHLA 4OI2A 2XI3A 5FLXY 4DPOA 4IG3A 3CDUA 4U9RA 1DAXA 3OFGA 4OJ1A 1L3KA 5A8KB 4YEAA 4IFYB 4B3RF 4YB6A 4Q8EA 3PHEA 4F3QA 3V6DA 3OHBA 1IKVB 1U48A 4LF4F 1JWWA 1FD8A 2Y0SD 3M8QA 3WZ0A 5L1LA 2LQBA 1H38A 5C24B 1X0FA 2K1RB 2VG5B 2BM1A 3W7BA 4ED2A 1RDRA 1IKXA 3W3SA 5D8HB 3TAQA 2V2KA 1QUVA 4EYIB 2ASDA 2YWEA 3BDEA 3H5YA 3MAQA 3ZZZA 1KHVA 2OMLA 1HARA 2ROGA 2XNQA 3HHLA 4PRFA 2IC3B 4DR3F 5HLFB 3DLEB 2QA4G 2OH2A 2PMHA 4F2RA 3KOAA 3DLEA 1X4GA 2QEXS 3PM9A 4Y00A 5AE2A 2AJ4A 2ZH7A 2ZD1A 1TK0A 3TO8A 2EKYA 3HM9A 1QY7A 5H9FJ 1WEYA 4ZHRA 3GILA 1UJ5A 2HPUA 4ZHRB 3UR0A 4DHVA 3PKMA 1KVJA 2O66A 3FEYB 2R7QA 2P5VA 2VONA 4TYAA 4DL2A 1DZ5A 1M5PC 4MK9A 3MUMP 3NWGA 2B4UA 5L1KA 4V19X 3CIMA 1KTQA 4PQAA 2B43A 4ZCMA 1S77D 4FYDA 1NB7A 1X5PA 2DGVA 2GMLA 4DN0A 1K9MT 4PG8A 2RNEA 2HRYA 4ID5A 3T5JA 4JBCA 1JNZB 2YNGB 3PKYA 4NLGA 1SIWB 4RNOA 3H25A 4J9MA 4OI1A 1JLGA 5KG0A 1SUQA 4RBVA 3CDWA 2W9BB 5L9NA 3KK2B 2PEHA 4I6WA 1N4LA 2EVZA 5B09A 1WHVA 2DBBA 3M1VA 1M5HA 1HBUA 4C8LA 5LMNF 4HL9A 2DRBA 1U1MA 3CSKA 2LQ5A 4A8OA 5HP1A 1X8DA 4RW6A 1PC4A 2HNYA 1RTHB 3KG4A 5GADI 1CVJA 4TY8A 2KYXA 3NNHA 3DRPA 4CO2A 4F8RA 4TY8B 1S49A 1S6PB 5EX0A 5JXSA 3HP6A 1P9QC 1HI8A 4M1KA 2GV1A 2Y1JA 4NLDA 1HMVA 4DV6F 1C1CA 1RT3A 5K5MA 3IA0A 2J7WA 2HHQA 4JV2A 2PN6A 4DV1F 1C1CB 5D4OA 3HVRA 3CB4A 5BYRA 3QJLA 1ZAVA 2NPIA 2JWNA 1HW9A 1LWCB 3L95X 5DQGA 1FA0A 2WHOA 3V81B 3X1LB 2OJ3A 5IM0A 2YNFB 4J9RA 5T7LA 4DR7F 1CPZA 4NLXA 2PA8D 4CO5A 1BQNA 2PFFB 1X4CA 1EP4A 4ILRA 3VCDA 1VK3A 3O8WA 1FDDA 5T14A 4H4KC 1ZOTA 4NL5A 5M2PA 5JVGQ 3QO9A 5IS2A 3TANA 1X9WA 2ZDPA 4QU6A 4QCLA 2IAJA 4F3OA 4ZOSA 3RR8A 5HQ8A 5LJ3Y 3AH6A 4BC9A 1KOOA 2VBXA 2XLIA 3CJ2A 5FIIA 2ZKUA 4OZ5A 4IFVB 2KXHA 1WHWA 2JLFA 4F25A 2LU1A 2DIUA 3MEEB 3NKYA 2E44A 1XMQF 3MTKA 5K9FA 4OZLA 3M2VB 2IBOA 3HZEA 3LO3A 3MEEA 3T9NA 3T3FA 1Q82T 1FTCA 3JTPA 2Z4PA 4LVOP 1RK8A 4F4WA 4EGLA 1M5SA 5KFEA 5DDOC 3FEZA 5F9LA 2DGOA 2FHOB 2DD8S 5SUHA 5KFVA 2VFUA 4AYBD 2E9ZA 1U09A 4GC7A 3U27A 2OPRB 4KFBB 4WIIA 1WG4A 1JNRB 2VFVA 1SIZA 1LWEA 4HDGA 2FJWA 1HI1A 1DTQB 2MSSA 3ENWA 4F02A 4U6PA 4MH8A 3MM8A 2R2UA 4PR6A 3DRYA 3MD1A 3KLEB 1VQPS 4DL0C 3NRBA 1VC0A 2DPJA