2AJ1A

Solution structure of apocada
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
71
structure length
71
Chain Sequence
MAEKTVYRVDGLSCTNCAAKFERNVKEIEGVTEAIVNFGASKITVTGEASIQQVEQAGAFEHLKIIPEKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable cadmium-transporting ATPase
publication title Structural basis for metal binding specificity: the N-terminal cadmium binding domain of the P1-type ATPase CadA
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
total genus 19
structure length 71
sequence length 71
ec nomenclature ec 3.6.3.3: Cadmium-exporting ATPase.
pdb deposition date 2005-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2aj1A00
2BUNA 3BB5A 1IUJA 1FE0A 3KG0A 1X8DA 1WD6A 1TZ0A 2K7KA 1Y9OA 1OPZA 2K1RB 2OFHX 1CC8A 2IYGA 2ROGA 3DXSX 2FHMA 3F44A 3LGNA 1MWZA 4DL0C 3BM7A 4EFAC 3HHLC 4FNIA 2W4PA 1W2IA 2OD4A 2OD6A 2QLWA 2XMMA 4U9RA 2KT2A 1GXUA 4F67A 3FMBA 5K9FA 3IWLA 5F0UA 3LGMA 1AFIA 4YDXA 1TUVA 1APSA 5B0GA 1S6UA 4DPOA 3HFKA 4A46A 3QGPA 2XMUA 2LQ9A 2G9OA 1Y0HA 1MWYA 3HHLA 2KYZA 1FESA 2OAUA 1P6TA 2QIFA 2XMWA 3BDEA 3KG1A 2N4CA 5B08A 1YJUA 4ZA1A 3HF5A 1Y3JA 4QOTA 2JDJA 1S6OA 1YJVA 1TR0A 2AJ1A 2OKQA 3TNVA 3IWXA 3KNGA 5T7LA 1KQKA 5B0DA 5IXUA 4FNHA 4ZOSA 1SB6A 4A47A 2OFGX 2HLUA 1TL4A 2FB0A 2VH7A 2Q3PA 3BF4A 1OQ3A 1X7VA 1FVQA 2AW0A 2ZDOA 3FGVA 1GXTA 5A6PA 1Q8BA 1YJRA 2XMTA 1CC7A 3TOQA 1KVJA 2LDIA 2VV5A 2PGCA 2BBEA 3BN7A 4NPOA 2BJEA 2ACYA 1OQ6A 2K7JA 2FTRA 2N7YA 1ULRA 3HX9A 2KKHA 5KAKA 1K0VA 2PD1A 1KVIA 2ROPA 2L3MA 2K2PA 2OP5A 1P8GA 3BR8A 1N5QA 3K7RA 4Y2MA 2RU9A 2HFOA 2ROEA 1AFJA 2OMOA 1N5VA 4HH0A 5B0AA 2XMVA 2IFXA 1N5SA 2HQIA 1AW0A 2LXFA 1Y3KA 2HIQA 2GGPA 1Q8LA 4HI1A 3QMQA 2FIUA 2QLXA 2GFFA 3MZIA 3DCAA 3HHLB 2HLTA 3I9ZA 3FRYA 2W4DA 2RSQA 1YG0A 4NL5A 4OJHA 2BJDA 2RILA 1FD8A 3TRGA 1FE4A 2XMKA 2GO8A 5T7LB 3HHLD 1Q53A 1FEEA 3CJKA 1QUPA 1VQSA 2ASYA 1VQYA 2IYIA 2N4DA 5F0WA 1SQEA 4HI2A 1U7LA 5B0BA 2HFNA 1R6YA 2ZDPA 2K1RA 1JK9B 3BGUA 3KKFA 2BYCA 3E8OA 2EW9A 3VTIA 1JWWA 1Q4RA 1RJJA 1LQ9A 3MCSA 4DN9A 4HL9A 1OSDA 2LQBA 1FVSA 2QYCA 2AP6A 5B0FA 3WDOA 1X0PA 2GA7A 4HH1A 5A6WA 1YRXA 2GV1A 1YJTA 5B0EA 3UDCA 5B0CA 4Q2MA 2GGPB 4OIXA 1N5TA 2GCFA 3GZ7A 1CPZA 4A48A 4OJGA 4Y2IA 3T9NA 5B09A 1TL5A 4OJ1A 2RMLA 2KT3A 4A4JA 4YEAA 2W4CA 4Q2LA 3LO3A 4OJ3A 1XBWA 3HDSA 3CJKB 2CRLA 2AJ0A 2XMJA 1V3ZA 1SI9A 1URRA 4Y2KA
chains in the Genus database with same CATH superfamily
4K4SA 3FBBA 1U47A 3LP0B 3RAQA 2GMLA 1F5BA 2UXCJ 2BMBA 2POKA 4I2QB 4NRTA 3IRXA 1MU2A 3CD5A 3I0RA 4Z7YA 4RX6A 4QIFA 1VQKS 2JRSA 2XMWA 7AT1B 3G6ES 1Y5NB 1R0BG 5HO4A 2QLJB 2Q3PA 2AW0A 1IJFB 1QM9A 2V8VA 1S1TB 5EX0A 4OX8A 4DXLA 5DQHA 5KAKA 4KAIA 1N5QA 4PPZA 4ECRA 2RRAA 1MROA 1FO1A 1VBXA 1VI7A 1X4EA 4BWJA 1HW9A 2N4DA 2VG6A 1NDLA 3HHDA 1OO0B 2EG2A 1Q0NA 3HZEA 3IA0A 5KFXA 2A6OA 3S7RA 1WC6A 4DQSA 2PN6A 3EGVA 5A6WA 3H5UA 3V6DB 2F8EX 4RW6A 4R0JA 3UD4P 2MKIA 1NB2A 4OZNA 1AUDA 1WHWA 2FJEB 3MAQA 1X5TA 2O5DA 3AD9C 3QYYA 5C42B 2BRLA 2J6UA 2DT9A 2M88A 3ENQA 2EFPA 2X1BA 3E01B 2IAJA 5D15A 1PAEX 2LQ9A 3Q8SB 2ZE2A 3D28A 3BDEA 3D3BJ 4DV3F 3KDOA 3LP1B 1G4CA 2IVFB 5DLFA 2E1PA 1GMVA 2LA6A 4V19X 4NZ0A 4ZP9A 2C1EB 3KLEA 1F3FA 1LWFB 4RUAA 2HNZB 3G71S 1SL1A 4FS1A 4O0NA 4PG7A 2DNGA 4A8KA 4ECXA 5KG0A 1JJ4A 1QTNB 4NL5A 1C1CA 4L6V3 5KFLA 4ZN1A 3B8HA 2IRXA 4ALZA 1GX5A 4B9LA 4X2BA 2DNKA 2UUAF 5KFTA 2WOMB 4H4OB 4RJVA 4DFJA 4RNFA 5IWAJ 9ATCB 3M30B 3IG1B 2KT3A 1YRTA 3LGHA 4HHUA 4L74A 3OVSA 4MFBA 2FJWA 3RYLA 4HKQA 4ED1A 1BE4A 3CCTA 4NYZA 1ACMB 1CJTA 1WHYA 4ECUA 2FVCA 2W2OP 1NSPA 2RQCA 1BD6A 3AXMA 1X4CA 3BGLA 4B02A 1AB8A 4K2JA 4K4TA 1FRJA 3D7SB 2OMOA 4NLGA 4I56A 3EMTA 1NO8A 4ZVOB 4OI4A 2FGOA 2KRBA 1DARA 1T9XA 1UFWA 2V2ZA 2HNYB 4RBVA 2E9RX 5D0RA 5KFKA 1F9HA 3UFCX 1CQMA 2JLFA 4FPRA 4DX6A 1UWAA 4JV0A 3HVAA 3MUVP 1AZSB 1OY8A 4DUYJ 4DV2F 4HT7A 1UVLA 1IKWB 3IBFB 2E5HA 3PW2A 5BR8F 1RT6A 4O3SA 2OEMA 3ZC4A 3KJVA 2C2DA 3TAMA 3T1AA 1HD0A 5SZTA 2CJYB 4L72B 1TL3B 2MQMA 1N0UA 1R31A 4KTQA 2VC0A 2HS4A 2ZNZA 3VR1A 2ZUGA 1YJVA 4UOCA 1JLFB 4NZ7A 4DJBA 4ZLJA 1K1QA 2BW2A 4C8YA 1J27A 2B9EA 4UW2A 3OVBA 3H2UB 2BZ2A 3F73A 3MUMP 2CJAA 2YWGA 5DDRC 2MYFA 2Q6CA 3ETMA 3VAHA 3PW5A 1U1QA 2E5JA 3NGKA 4JI7J 1NZ8A 3M4XA 3I5BA 2AYMA 1T02A 4YEAA 3I0SB 3CIMA 2LU2A 1JB0C 3BR9A 1PJ7A 1H2TZ 4ELTA 2FPHX 4QCLA 4B9NA 1APSA 4RW8A 5HP1B 2OSRA 2LDYA 2G2OA 1DTQA 3CCSS 3U27A 3OL6A 2X51A 1RP5A 4QWDA 2ZJRQ 1LFPA 2BKPA 2NXNA 2MZTA 3OL7A 2DXDA 2V2QA 1X4DA 5CABA 1X5PA 2GHPA 5KT5A 5JXSA 3QIPA 3PKYA 3DGPA 4MK9A 1EZZB 3T1HF 3G9CA 2BM1A 5I3QA 1KFSA 1OPIA 3H5XA 1CBKA 5IM0B 4J9UE 2HHWA 1XMQJ 1RAEB 3DN9A 3G6YA 2ZHAA 4B3OB 5IT0A 5BJRA 2ZDPA 3ZTOA 4I6YA 4TY8B 1EB0A 1Y00A 3IM8A 2BYCA 4QR0A 4LMZA 2HQFA 5H9EJ 1A0OB 4PWDA 3AJ1A 3BSAA 4MYUA 1FX4A 5A8RB 3VZIA 1FRIA 4LFBJ 1DBDA 4WWSA 3H4DA 4ICLB 1XBWA 2DNPA 1VQMS 2X1GA 1Q78A 1LNQA 3AAWB 2DH9A 1XR5A 3OVAA 4ED6A 1JX4A 4U95A 1RZMA 5GMKa 1N5YB 3BGRA 3BGOP 2I1RA 3M6VA 2Z56B 3KG4A 3LP2B 1T05A 3TANA 3CJ4A 4NA1A 3GCXP 2W2NP 1WC1A 1E6VB 1WG1A 2DKOB 2JSXA 3MECA 2Z4PA 3ENAA 1EHWA 2UU9J 3DLKB 4P2SA 3UD5A 1S6QA 1R0CB 2LFVA 5D4LA 1P8GA 2VHGA 2CQ4A 4IRCA 1RCOB 2M5YA 4ID5A 3LTOA 1VQ9S 3AOCA 2BE9B 3CJKA 3G82B 3H8YA 2L48A 2VA3A 2GX8A 3QWUA 4M5JA 2MMYA 2ZBRA 4RUBA 2DR9A 4OYIA 3DGVA 3BO4A 1VRTA 4LSNB 3MDFA 5DLGA 3JSRA 3TW0A 4NA3A 2B5JA 2R8JA 3CCJS 4YY3F 4X4VA 2Q79A 2XWXA 4J9KA 4CCHA 4YOEA 2UZAA 1OPZA 3QGHA 2R2RA 2DR8A 2DR7A 1D1UA 1I3OB 3MR6A 1W7WA 1ROFA 3TUPA 3KLFA 3CT9A 4PWUA 3VAIA 2XMUA 1ZOTA 3Q24A 2WVFA 2GIRA 4TU8A 5BYRA 4L73A 2YKOA 2DGUA 3ILJA 5AJ3F 1NNDA 4ZVFA 3CIZA 1TKDA 4BHQA 2YKMA 2VKRA 2KXFA 3M6WA 2JLEA 2V8PA 4DV3J 3DOKA 2DD8S 2KN4A 4IRDA 2HIQA 2KXNB 2B4OA 3J81U 5E3AA 4NRUA 1FDAA 3TAPA 4ZJQA 1HARA 3MR7A 1O6XA 4N77A 1JWWA 3MAHA 1NDKA 3K8WA 7FDRA 2QL7B 2EC2A 2R7OA 1GNKA 3SBMA 3CCMS 2BXJA 1TK0A 2OSQA 2XMJA 1RK8A 3DDKA 2K7KA 2UUAJ 1FA0A 2GMJA 1CEZA 3HXMA 4CLLA 1KLMA 4ED4A 1PBAA 2E5IA 1HQUB 1M5KC 4FZVA 1MLAA 4ES3A 4TN2A 1TL7B 1CJUA 3PIPQ 3AB2B 3D1OA 3CNQP 3KLGB 5K14A 2JJ4D 4A47A 4IFYA 2CVIA 3FCWA 4WTOB 2J8AA 2ZJQQ 4FYWB 5EWEA 1G6BA 2P6TA 2MZ1A 2GAGC 1YIJS 1TK8A 3HULA 4PUOA 1P9QC 1W26A 3QGGA 2KO1A 1O5JA 1E6YA 2BJDA 2OPPA 4KFBA 1U0SA 2ADCA 4WZMA 4I2PA 2LQBA 1U1MA 1C1BA 4O0IA 1NK8A 1F2HA 1FX2A 4FS2A 2BDPA 5M2PA 4NI2A 1NKCA 1G1XA 3TJ8A 1U6ZA 4F0HA 2ZFHA 2M52A 5J2QA 4A8OA 1VS3A 3KJQB 2J7WA 4DV2J 2LP4A 1T3OA 2DEJA 4PXDA 4CH0S 5BR8J 4O3RA 1T03A 3ILLA 3MF5A 4K2XA 3PM9A 3KNGA 1XTZA 1U1LA 2HFSA 1V6HA 3VQSA 3KUHA 2XMAA 5MLCV 3NCRA 2FQQB 4C8NA 3ICLA 1ZH5A 2CPDA 4ATNA 3IRXB 1MU2B 3I0RB 4ETXA 1HBUA 1Q8LA 1IBKF 3EM1A 3BYPA 2FJVA 2RILA 1WC4A 4ZPVR 3MPUB 2BQ3A 2PA8D 2OTLS 5KFDA 3CJ3A 3EICA 2CQBA 4FYXB 2QTWA 1LWCA 2O66A 4PG6A 1U02A 3R9LA 1YRXA 3JS9A 1MROB 1ZM9A 1NK6A 1SJ1A 1PJ5A 1T9VA 2MB0B 1UZDA 3A8JA 4QWAA 4USTA 4CNYA 2VG6B 1WD6A 2RUGA 2CJXB 4CT9A 2FD2A 3NOCA 4FF3A 3K8VA 3LGMA 2CZVC 5JVGQ 2ZBIA 1NXIA 4RW6B 1FXDA 2WVEA 1SIZA 3CJSA 4O44A 1Q79A 1YLXA 1O51A 5LMUJ 5IC4B 3PEHA 4YQWA 4K4WA 4NPOA 3EXYA 2QLFB 4JI3J 2IAJB 1TUGB 1ZM3A 2GVZA 4QU7A 2XO6A 2ILYA 1EAYC 3M6XA 3UR0A 2ZE2B 2Y1JA 3NXZA 3OD2A 5KFZA 2VPZB 3KDNA 3OFEA 4U96A 3T1HJ 4N56A 2Y8YA 1BQNA 4DV0J 1WUUA 3KLEB 2WW8A 4B9SA 3HCXA 1KBRA 2QG9B 1JLEA 3KLIA 5B0FA 1OIAA 4HACA 2OO4A 2C3OA 3ILIA 2ZOMA 4WFXA 1P27B 1C1CB 4NE9C 4DR1J 2AJ0A 1JLCA 4TQSA 1NCLA 4LBIA 5HROA 2QL9B 4DV7F 3K5LA 1W2IA 2CNOB 2B7CB 4FXWA 5M2RA 3C3LA 4B3MJ 2NYIA 2FY1A 1FESA 3QT7A 1YJUA 4X4PA 4XTTA 5LT5A 4MFBB 4Y6IA 2FB0A 3UR3C 1TTHB 2NQPA 4IH7A 5CYMA 1REVA 3EWGA 1CJTB 5CH7B 4LJMA 2GGPA 2BJ9A 2QFIA 1UKUA 4JB8B 2YXLA 5D0EA 3HKZD 4CO4A 4DLEA 3HSZA 1N8RT 4I64A 5F8LA 4OHZA 4G65A 3OT9A 3PDNA 2WBMA 1S10A 2M2BA 2R7SA 4DN9A 4CLKA 3VCDA 3PFOA 1K8AT 1RTZA 1KRPA 2A2CA 4MAKA 2UUWA 3TA2A 1YBAA 3F41A 3HDSA 4USWA 5ETNA 1FE0A 3PW4A 4NASA 2N3OA 1FRKA 2OD4A 1L3TA 1MN7A 2CQIA 4YY3J 1CVJA 2Y1LB 1RBAA 3QJLA 3R5BA 4USUA 4HR2A 1MNEA 1RT6B 2WW4A 1OS5A 3MEGA 3CE8A 4ECSA 3KJVB 3TAMB 3V6KA 2C2NA 2KVQE 1XN9A 3R2DJ 1KVIA 3GCWP 4DZDA 4CLSA 2HHTA 5AJ3J 3BSOA 2FYXA 1N34F 3TUZC 2YX4A 5D0GA 5K8OA 2XCPA 4NLTA 3SFUA 2C3YA 3U1NA 2R8GA 2F3JA 1RBOB 2NREA 5KFJA 3IM9A 2BE7D 6AT1B 2CDRB 2E9ZA 4DQRA 1S12A 5MAOA 3UCZP 3M7VA 3QJJA 5J2MA 4JV1A 1HIYA 1RT7A 4ZPTR 2OPQA 3R97A 2H51B 3KG0A 5KFWA 3DHWC 3NMRA 1JLQA 4UF4A 5K9FA 3QIDA 4ZVEA 4PRFA 2DO4A 3NBPA 4EEYA 3BO3A 4R5PA 3BQ1A 4OLPA 1LOUA 1NAQA 2VL1A 2V9WA 2IBOA 1S0NA 4IUFA 2R8HA 1GXTA 4DV6F 4J5OA 4PG5A 2CJBA 2L3MA 2V2KA 1QAXA 1FJGJ 4RW8B 2M8DB 1DTQB 2KG1A 4DG1A 1AXQA 2ZD1A 1BLUA 2AF6A 4QWBA 4FKYA 1QSYA 1J5EJ 1QAYA 3H42A 2RQMA 4KRWA 4X64F 2MTLA 4DR5J 2HW3A 2HGNA 3QIPB 3DGPB 1EETA 4LF6J 1H98A 1KDNA 1RT5A 4QQBA 4A4JA 5JUMA 1S79A 1T9YA 2UV8A 4YB7A 1DLOA 1EQ0A 3BJYA 3ISZA 3M6UA 4PWDB 2QMWA 4WK1A 2KYXA 1RTJA 3TZXA 4F67A 2W9BA 2DR6A 4O4RA 2DHHA 5KT3A 4IRKA 4QOTA 1TR0A 4M94A 4KV8A 4GVBA 1DRZA 3ZZUA 4CT8A 1OQ6A 2M0GB 5EWGA 4NLPA 4DX7A 1TMMA 4ECWA 2ZITA 3BGRB 4LBPA 2RVJA 4DSLA 4OYZA 2EFQA 4K59A 1RT3A 1YG0A 3QFWA 4DCPB 1T05B 5LM7E 2CPIA 4PQUA 1U7LA 2BE2A 3BPSP 2CZ9A 3T41A 1RHRB 2MGZA 3MECB 2VPYB 5AXMA 1WC3A 1S6QB 1XERA 1U6BA 1IBKJ 3GQCA 2QLBB 2GVDA 3R1LA 4ID5B 1PAUB 4F2SA 5KG7A 1WWHA 4J9RA 4RW9A 3NS6A 2DNRA 3V4IA 4KY3A 3CJKB 4DPUA 3RBDA 2C2KB 2BUNA 1HBMA 3LQVA 2LU1A 2FVPA 2WAQD 1LV5A 1UJ4A 1M90T 4ENOA 1GXLA 1VRTB 2HQGA 3RU0A 1PYSB 2NPIA 2B5JB 3SSSA 2OAUA 4NCGA 1Y11A 1B0TA 2K06A 4QWEA 2YNIA 1QSLA 3O8WA 3NS5A 2HHPA 3KLFB 4Y2MA 2WVBA 4YS2A 4CO2A 3T5JA 3KUGA 1RU1A 2VB6A 3I9ZA 2R7RA 2C2OB 2VQFJ 1IR2A 3GE9A 3BH7B 3CJ0A 1T94A 2V2VA 3CUNA 2QYGA 3DDNA 2YKMB 3WC0A 3FCVA 3DOKB 1YJTA 5H9EK 1VC5A 2ZH1A 5E5NA 1SH3A 4LFAF 3J7A1 2DHAA 2HQDA 1GK8A 3VHQA 1U25A 2XB2D 3O6QA 4F25A 3ZTQA 4TYAA 1BGXT 3M8YA 3MEEA 2VFVA 2HS0A 2ZH2A 2VDHA 1LKZA 3D1QA 4FPIA 2RH3A 4DV7J 1B0VA 2O01C 2J6TA 1KLMB 3MEDA 2HGLA 3D54A 3NCPA 1S1VA 3G8TA 1RB0A 1FTRA 1PCAA 1S7IA 3I96A 1R89A 1KOHA 4NCBA 1RHUB 1CJUB 3PIOQ 2DGVA 1UPPA 3AQPA 1FT8A 5K14B 4IFYB 4HI2A 4ZCMA 1LEOA 3FZBA 2CQ0A 4LVOP 2ZEJA 4ZVSB 4PUOB 1E6YB 3RBEA 1M5SA 2WSCC 5B09A 4ZCKA 3RBXA 2OPPB 2ZH3A 1ZA2B 1WEYA 4KFBB 4NLWA 2J7KA 5KFSA 1SJRA 3DXSX 4YFUA 2ATLA 4QPTA 4JBCA 2AYBA 2FZKB 1RBLA 1FNXH 4I2PB 4QPXA 4JI6J 5F0UA 1YZ7A 1C1BB 2H48B 3DLJA 4ZPWR 2FUG9 1VQ7S 2XSJA 1D0EA 4M1KA 3UWTA 2C3MA 4NI2B 3W2VA 1RTDA 1PC5A 2JVRA 2WB1D 1SC1B 1WEZA 3DDIA 4KO0A 5J2QB 2CAJA 3UI3A 2KDOA 4ZVRB 1WDDA 1LWEA 4GKJJ 2E5LF 4N47A 3CC7S 4ILRA 2DNOA 5D6GA 1T03B 4F4YA 5HAOA 1NDPA 1QVFR 3MMBA 4JV5J 1H6KX 1K47A 3NL0A 3CMES 4FBUA 1D8ZA 1L3VA 4XAKA 4E0DA 5CYJA 2CPYA 1N34J 3QSIA 2Y8WA 1HNVA 3LH2S 1U0HA 3H2VE 3O44A 1G3OA 2Z58B 1HBUB 2VJVA 1V3RA 3SDEA 5A2QY 2F5GA 4V1Ak 4ZK7M 3P8BB 4DR4J 1C4CA 1MMDA 4OZ5A 4UT4A 3UN3A 2AMCB 3CF5Q 3LA0A 4P7VA 1NZAA 1LWCB 2LMIA 3MI7X 3CJ8A 4YB5A 5A8KA 1HA1A 4K0KJ 1WACA 2EBEA 2W8KA 4CWBA 4DOZA 1QVGR 2G9OA 4GO5X 2MZJA 2CPHA 3B54A 4IR1A 3H5YA 2CG8A 2VIHA 3OTOJ 3GP9A 3SCKE 3Q83A 1LK5A 3EZUA 2QA2A 2EK6A 2ROEA 3JB9k 4C8OA 2CJKA 2PT0A 3QMQA 2NZ4A 2CQCA 2A1BA 4U8YA 2G2ZA 1PBUA 4WFAQ 4O44B 1XK8A 2R9LA 3OQ2A 1RWXB 3VVUA 1VHFA 1N88A 2J9EA 2NCKL 1NMEB 4USMA 2GVZB 2XO7A 5D8HB 2O67A 4LUBA 2R8IA 2NSCA 4X64J 2EC0A 5K5MA 1XNRF 3ZZPA 2GQ2A 4JI8F 1BQNB 3P49B 3K57A 4PABA 1LXNA 1JLEB 3KLIB 2KZMA 1S6UA 2W7AA 4QYZJ 2HBQB 3JXOA 2RJZA 4HACB 2ZOGA 5KTQA 4AUKA 1U1RA 2HBYB 2OELA 2RDJA 1JLCB 2PE8A 4Y34A 3HT3A 1FVQA 3CD6S 5HROB 2DYAA 3V5RA 3FBFA 3M8SA 5DO2A 1IJEB 3NOGA 1WI8A 2CNLB 4XIUA 3C46A 4KR0B 2HRTA 3ZFVA 1YRUA 4YP3A 3ISND 3UN2A 2UVUA 2MKHA 2V8DA 3JQKA 3BGUA 1W2BR 1N52B 4WKRA 5CYMB 4XO0A 4DN0A 1WTFA 1REVB 3BQ2A 4TNOA 2E5GA 4AXJA 2I38A 4P2MA 2GGPB 4WFBQ 4F0KA 4XDDA 3FC9A 4P72A 4DPTA 3KK2A 2XZTB 5FDLA 2NXCA 5GAGI 3I87A 5LXYA 4NXMF 3R7NB 2G2YA 2DVIA 3D9BA 4H4MA 3GPAA 2MQOA 3T1YF 3IWLA 2N3LA 2MKCA 5D78A 2H4WB 2RQKA 1YJ9S 1VHIA 2L9NA 1P6TA 3HVTA 5GAEU 5LMNJ 3C14A 3KTQA 2NXUA 2DGSA 3UW1A 5KFFA 2JFKA 1NK9A 5D3GA 2ACYA 3HX9A 1A9NB 3CEDA 3D67A 2KJVA 4NCAA 2X1FA 3KXDA 2AX0A 5AXKA 1TQLA 2OI2A 3MEGB 1VLOA 2G1DA 3ADAC 3EPGA 4IG0A 2GNKA 4RNHA 2DHSA 3Q86A 2Y1IA 3NGSA 2IM0A 2YNFA 1HPZA 2MKKA 2HFVA 1B0PA 4OHYA 4FF1A 2EK1A 1GEHA 3AY0A 3GYGA 3I55S 3UCUP 3NCQA 5KOXA 4YB6A 2J0WA 2AEJA 3M2UA 1U1NA 3IC1A 1VDHA 4W92B 1CJVA 3S01A 2HBZB 3DM2A 2XLIA 2DNLA 2VPWB 1WOSA 2RS2A 2BOPA 3DMJA 2V9KA 4LFAJ 3CJTA 2YWHA 4DFMA 3NEKA 5ADZA 3GIKA 5J2MB 1RT7B 5C2CA 3K5MA 2OPQB 5T7LA 4B9VA 2FLOA 4NLYA 2YKAA 4DV1F 3E2EA 4F4AA 1D3WA 1JLQB 3E51A 2YTCA 4ED3A 4AE5A 4QYRA 1AFJA 3NBPB 1N5SA 2XY6A 3KNAA 4R5PB 4K5SA 2YY3A 3KJNB 3LAKA 5E3RA 5CXTA 4ZPAA 4PXCA 2XMKA 3N9UC 1IKYA 3PYFA 3N79A 4YDDB 2GO9A 4NXNJ 2EW9A 1S1WA 3H20A 3K0JA 4ED8A 5J1NA 1WSRA 3CMQA 3CULA 4P10A 4OMFG 3AJDA 4DG1B 3DOLA 2ZD1B 1RKJA 1JIHA 3R2CJ 1U09A 2CZ4A 4PG8A 3FRZA 4OJHA 1NJYA 2Z2LA 5BYQA 1VYAA 3AJ2A 2FHMA 4D3HA 1M5VC 3V6JA 1NHKL 1U2FA 1JQGA 2HWIA 2L9WA 1EETB 4YDXA 1F3VA 2Y9HA 2HZCA 3J7Z5 3PHTA 1RT5B 1TUWA 4LIWA 4M5KA 2XEXA 2UUCJ 3OTEA 1DLOB 4FVMA 1PGZA 1B64A 3RW7A 1Q7YT 2BA9A 4QW8A 1X4GA 1RTJB 2Z30B 2W9BB 1WHVA 2K2PA 3PCOB 3E3XA 4TKTA 1IWAA 3MR2A 4OI3A 5DDQC 3B82A 5IS2A 4ECZA 4DL6A 2JWNA 4B3TF 4KV8B 4KGXB 1RSCA 4GVBB 2AWZA 2E5LJ 4DQIA 4UTGA 1WORA 3HFZB 4ZN3A 2Z2YB 2IC3A 1RT3B 3W8PA 1PC4A 4M5LA 4USIA 1HW8A 4PQUB 2BE2B 4EBDA 3W1YC 2V0NA 4ANCA 1MWZA 2D3O1 1WDTA 2CPZA 4GC7A 2MGZB 3GFHA 2UUBF 1AROP 4JI0J 2HKEA 3L7PA 4X84A 2G0CA 2GVDB 1YBUA 4DUTA 3TYTA 5KFGA 4RW9B 3ULHA 5I42A 1EP4A 5BXIA 4ZVQB 1NKBA 3V4IB 1VIXA 1Y4ZB 4M95A 1HBMB 4LRFA 1OQ3A 2PSZA 2KRRA 4KSEB 4B9TA 5HVHA 4LF7F 2IRYA 2QSFA 4F4KA 4KGMA 1FKAF 2AKWB 4OYAA 4NCGB 4R8UA 4K7QA 5J2NA 3RB3A 3M9OB 4DR7J 2PEHA 3R5GA 2YNIB 3M32A 1IBMF 2CQ1A 1NBEB 4FF4A 4DF4A 5HI7A 1Q4RA 1H38A 4Y65A 2XS2A 1OSDA 2O1PA 2JOQA 2CQ3A 4A8SA 2NS1B 1V3SA 4J9QA 3UVJA 1SQGA 3VF0B 4IH6A 1R8HA 3UO0A 3M8RA 2JC1A 3PRVA 2VZ9A 2ADBA 2XY7A 1IR1A 1UEKA 5KT6A 1TKXA 1KNZA 1JLBA 1FRLA 3B4MA 4O23A 5HMZA 1AUSL 3HFKA 2CNNB 4JP8A 5KFOA 3OTDA 2IM3A 2KFYA 4Y3CA 3IRWP 1XNRJ 2MPUA 2R2UA 2OEJA 5SUHA 1HBOA 4B9MA 2UXBF 2J5AA 2D69A 1VQ5S 2LDIA 3MEEB 2HURA 3PR4A 1R8AA 3R8YA 2QT7A 1M1GA 1WHXA 3MM8A 1Y10A 2BABA 4FKXA 4ILLA 4CLUA 2JVOA 3TEGA 4JI2J 3MEDB 1FNOA 2HK2A 1S1VB 4DL5A 4XPEA 3BDPA 1IM6A 4EBCA 1WF0A 2HHXA 5LJ3Y 1HNWF 1H2VZ 4YUDA 1RAHB 5CAAA 2IVYA 5I4MA 1RWKB 1RT2A 1SL0A 4RU2A 1TZ0A 3DRYA 3OR1A 4URSA 2K3KA 2DRDA 3DNCA 5DS7A 5EX3A 2WZ1A 4RW7A 5B0GA 3CWJA 2CPJA 3FSIA 4LT6A 3R3TA 1DTTA 1RT4A 5KG6A 1X4AA 1YK9A 3OJUA 1VGYA 1H74A 3T1YJ 2YQ0A 1PSDA 4DF8A 3AOBA 2C3UA 2FZGB 2JH3A 4F8RA 1A6LA 4WP8A 3CCLS 4CNZA 3AB4B 1CSJA 4LBHA 5LXRA 2XSJB 1HI1A 1D09B 3QRRA 4RBUA 1QE1A 2OGUA 1QSSA 3L3CA 2YNHA 3W2VB 1RTDB 4J37A 5CD4H 3C6TA 5F0WA 4G1QA 4KO0B 2K1RA 3ENWA 3MCSA 5C5JA 1LWEB 2EI5A 3QPIA 3QATA 4HH1A 3TUJC 3HJVA 3MHYA 4OYXA 4C4WA 4Y2IA 4ZLNA 2XS5A 3MMBB 4BCAA 2RNEA 4J9NA 4Y2KA 1CC8A 1T7PA 2YNGA 2YWKA 4CH1A 2HVDA 2E44A 1AFIA 1HNVB 1U0HB 2I8EA 1NK0A 5B7WA 3SDEB 4AQYF 5AXNA 3FSYA 4OFZA 2YWEA 2ZM6J 3G2XA 3EZOA 3R5JB 1D9DA 4KT0C 1U2RA 4L76A 4GKKF 5HQ8A 1WELA 1S9FA 2C2ZB 1WOOA 1BWVA 2B8PA 1MMNA 2YX7A 4N8NA 2D3ZA 3GFXA 5A8KB 2BACA 2EVZA 1NJXA 5L8RC 3DCAA 4KHPJ 2Z8QA 2ZHOA 2I6WA 3GWCA 1U48A 5DZ7A 2D74B 1HFEL 3UDLA 1DQ8A 2XM3A 3IR7B 1TKZA 5DQGA 5F3TA 2KFNA 1BHNA 2P9CA 3IN5A 4IDKA 2KFZA 3GZ7A 1ZBTA 2G13A 4IO9Q 1V3ZA 2LEPA 3CDEA 2ZWPA 3FKBA 4LSZB 1Q81T 1RU2A 2ASDA 1SH2A 2KB2A 4OZ1A 2LECA 1R0AA 2AV5A 1VQ6S 5H1SV 4LVNP 4RR5A 4CIOA 3DKDA 3MEKA 1N4LA 1DY3A 1UP1A 1KR4A 4M5DA 4ED2A 1YJWS 2E7VA 1KVKA 3D0HE 1VQPS 3FGVA 3OSNA 5HJYA 1FJCA 5HVFA 3D6HB 2FC8A 4Z2XA 1FFGB 1FRXA 2V63A 3BKFA 1IQTA 1C0TA 1R6YA 1EIYB 3VGTA 1VQOS 4B08A 4RZRA 1IBLF 4MH8A 3GSDA 1KWMA 2ZJPQ 4B3TJ 4WFNQ 1REGX 2P9EA 1BY9A 1FEHA 2W2QP 2ASJA 2H4YB 4IQMA 4OJ1A 3CDWA 2CWXA 2MZQA 3J81j 1A7GE 2QSWA 1QLNA 1T11A 2CYYA 1VISA 4OYMA 8AT1B 3B4DA 3KK2B 3D6FB 2EFGA 4N7TA 3HD1A 5FDLB 1SB6A 2IHR1 3OFFA 3F0NA 5I3UA 1S7HA 1RAOA 3FK4A 5HLFA 4L3NA 3GILA 4H4MB 4OZJA 2GJ2A 2IM2A 3W61A 2YKNA 4DR6F 3IFEA 5KFPA 5EGYA 3LANA 1PG5B 2IMWP 2AU0A 4K4YA 4F7VA 1Q7LB 5KFAA 3HVTB 4Y28C 3TQ1A 3LF0A 3C14B 1IN0A 1RWNB 1ZZNA 4F3MA 1VOMA 3AHPA 2V8GA 2CXEA 2AD9A 1RE1B 4LF7J 3K2YA 2ZH6A 4LF9J 7FD1A 5D3GB 2AGOA 3J7AN 3A8EA 4LQ9A 3G8SA 1FKPA 3AA9A 1U1KA 4OIXA 1R43A 4X66J 4AL6A 1IBMJ 1UMJA 2CPEA 1N33F 3MOZA 1TAQA 5CYQA 4IOBA 2ZH8A 4DL2A 2Z2ZA 4IG0B 3U1MA 3QT8A 2QLWA 5F8MA 5JMNA 3QBCA 2DY9A 2YNFB 5DDPC 1HPZB 1AA1B 1V9OA 1OSCA 2YH0A 1YTYA 4C11A 4QYZK 3M2UB 1RISA 2RIJA 3GJQB 2ZOFA 4PZVA 3OFHA 4N8OA 2PFDA 3L09A 1CJVB 2I5JA 5ETPA 3DM2B 5KG2A 2PD1A 3TA1A 2C42A 3DMJB 3RB6A 1N36F 4GRSA 4P6QA 3MPVA 2BV3A 3HSJA 1VQ8S 3FQKA 2VDIA 5T7LB 1YI2S 5LL6d 3CGIA 2VD3A 3GSIA 2MKJA 4HL9A 4X65J 2W2MP 4LFCF 3HVWA 1TV6A 3MM9A 2FZCB 1FDBA 1K9MT 1M5OC 2P2CB 3PV8A 1IKYB 4HLBA 3DLHA 1C0UA 4P2FA 3MFHA 2IYGA 4X4UA 1UPMB 1S1WB 4LRDA 1FWKA 1XWLA 3W2WA 3H90A 1X4FA 1NPRA 3DOLB 4PPDA 3A13A 2LYVA 2N4CA 1V5VA 2PA3A 1XMOF 3BSNA 4DL3A 1HYSA 4CO3A 3EDQB 3OXGA 1S76D 4EWTA 2HVEA 4TVAB 2NZCA 1ZTTA 4UY8T 1YGYA 2A10A 5L38A 2FVRA 1FKOA 3Q8YA 3OHAA 3WZ0A 3GR0A 3M9NB 2W4DA 4HHHA 3HHLD 5C25A 4DSKA 1GH8A 4XDCA 2J8SA 2HFNA 1GFWB 3FBEA 1S48A 1SL2A 3CJQA 4F2RA 3PXGa 4DQPA 3HPOA 4ANDA 4Q8FA 2M3DA 3GLJA 5A0YA 4LF5J 2R8KA 1KD1T 3BKTA 1DAXA 2E7WA 3D0IE 4A8FA 3F56A 4J9VA 4RBTA 3CB4A 4KGVB 2G0IA 4LRBA 3RZAA 3NWGA 4MK8A 1VC0A 3C6UA 2B3TB 2W1BA 3ET6A 1G2EA 2OEKA 1Z2LA 4DR2F 1HNXF 2GJFA 3U7JA 2PEBA 2IC3B 1QD1A 2AZ1A 1IBCB 2HAFA 3W7BA 2QE5A 3K17A 1H7XA 2XS7A 1XR6A 2V4JA 4FYVB 3MUTP 2AEFA 4AQYJ 3CCRS 5CZVA 2AGPA 4DFPA 4DCOB 2OIHA 2OPSA 2W25A 4ZVUB 3TAQA 4GKKJ 3T9ZA 5I42B 2RSQA 1EP4B 2YVSA 2BANA 1RAAB 4CM2A 1PO6A 4EGLA 4PEOA 2JEGA 5FJ4A 4M5HA 3R5DA 3PY8A 1L5UA 3R5CA 2HRYA 3B6BA 2LQJA 5CZXA 3IR6B 3H5SA 5JJBA 3VQTA 3SSQA 1ZS6A 4R8UB 4J9LA 2DHXA 1NRKA 5J2NB 4NLVA 3AXKA 2FHKA 2DCUB 2CA9A 3M32B 1VK3A 4ZMMA 4ANEA 3ISNC 3H59A 2ZHBA 2PO4A 4N41A 5KFBA 3NNHA 5F8GA 4RUHA 1WF1A 4HYKA 3UVJB 4RLEA 5AE2A 2WVCA 2MLZA 1S49A 5FLXU 1FF2A 3X1LB 4J7CA 1B7YB 4DPWA 4OX6A 3ZO7A 2MXYA 3HJFA 2H1YA 2XSFA 4DV5F 1TKXB 1JLBB 1JMTA 5J2PA 4ECQA 4H4KA 4DWIA 1P9YA 3TEHB 5K8MA 2CQ2A 4RNOA 3N6NA 4G1IA 3H40A 4BDPA 3QNWB 3MPYA 1F60B 2E1MC 1HBOB 2XZWA 3CCWA 2A3JA 4H54A 4DEZA 3MMCA 1X0PA 3KK1A 2HIYA 3MM8B 3D66A 5D4OA 1FFWB 4OYWA 4NLOA 1SIWB 4B3SJ 3EZ5A 1URRA 3A3OB 5IV4A 3W63A 3BBCA 1IBLJ 1N54B 5H9FJ 3BBFA 2Z2MA 4Q44A 4ZVTB 4DS4A 3EUNA 2UXCF 1WF2A 2ALYB 2DK2A 3VAGA 4IG3A 4MYTA 3OW2R 3HHLA 4PKDB 3FBCA 3W65A 2V6AA 3GV5B 4DMZA 1RT2B 4F3OA 1H72C 1XC9A 5LSRA 3OR1B 3GYNA 1S99A 4RW7B 3CO9A 1RHKB 4FF2A 2KJWA 2QLXA 2KHCA 3PACA 3LPYA 1DTTB 1RT4B 1JLGA 4RU9A 2DISA 2VBZA 1TP7A 4EO8A 5L46A 2NXJA 2RRBA 3QZ8A 1QE1B 2YBVA 1NB7A 3QSYB 3P5TL 2YNHB 3NGTA 4OJ3A 2EFVA 3C6TB 2E1CA 2NUUG 4G1QB 4QW9A 2K1RB 4CLFA 3A8KA 4YN3B 4ILMA 3DHXA 4JYAF 4EK2A 1EJ7L 2OH2A 2QFJA 2GJIA 4USKA 2QJ3A 4C7QA 4UZBA 2XHWA 4F4WA 3TNVA 5HMXA 1U6FA 3GJRB 1H7WA 2YNGB 2RDIA 1Q8BA 1X0FA 4DLGA 3V4MA 3TP2A 4AD6A 1IQZA 1H73A 2BKOA 3N6MA 5FIIA 1ITPA 2ZWOA 2PMWA 1KS2A 3VTIA 4X4QA 4QIGA 4OX9F 4WZQA 1N36J 1ZZFA 1R8BA 3FNNA 2Y0SD 3X3UA 1WTBA 4MKAA 1VMBA 4M5MA 1I1GA 3PG9A 2IJFA 2I9SA 4EZ9A 5KFIA 3C19A 1U8SA 2NR0A 3Q8PB 4PQAA 1C2PA 4KKOA 1U4BA 4Y00A 3NAHA 1TKZB 1ZPVA 1RABB 2X1AA 3RAXA 4DV4F 3PHEA 1HHTP 4IDKB 2YQ1A 5K8NA 4UZCA 1TFYA 2DNQA 5DGBA 5GVQA 2DGOA 1HQEA 1T0TV 2XLJA 1Q8IA 4QZVB 1RT1A 3K5NA 1Y5IB 2RT3A 3C16A 3UD3P 3QRPA 4F3QA 1R0AB 3KMSA 2N7YA 3R6LB 1FWPA 4W4MA 3BR8A 2JNJA 5GAHU 3THTA 5EUHA 1XMOJ 3OL8A 3RAMA 5GADU 1YZ6A 3MZIA 3VAFA 3U1LA 4NZ6A 1ELOA 2JEFA 1S97A 4M5DB 2LQ8A 2RE1A 2MY8A 3V6HA 3LOUA 4Y2CA 5D4PA 1RXOB 1R7IA 4QR1A 3CCUS 4ZS6A 1FVSA 1ZM2A 1U2CA 2HK3A 3I5CA 4CRJA 4DUYF 2QV6A 1LK7A 2VF3A 5K8PA 3M8ZA 5HJXA 1KP6A 4G3IA 2ZVIA 4V19J 1RWMB 3KHGA 4ZHRA 1K44A 1C0TB 2VG7A 1PYTA 4UOGA 3MURP 5JVHQ 4FNIA 4LR9A 3W8GA 3OXLA 2PI5A 3ZNUA 4DCJB 3NWRA 3CW2C 1CULA 1VBYA 2HNDA 2R2SA 4DSFA 3C8YA 3JTNA 1FK9A 2CFXA 3KUEA 4RKUC 3G6VA 2K7JA 2AJ4A 3BYRA 2HWTA 4OI2A 3CDBA 3T5HA 3D5MA 3VAMA 3MXHP 2LXIA 4EYIB 4C0HA 2F40A 4Z7CA 5I3UB 1YHQS 4TXSA 5HLFB 3IP0A 2DNNA 2HVHA 4FYYB 4RO0A 3RBZA 3DLLQ 2XZDB 4DL4A 1MG7A 2YKNB 2C2MB 2H5EA 2MQ8A 3IGVA 1PILA 1T3NA 3T6BA 4OZ2A 4M8LA 1UEVA 3J7YI 1FKPB 3N01A 2L9DA 1IWGA 4P2XA 4YR2A 2DO0A 5CYQB 3O1LA 2BJEA 3ZTRA 1XMBA 1F0XA 3UPFA 5KT4A 2HQIA 4I7FA 2VOOA 4RW4A 3JAMY 4C11B 1XMQF 4DV5J 1NK7A 4DFKA 4ZPCA 2C3PA 3QJPA 4EI2A 3PR5B 1S1XA 3ZXWA 2I5JB 1QUVA 1GQEA 2DITA 2BJ3A 5E7OB 2FJXA 2EKNA 1ZETA 1SJ3P 2YQ3A 5ETQA 1UVMA 5KG3A 4YMEA 3T5LA 4I6AA 5RUBA 3HHNB 4HVZA 2OLWA 4DHVA 4F26A 2ZH9A 4EFAC 1U8WA 1DQAA 2XMMA 2RD5C 1TVRA 2FHJD 4C9DA 1SC6A 2KM8C 3KWMA 1TV6B 3SXLA 3MM9B 2JDJA 3RGIA 5IFMA 3DOMA 3PYEA 1C0UB 3SQOP 1WKJA 3CCES 4OLOA 3CCVS 5IT9Y 3RG6A 2PGCA 2XTJP 4MTPA 4ID8A 1K0VA 2UU9F 3V81A 1F6TA 4FYDA 3EVMA 2KI2A 3W2WB 3OXFA 3Q8UA 2OMLA 2GMHA 3MAAA 2MY7A 1HYSB 5I3PA 2VC1A 1YQHA 5HSPA 2ASYA 2UVWA 2R7XA 4CLYA 2Y0BB 1S59A 2VBYA 3I56S 3QZ7A 5J1PA 1Y5LB 4MIBA 3N28A 4DU7A 4NLXA 2KXHA 1FKOB 1Z2ZA 3TX8A 3TI0A 4XPCA 4OJGA 3W66A 5DJBA 3SI8A 4Q2LA 4ECVA 1I5OB 3ZZOA 3GMGA 5C25B 4TLRA 3LWLA 3P3DA 1HBNA 3N5FA 1UVKA 2FC9A 4LRCA 3OFGA 1MW7A 1KEKA 3RR8A 1J2VA 1RLDA 3HD2A 5A0YB 4Q5VA 4ZP7A 2F9DA 3T3FA 2MJNA 1LW0A 2GIQA 3EYZA 3WQPA 1BQXA 2OFGX 3QT6A 5AE3A 4JYAJ 4F04B 2FLNA 2QX0A 3GIMA 4Q8EA 1Q16B 3C6UB 4JUZA 3BN7A 4OX7A 4WTYA 2FTRA 2BM0A 5KG5A 3ET6B 1S5ZA 2YKPA 3EXCX 2Q1LA 1B3TA 4I1TA 3P5BP 2DNHA 3A1YG 1D8YA 1JJHA 5ITHA 2H5IB 2IJNA 3THVA 1FCAA 5E3CA 4QWCA 4EU0A 1KTVA 1FEEA 1VCTA 3GJSB 5ETVA 3W64A 1UFKA 2VASA 2SXLA 2V4JB 4TQRA 3AA8A 3OR2A 1ZAWA 4B17A 4WE1A 4P7TA 1YDLA 2OPSB 1VJQA 1U45A 3PJ9A 1NK5A 1TL5A 1X5OA 3CSKA 5AT1B 2BANB 5HQMA 1HL6A 5LSLA 4WP3A 1URNA 2FY8A 4PG4A 2CPFA 4OX9J 3QFHA 2B6AA 2BRKA 2OD6A 1S6PA 4P73A 1Q82T 1NSAA 1IKVA 5DM7Q 3DRXA 4LF4F 3OUYA 2M70A 1UTAA 2BEFA 4KBIA 5L39A 1VR6A 4JI1F 4C48A 4CZCA 1QAJA 2ILZA 2RS8A 3I9V9 2C2EA 2U1AA 4HTJA 1F5AA 3K5OA 4DV4J 1KN6A 2DPIA 2E7XA 4Q0BA 1PIEA 1NSQA 4PCQA 2G0JA 2H5JB 2D3UA 4ZVGA 3JSMA 4NA2A 3T19A 1Y3KA 4DSJA 3L7OA 2GAHC 1FDDA 3NRBA 4ES2A 3A3NB 2CVEA 5A8WA 4MIWA 4EMDA 4C8ZA 2J0SD 2FHJA 1JJ2R 3US5A 3VGSA 1Q95G 1RUSA 2MSSA 3HLUA 4ZDNA 5J2PB 4E98A 1RCXB 2QMXA 4LSLA 2PIIA 1Q86T 3VWSA 5G0RA 2XGQA 4AL5A 3L4BC 4O4GA 1BC6A 4MKVA 1M5HA 2B7BB 3Q8RB 3TWZA 3BB5A 3HHKA 2V4QA 1RACB 4I69A 2W7PA 1GTHA 1KHVA 1NDCA 3MCMA 3MPWA 1GXUA 2GQQA 4RWXA 3MMCB 2WBRA 4A46A 4A8YA 5LJ5Y 4ECYA 3KK1B 1M0SA 5B08A 3FEZA 3RTVA 5CD4A 2VONA 2M7SA 4WXWA 3MWBA 2WSEC 1F5CA 3D4JA 2M4MA 2JEIA 3Q0AA 3N4WA 3MCOA 2HZAA 2VFRA 5B0AA 5HVGA 1RDRA 4IG3B 1BMQB 1X4HA 5KFHA 3HHLB 3O3LA 2IBKA 1X9WA 5KFNA 4JI5F 4LF2A 1HWIA 5L1LA 1S4FA 4X4TA 3Q89A 3BBBA 4QJVA 3ITHA 3GV8B 1SCJB 3EVOA 2HEKA 4UOHA 2GV1A 1SKWA 4P52A 1N5TA 4GC6A 5THWA 3T9NA 1WC5A 3TUIC 1JLGB 3FFIA 5F8JA 2CRLA 1AT1B 4UUWA 4K4XA 1LFWA 1SJQA 1UW9A 2V5HG 1F1BB 2NPFA 2RAQA 3P45B 2M8HA 3FMBA 5D77A 3JSYA 4G6VB 2H54B 4NMXA 4KGZB 1XNQF 1IXKA 2XY5A 1PJ6A 4MK7A 2B56A 2U2FA 5IOLA 3JQMA 2D9OA 3RUBL 4CO1A 3TQEA 3ZZZA 4H4KC 4USVA 5LMUF 3W5YA 4MKYA 2N82B 4JI3F 2UXDF 4X4RA 1RAGB 3H2LA 1SBRA 5L9XA 2VPXB 4KE5A 1VQNS 4OV6A 1SUQA 2R2TA 1T9TA 4HEA9 1D9FA 4C0OC 2VG5A 2J76E 2X3DA 4WJBA 4DV0F 4KQZA 4Q45A 1H2UX 5A2QU 2Q66A 2ZKTA 4NEZA 1N0VC 3IAS9 2RMLA 2NUHA 2EEYA 4DR1F 2D7SA 4X4SA 4KJIA 2DNMA 2V4RA 5DG7A 1KTQA 3HHLC 2E9TA 4CI0B 3WC2A 2AGQA 2YPYA 1RA7A 2PC6A 4B3MF 1Y0HA 2HFZA 4NWBA 5H9FK 3G4SS 2J0QD 2D41A 3I31A 2JZ5A 4URGA 4KIAA 1YKWA 3CO0P 2CQDA 2WCXA 3A8IA 4KKOB 3W3SA 2Z0GA 5EDWA 4P71A 2OP5A 4IQXA 5F9NA 2AEMA 1UL3A 2X7IA 3NAIA 1CS4A 1JXLA 2APOA 1NHVA 2RUSA 1DZ5A 1U49A 1PYOB 5CHCB 3BO2A 3LPEA 4C98A 1HQEB 2R7UA 8ATCB 2AJFE 1RT1B 3C16B 4ZLLA 3S6EA 2MLXA 2C28A 5ETMA 1NEEA 4K8RA 3PX0A 2GA7A 3HI9A 2NYHA 5DG9A 2VFUA 1GX6A 3DRPA 1T9WA 2KL8A 2RRNA 2OFHX 3BS9A 5K20B 5IT4A 2MLYA 5CA5A 4U7UK 5D4NA 3IR5B 1NK4A 4FN5A 3QGPA 2XBPA 4K4ZA 4ZITA 1UWBA 4ZLPA 1Q1KA 4YHHF 4OYPA 3IWXA 4ZHRB 4OI0A 5IXUA 2FDNA 2VG7B 2WHOA 2MJUA 4J9MA 3A3PB 4QIVA 1KFDA 1RTHA 5HMWA 3CVKA 2GFFA 5FLXY 1CULB 4CYUA 2BVZA 2HNDB 3FVYA 2COLA 1VQYA 1FK9B 2ZZMA 4WXOA 5IV3A 2WRMA 2IDLA 5KFVA 1NU4A 2J9DE 5EN1A 4OL8A 1HHQA 1NHUA 3BZQA 1NJZA 1HI0P 3TVYA 3HK2A 2KG0A 2YX1A 2MZSA 4OV1A 3U02A 4C3KA 2JC0A 3MM7A 2WVDA 1ZTWA 2LLZA 3R27A 1VJWA 1U1PA 2FLPA 3R5AA 2EBGA 3BN4A 4DV6J 1HNIA 3Q8VA 3GR1A 5A76A 1VBKA 5DGAA 1Y7PA 4LF4J 4IFVA 2QA4S 2HFOA 3PW7A 4NLDA 4F4ZA 4NEYA 2DXFA 1FJGF 4B3RF 4NYOA 3UDVA 3R7SB 3NNCA 5GAHI 4JI1J 2LXUA 2RDDA 3HMJG 2D1CA 3NMAA 3PX6A 3PTWA 2YWFA 5GADI 4BLGA 1IVZA 1Q53A 2CADA 1OYEA 3UE2A 1MMLA 4KH0B 4KH1B 4N76A 4LQ3A 3POTA 4BBYA 1J5EF 3NLCA 1Z1ZA 1OJ4A 4DDFA 2ZZTA 3ZZRA 3OJSA 4DR5F 4C8KA 2P9GA 3TR5A 4LF6F 2QYCA 3N6LA 2ZBCA 3MTKA 3C15A 4I7FB 1FRMA 4RW4B 1TELA 2QZ8A 4OYBA 3EVWA 3Q23A 3W9HA 4QBUA 3AD8C 4U67Q 2DB1A 1M1HA 3CDUA 3LGNA 1S1XB 4DPYA 2DNYA 3NGRA 1SQFA 1O0PA 1UW4A 2RB7A 1KHWA 4C97A 4AYBD 1SH0A 3TA0A 2F8HA 2BOAA 3PNIA 4PAAA 1WKLA 3K58A 2AJ1A 2F65A 2NLWA 2HLUA 1TL4A 3OV7A 4C3MA 2ZDOA 2R7QA 4PR6A 1DHMA 3H98A 2BKNA 2GHWA 1RTIA 2VV5A 2HPUA 1TVRB 1WG4A 3WIVA 1NLKL 6FDRA 1N5VA 4ELUA 2I0XA 2LEAA 2VFTA 3H7HB 1NUEA 3G8QA 3UNYA 1EX8A 3DOMB 1CQNA 3J81Y 2DH7A 3NNAA 1YJNS 5ETLA 1KQGB 1RLCL 3TO8A 3KKFA 5DG8A 3P6YC 1YX2A 3S1TA 1SV5A 1VC6A 3V81B 2PI4A 3WDOA 1B99A 5B0EA 2HG4A 3UDCA 3FQLA 8RUCA 3HHEA 3DRRA 4JI5J 2W9CA 3MAAB 3SFGA 2XLKA 2XYGB 2AYEA 1DQ9A 2E66A 2DJWA 4WIIA 4HT5A 2V8HA 5E3QA 3RB4A 5M2UA 2DXEA 5GAGU 3KG1A 2R7TA 4KC5A 4RL1A 2BJ7A 1VLYA 1HBNB 1LWXA 3RRKA 4LF8F 3IBCB 2BBEA 3CC2S 4OI1A 1XNQJ 5F3ZA 5BYSA 3CC4S 2JHEA 4S0MA 4A8XA 4OHXA 1JJCB 5DZ6A 2VQFF 1LW0B 3R7BB 1S72S 1JNZB 4FDFA 3ZZYA 1OY9A 3OTCA 1HWUA 2WTFA 2UXDJ 2VODA 2Z57B 4HDHA 5HK4A 4P9SA 1UVJA 4FP9A 2F4VF 1R8PA 1GMUA 3BGFA 4MIAA 3NG8A 3OL9A 3F44A 2E1RA 4P74A 1AYEA 1UFLA 1HKAA 1KOOA 3OR2B 4WE1B 5E0OA 2XQCA 2AHOB 2QO3A 3O5TB 4Q7AA 3M8PA 1K73T 5C24A 1TKTA 3TZWA 1VQLS 3PJXA 2B9YA 2GC8A 3HM9A 3ZNJ1 1XJWB 2GQCA 3N0VA 4C0BA 1LXJA 2B4VA 3D2WA 1F9EB 5HATA 2B6AB 1N48A 1ZYQA 5KFUA 1S6PB 4J9SA 4A8QA 4C3LA 3AODA 4IYQA 4M5NA 3KLHA 2FVQA 1IKVB 2MKSA 2VFSA 3M1VA 4HHJA 2E1AA 3OUYB 3GIJA 1DJ0A 1S9EA 5F8IA 1S9GA 3VGUA 3NP5A 1JNRB 4ZPBA 1IKXA 2F4FA 3JQJA 2XGPA 1BWEA 4A8MP 4Q0BB 3D3CJ 2CQHA 3JSMB 3JYTA 1RAFB 1L3UA 5DM6Q 2QL5B 4F02A 1JLAA 4I4BA 5KFYA 5A8WB 4U9RA 2GHVC 1M5PC 4JI6F 4LSLB 2YPZA 2MHEA 3TARA 2WSFC 2XG8A 5G0RB 4O4GB 3PRBA 4CH7A 1YBTA 5A6PA 4QU6A 1WJ9A 2CJQA 5DDOC 4F50A 3G87A 2DHGA 3SV3A 4GKJF 2IM1A 4ZKAA 3PYGA 3FEXB 3IBWA 2OPRA 4HH0A 4YHHJ 2Y1RI 4MT1A 3PVXA 4HI1A 1VBZA 2ASLA 2ZH4A 1DURA 3RR7A 4DSIA 2ZBQA 4JV5F 2I2YA 3L95X 3WBZA 2ATCB 5ETOA 1FJ7A 3J80U 2MDAA 4NLUA 3BPDA 1RKIA 3PRDA 4MKBA 1OMSA 4M63A 5IQ6A 2KVIA 3NKYA 2A0FB 4DR4F 2XI3A 5HMYA 3DRSA 2J6SA 4LR7A 2HQCA 3MR3A 3ITHB 4CM0A 1GT8A 4K0KF 4TY9A 1T9UA 3OLBA 3GG0A 3FFIB 2AYGA 5B0DA 2QN6B 2DRBA 2IY5B 1X7VA 3OTOF 4CO0A 3ZZ0A 3CD7A 5ETTA 2UUTA 1X4BA 3HP6A 4PYDA 2B9WA 3ONQA 4ELVA 4MJKA 2X3GA 2LKZA 2QA4G 5IZHA 4CLWA 3EJMA 2PDAA 4RPFA 4L3KA 1TL1A 4I67A 4ED0A 1RJJA 4ZP6A 2IA0A 4B3RJ 4GVLA 3FEYB 4U7CA 2BQRA 5C2GA 2W8LA 3EGNA 4UQTA 3I6PA 3D6TB 1V5IB 1JXVA 3LW5C 1S1UA 1RYSA 3JTOA 4WKYA 2ALZA 1JKHA 4A48A 1XQIA 1F9FA 2CJ9A 3MPDA 5DRKA 5CCMA 1N6QA 3BREA 1J5OA 1D9AA 1SUQB 3PJWA 4UQGA 3DFEA 4XK8C 2N7CA 2ERRA 3WX8A 2VG5B 4JI8J 4A8WA 2V69A 2W4PA 2V94A 3GV7B 2FVSA 2ZH5A 3VZHA 3CJ5A 3EDRB 2MQQA 2DGWA 4AFFA 2WONA 3QQCD 1RADB 2VU5A 1FJEB 2DGQA 1R8CA 3CXCR 1VRUA 3PO4A 4TU7A 1YJRA 1KVJA 1G7CB 2YWWA 4U8VA 2ZVSA 3Q2SC 2UVVA 3DC2A 2MHNA 2G1HA 2A2DA 1YVFA 1FE4A 1RHMB 5HANA 1QUPA 3IGNA 3RJMB 3W60A 3DXBA 3UN5A 1YWXA 1WSVA 1WNEA 2ZKUA 2Q43A 3ZZTA 3I82A 1O8BA 4Q2MA 1CS4B 3I32A 4F4XA 1NM2A 2QEXS 2F7VA 4OYOA 3GFYA 3TZYA 4BWMA 3PZPA 4NXMJ 1S0VA 5L1JA 4ZIVA 4PXBA 3WX4A 1RI7A 4FVCA 4CTAA 2F8MA 2MEWA 1FWLA 4EZ6A 4X62F 3R1HA 1MWYA 1RWWB 2L08A 4JOUA 4ZA1A 1Y3JA 3DRPB 5LMNF 2OKQA 2VUGA 2IDEA 3OBIA 2HGMA 4IR9A 4NOHA 2E29A 2W7OA 4USHA 4RUCA 9RUBA 3OPKA 2Y3YA 1Q8KA 3RB0A 2A6MA 2IJRA 3UQSA 3SV4A 4EBEA 1UWBB 2ZH7A 2B4UA 3GU0A 4I6WA 4NLRA 2G4BA 4I0WA 3TJ9A 2FLLA 4LF8J 2CG4A 3MD3A 1MSWD 4AXIA 1RTHB 4URQU 4J9OA 2VICA 5ETRA 2O3DA 4CYUB 3SEOA 5GMDA 2CDQA 4ZVHA 5KG1A 4OHWA 4DR3F 1XR7A 4KPYA 2F4VJ 2R3VA 1HI8A 1TUVA 4DPOA 1U24A 1RWVB 2RF2A 1HNZF 3LALA 1FDNA 2V34A 5CCLA 4WP9A 1WEXA 3P4UB 3IXQA 5HL7Q 3I4PA 2XCAA 3KHLA 5IC6B 3GIIA 3I4HX 4B9UA 3EGZA 1FI4A 4DV1J 4CLPA 4ER8A 1OY6A 1ULRA 3MM7B 3A12A 3HO1A 5LOQA 2FIUA 3FRYA 3MMAA 3LUYA 4N5SA 3G96A 1BXNA 3DLEA 5L1KA 4O3PA 4GO7X 4BC9A 4WPAA 2GZOA 2XYPB 1FNMA 2HMIA 1HNIB 2JX2A 3L9ZA 4NXNF 5J1EA 1HWLA 4IFVB 1UJ6A 4ECTA 4NLSA 4AL7A 3A4TA 3QAUA 5E2QA 1KQSR 1LW2A 1NJWA 3DLGA 4C8MA 2FHOB 4WFYA 2MZRA 3POTB 4RWWA 3M9MB 3OTBA 5AXLA 4WYWA 1U26A 5EHHA 3G6XA 1SKUB 3QO9A 2V67A 1Q5YA 3SZ2A 2XULA 1QJHA 2B8QA 1NPPA 3C15B 4KHMA 1UA0A 1UEUA 4DX8H 4TYBA 2DR5A 5L1IA 3T5KA 2UUCF 3FUYA 2A18A 4OZ0A 3QAEA 5AE1A 2J7UA 3DYAA 1RWOB 1CC7A 5HBMA 4DQQA 1I51B 2R4FA 2KH9A 3VAKA 5IQQA 1YSJA 4J9PA 3DI6A 1XEZA 5KT2A 2PMHA 3FCHA 2DEIA 4DU8A 5B0BA 3KK3A 4RNMA 3E8OA 1RTIB 3GONA 3M8QA 2NXEA 2IIHA 4IOAQ 5CQGA 4KB7A 5KFRA 4U7UD 2AP6A 3M2VA 4CQ1A 2CKWA 1NH7A 3D0GE 4ERDA 3BSCA 1WI6A 2GCFA 3QLHA 3VVTA 3GTYX 2DY1A 4KPCA 3IS9A 1RWUA 2R7WA 4JV2A 2VBWA 4EYHB 2AIRB 1HMVA 2RKIA 3SQGA 2VA2A 3BM7A 2UUBJ 3MM5A 4QIEA 1SV5B 2HRUA 4UOFA 2EFNA 3MD1A 2KT2A 3W9IA 4JI0F 4ETZA 1UA1A 1S57A 3GIRA 2RHSB 1CJKA 2CQPA 3BV8A 1Z4UA 1BQMA 1NPKA 4X4OA 3DRRB 2W9CB 1S6OA 3D68A 3H25A 1IM4A 4ZOSA 4K4VA 2OUGA 5KOWA 3TOQA 4JI4F 3TZZA 2ROPA 3P96A 1H3DA 4QR2A 3KJFB 5F8HA 1SVDA 2CPXA 3ZTSA 2UVRA 4DR7F 3K5PA 2R7VA 1DFDA 3HSDA 4GMKA 2EG1A 2LA4A 2W2PP 1L3SA 2RU3A 1U1OA 3N5BA 4KHRA 2HHSA 1UZHA 3SCJE 3ELHA 4DS5A 1VRQC 1KSPA 2J9CA 3NGUA 1Y9OA 5E33A 3MM6A 3C66A 3SYZA 4W90B 1ZAXA 1S0MA 4DBQA 2UV8G 3MTJA 2PMZD 5T14A 2DRAA 2QMUB 3HKWA 3PX4A 5KT7A 1UAWA 2UXBJ 3M2RA 4D3GA 1VIOA 1SC3B 1X5SA 1HR0F 2BQUA 2KZZA 2HBRB 2C2RA 2AZ3A 4FBTA 2KKHA 2DBBA 2ACMA 1H0HB 2XMVA 4YB1P 3M8PB 5C24B 1TKTB 1TK5A 4J91A 1BUXA 4ZP8A 2LCWA 5U47A 4RNNA 3KHHA 2YH1A 2FGCA 3LP0A 4JI2F 1NSKL 4O3QA 3QGIA 1HHSA 4FXDA 4FXVA 4I2QA 3KLHB 3CJRA 2VQEF 3M1VB 1HNWJ 3CD0A 2F9JA 3LO3A 1S9EB 1GAOA 1S9GB 4HDGA 4ED7A 3JSBA 1IKXB 5GAEI 1S1TA 2IMOA 2XWYA 4WU3A 5F9LA 4DI6A 2KT5A 1NKEA 1QTMA 2KHDA 3JYTB 1RQ0A 4MMOA 4TU9A 3CMAS 1C4AA 3PYDA 2CIMA 1SXLA 1JLAB 2W9AA 2KU7A 4CO5A 2W24A 3OSPA 1X9SA 3HZGA 3AT1B 1N32F 2VBXA 4LRAA 4X62J 3EPIA 1UCNA 4NMLA 1T8EA 5F41A 3J7ZT 2J9DA 3PFEA 1T95A 2AJ2A 2IFXA 3V6DA 3UDEA 3C2PA 2CWKA 4NLQA 2GO8A 3L7UA 3AQOA 1YJ7A 3MOJB 5C42A 3E01A 3W62A 4G1PA 3VAJA 2OPRB 1CPZA 5D0HA 3MR5A 2AT1B 3LP1A 1UVIA 4PXEA 1RHJB 3RW6A 3D6MB 3CDAA 1RHQB 4DSEA 2D3OR 1MN9A 2ZNYA 5KFCA 3AOAA 1LWFA 2ZC3A 3M05A 4DUZF 2QA1A 2HNZA 2JFDA 2HHHF 2XNQA 4R0EA 3LWMA 4ED5A 3TX0A 2W01A 2KYZA 2Q6BA 4DR3J 2ZM6F 1VFJA 3KMQA 5E41A 4LF1A 2K3IA 3GB0A 3DRSB 2DGTA 4IOCQ 3SIPB 4ZIWA 2HHQA 2WOMA 4H4OA 1HNZJ 3B78A 1RWPB 5KFQA 5DQIA 4KHPF 1OYDA 3M30A 3IG1A 3R6GB 2ZZNA 3TRGA 2DCLA 3ZTPA 5L9NA 1JK9B 2QGFB 1KQFB 1ZM4A 1XIQA 5C7PA 3FDSA 1LQ9A 3SCIE 2NSBA 2WK4A 1HWJA 3M8WA 4QIWD 2HHUA 2HQ3A 3AD7C 2CNKB 3SMZA 1I94F 1S4EA 3IO1A 2R42A 4OZLA 3KYLA 2ROGA 3CCZA 2V50A 1TL1B 4DPXA 3TVZA 4LIRA 1JXEA 4UY85 2HAIA 1FXLA 2CQGA 1S1UB 1K1SA 4YR0A 2EWHA 2D9PA 1JKHB 3GFZA 1ZAVA 1J5OB 1N6QB 3Q2TC 1KQKA 3SSRA 3PKMA 2HNYA 2B0GA 1EQMA 3VGVA 3QT5A 1N56A 5DETA 1GMWD 1TAUA 4CDIA 4ZPDA 4BC7A 1ZA1B 3IWNC 4NYPA 1RA6A 1AZSA 1IKWA 2AQ4A 4ZCIA 2WONB 3BEGB 4NX9A 1S77D 1SQEA 2FJBB 4C2MA 1VRUB 2DNZA 2GW8A 2GIFA 2AX1A 1ZPWX 1B7FA 1IR0A 2XI2A 4J90A 1TL3A 4ZJLA 3DU5A 2IRUA 2ZBPA 1FHTA 4K50A 2B9XA 1FTCA 3OHBA 3UCGA 2MQPA 3O2IA 1JLFA 4DZ6A 1KLNA 2P5VA 3AH6A 1CLFA 1NH8A 4USJC 2EKYA 1UETA 2H65B 3QWPA 4LREA 1HQ2A 4UUXA 2ZC4A 3HVRA 4WIQA 4KGKA 2MKYA 3BF4A 5G4DA 1QDUB 5T41A 4CTAB 3H4BA 3CJ2A 4DR6J 1FFSB 1X9MA 1SKRA 3FZ2A 1X60A 4I68A 3I0SA 2IYIA 4JI4J 4OI6A 4WCEQ 2L41A 1MWQA 4LF9F 1SKSA 4W98A 2BJ8A 2LEBA 5KFMA 3QRQA 2H3EB 4CP5A 1M1KT 3ENVA 2B43A 5HP1A 2JEJA 2F63A 4X66F 1N33J 4F36A 1EARA 1SPBP 3IMQJ 4K4UA 3GJTB 4Q43A 3Q8QB 4DL0C 2HYIB 3K59A 2OJ3A 2EFOA 2XNRA 3MGJA 4ZJOA 1R3NA 4E8UA 3GYXB 3FMWA 3W9JA 3HFVA 2DIVA 2QIFA 5IM0A 4P75A 3HF5A 4R25A 4LR8A 4B3OA 1FERA 4FNHA 1P1TA 4TY8A 2HZVA 3BKUA 1RAIB 3D1HA 1I6JA 3NY0A 4PWWA 3PEJA 2HS3A 5A8RA 4OQJA 3THPA 2RF2B 2RQ4A 5EWFA 2P6SA 2J0XA 2QC3A 2JL9A 5IWAF 4TLQA 4CLTA 4ICLA 2XHCA 1HR0J 1VQSA 1F2GA 3CCQS 1GTEA 4CLZA 2HVZA 2B51A 4LFCJ 4F0MA 4X65F 2HFUA 1OWXA 2V68A 5B0CA 1N5YA 3NS7B 3MMAB 4IH5A 6FD1A 5LSOA 4ZVPB 4DL7A 2IA6A 3LP2A 3EE3A 4IO1A 1P1LA 3FJ2A 3DLEB 1SI9A 1K0TA 2B4PA 2IPOB 1IUJA 3KFWX 1GMWA 1E6VA 2H9ZA 2HMIB 3J80Y 1Q5VA 5J1EB 3H0PA 1B70B 3DLKA 2VQEJ 2IVMA 2WB4A 3TJAA 3Q22A 1FXRA 3RRGA 3DLBA 1LW2B 2MQNA 3DU6A 2DGXA 4O3OA 3DLGB 4EO6A 1EKSA 3G82A 1R6VA 2XC9A 2VH7A 2OHDA 2MSTA 2K8GA 2P8IA 2LQ5A 1KC8T 1CG2A 1ICEB 2XMTA 1VK8A 3QO9B 2CUYA 3UNGC 4AT1B 4LSNA 3VV2B 3K7RA 4Z37A 1PKUA 3KOAA 4M5GA 3S8SA 2DPJA 3AFGA 2LXFA 3JAMU 3ILOA 4BS2A 1UJ5A 3FSXA 4ITSA 1WOPA 1FD8A 3NGDA 1N32J 2HVIA 3BH6B 4WYLA 3BQ0A 3DYAB 1HLWA 5HBMB 3HT0A 1RYRA 1SC4B 1KONA 2JLGA 3DI6B 4LF5F 2DIUA 5ETKA 2HWHA 3KLVA 2ABYA 2HHVA 2HSEB 4PYAA 4E2FB 1S0OA 1X8DA 3MCNA 3KK3B 5E3PA 1WKKA 4C6AA 4Y2AA 4OHVA 3M8QB 4ZCLA 5KG4A 5F8NA 2VOPA 4DR2J 4WU2A 3M2VB 3I5AA 1HNXJ 2AJQA 1R27B 3G86A 1UVNA 3QLHB 1RGVA 3MFIA 3KHRA 2RHQB 3IS9B 1B4SA 2BW7A 2C22A 1RAJA 1HMVB 4OZ3A 5IT9U 4KYZA 2RKIB 4C8LA 2BR0A 3SQGB 4DUZJ 1X31C 3CTRA 1L3KA 3MM5B 2EXUA 2HHHJ 2GS8A 2KM8B 1FRHA 3W5XA 3HSGA 1SJ4P 2RU9A 1QY7A 4X4NA 4DX5A 2PFFB 3W5ZA 3JTPA 1CJKB 5GMEA 4JI7F 1BQMB 1VQ4S 2BX6A 3GG1A 4WBFA 1KKHA 1W25A 4Y0FA 4WK3A 2LVWA 4WFZA 1SJFA 3EGWB 2VKZG 3SCLE 1HQUA 1TFWA 1FD2A 2EPIA 2BJ1A 1TL7A 4O3NA 1EKRA 4EUVA 3TVKA 3KLGA 2M9KA 2QRRA 4YR3A 2FJDB 5KFEA 4K5RA 3T6JA 2XYHB 5FD1A 1NJIT 3IAM9 1I94J 2KTQA 3OLAA 2VJUA 3PO5A 2F1FA 4ES1A 3MM6B 3J7YU 3V2UC 5ETSA 3WIUA 1QAIA 3VALA 1TMJA 4IKAA 2FJAB 1AW0A 4M5IA 2ZUAA 3WHIA 1WC0A 2HLTA 2MQLA 1WG5A 2DTJA 3K89A 2OTJS 3CPWR 3EX7B 3MMJA 3LAMA 3RRHA 2UP1A 4LFBF 3M2RB 2YKQA 4L75A 1TU0B 4HTIA 4WF9Q 2DH8A 5HQLA 1HWKA 3PW0A 3ETOA 1YITS 2W4CA 5HN0A 4B3SF 4U6PA 1HD1A
chains in the Genus database with same CATH topology
2J7KA 5KFSA 1SJRA 4K4SA 3DXSX 4YFUA 2ATLA 4QPTA 1U47A 3LP0B 3RAQA 2GMLA 4JBCA 1N54B 2AYBA 1F5BA 4U9RA 1FNXH 4I2PB 2GHVC 5H9FJ 4QPXA 1M5PC 2Z2MA 4Q44A 5F0UA 4DS4A 1C1BB 3EUNA 2POKA 4LSLB 4I2QB 4JI6F 2MHEA 3DLJA 4NRTA 3IRXA 3TARA 2UXCF 1WF2A 1MU2A 3CD5A 3I0RA 4ZPWR 2DK2A 2FUG9 4RX6A 1VQ7S 4QIFA 2WSFC 2XG8A 2XSJA 3VAGA 4IG3A 1VQKS 5G0RB 1D0EA 2JRSA 4MYTA 3OW2R 3HHLA 4PKDB 4M1KA 4O4GB 2XMWA 3UWTA 3G6ES 2C3MA 3GV5B 3PRBA 1Y5NB 3W2VA 1RTDA 4DMZA 1PC5A 1RT2B 2JVRA 2WB1D 4F3OA 4CH7A 1WEZA 5HO4A 4KO0A 2Q3PA 1XC9A 2AW0A 5J2QB 5A6PA 1IJFB 1QM9A 2V8VA 3UI3A 1S1TB 3OR1B 5LSRA 4QU6A 2CJQA 2KDOA 5EX0A 4OX8A 5DDOC 4F50A 2DHGA 5DQHA 5KAKA 3GYNA 4KAIA 1LWEA 1S99A 3SV3A 4RW7B 1N5QA 4GKJF 3CO9A 2IM1A 4N47A 4ZKAA 2E5LF 3CC7S 3FEXB 3IBWA 2OPRA 4HH0A 2DNOA 4ILRA 4PPZA 5D6GA 4ECRA 2RRAA 4FF2A 1MROA 2Y1RI 3PVXA 4HI1A 1FO1A 2KJWA 2QLXA 1T03B 4F4YA 1VBZA 2ASLA 1VBXA 2KHCA 3PACA 3LPYA 1DTTB 1RT4B 1JLGA 2ZH4A 1DURA 1VI7A 3RR7A 1QVFR 3MMBA 1X4EA 4BWJA 1HW9A 4DSIA 1H6KX 4JV5F 2N4DA 2VG6A 4RU9A 2I2YA 2DISA 3L95X 3WBZA 3NL0A 3HHDA 3CMES 4FBUA 1FJ7A 2VBZA 1OO0B 1D8ZA 2EG2A 3HZEA 1TP7A 1L3VA 3IA0A 4XAKA 5KFXA 2MDAA 3S7RA 4E0DA 5CYJA 2CPYA 4NLUA 4EO8A 4DQSA 1HNVA 1RKIA 3H2VE 3LH2S 2PN6A 3PRDA 3O44A 5A6WA 4MKBA 1G3OA 3H5UA 3V6DB 1HBUB 4M63A 2RRBA 2F8EX 5IQ6A 1V3RA 4RW6A 3SDEA 3QZ8A 5A2QY 1QE1B 2KVIA 4R0JA 3UD4P 2MKIA 1NB7A 3NKYA 3P5TL 2YNHB 4OZNA 4ZK7M 4OJ3A 2EFVA 1MMDA 1C4CA 4OZ5A 1AUDA 4DR4F 3C6TB 1WHWA 2E1CA 2NUUG 2FJEB 4G1QB 2XI3A 1X5TA 2K1RB 4QW9A 3MAQA 2O5DA 5HMYA 3CF5Q 3DRSA 4P7VA 2J6SA 1NZAA 3QYYA 4ILMA 5C42B 2BRLA 2J6UA 2DT9A 2M88A 3DHXA 3ENQA 3MR3A 1LWCB 2EFPA 2X1BA 3ITHB 4JYAF 2LMIA 3E01B 3MI7X 2IAJA 1GT8A 4YB5A 5A8KA 1HA1A 2OH2A 4K0KF 2LQ9A 2GJIA 4TY9A 1WACA 2EBEA 2QFJA 3Q8SB 2W8KA 2ZE2A 4DOZA 1QVGR 2G9OA 4C7QA 3OLBA 3D28A 3BDEA 2XHWA 3GG0A 4GO5X 2MZJA 4F4WA 4DV3F 2CPHA 3LP1B 4IR1A 2IVFB 3FFIB 3TNVA 5HMXA 3H5YA 2AYGA 5B0DA 1U6FA 5DLFA 2DRBA 2LA6A 3SCKE 1X7VA 1H7WA 4V19X 4NZ0A 3OTOF 2YNGB 2RDIA 4ZP9A 1Q8BA 4CO0A 1X0FA 1LK5A 3EZUA 3ZZ0A 3KLEA 3CD7A 4DLGA 1LWFB 4RUAA 2QA2A 2UUTA 2HNZB 2EK6A 3V4MA 3TP2A 1X4BA 2ROEA 3HP6A 3G71S 1SL1A 4FS1A 1IQZA 3JB9k 2B9WA 3N6MA 4PG7A 4C8OA 3ONQA 2CJKA 2PT0A 5FIIA 3QMQA 4ELVA 2DNGA 4A8KA 4MJKA 2NZ4A 4ECXA 2CQCA 2X3GA 2A1BA 5KG0A 1JJ4A 4NL5A 1C1CA 2LKZA 2QA4G 4L6V3 4WFAQ 4O44B 5IZHA 1XK8A 2R9LA 3OQ2A 5KFLA 3B8HA 2IRXA 1KS2A 4ALZA 2PDAA 1GX5A 1VHFA 1TL1A 3VTIA 1N88A 4X4QA 4I67A 4B9LA 4QIGA 4ED0A 1RJJA 4ZP6A 2IA0A 4OX9F 2J9EA 4WZQA 4X2BA 2DNKA 3FEYB 4U7CA 2UUAF 2BQRA 5KFTA 2W8LA 2WOMB 3EGNA 4H4OB 4UQTA 1ZZFA 3I6PA 2XO7A 5D8HB 4DFJA 2O67A 3LW5C 4RNFA 1R8BA 1S1UA 3FNNA 1RYSA 3JTOA 4LUBA 2Y0SD 4WKYA 3X3UA 2R8IA 2ALZA 1JKHA 4A48A 1WTBA 4MKAA 1VMBA 3M30B 1F9FA 2CJ9A 2KT3A 3IG1B 1YRTA 5DRKA 5CCMA 1I1GA 3BREA 1N6QA 1J5OA 1D9AA 1SUQB 3PJWA 2IJFA 2I9SA 2NSCA 4UQGA 5KFIA 4EZ9A 3OVSA 4MFBA 2EC0A 3DFEA 2FJWA 4XK8C 2N7CA 1U8SA 3RYLA 5K5MA 2NR0A 3Q8PB 2ERRA 1XNRF 4HKQA 4PQAA 3ZZPA 2VG5B 2GQ2A 4ED1A 1C2PA 4A8WA 4KKOA 2W4PA 1BQNB 4JI8F 1U4BA 3P49B 2V94A 4Y00A 3GV7B 3K57A 2FVSA 3NAHA 1LXNA 3CCTA 1TKZB 1ZPVA 2ZH5A 1JLEB 3VZHA 3KLIB 2KZMA 1S6UA 2W7AA 4NYZA 4QYZJ 2X1AA 3CJ5A 3RAXA 4DV4F 3PHEA 1HHTP 1WHYA 2RJZA 4IDKB 2ZOGA 5K8NA 2MQQA 4ECUA 2DGWA 5KTQA 2FVCA 4AUKA 4AFFA 2WONA 1U1RA 1TFYA 2RDJA 2RQCA 1FJEB 1BD6A 1JLCB 2DNQA 2PE8A 4Y34A 5DGBA 5GVQA 2DGOA 2DGQA 1HQEA 1R8CA 1X4CA 3HT3A 3CXCR 2XLJA 1Q8IA 4QZVB 1VRUA 3BGLA 1FVQA 3PO4A 4TU7A 3CD6S 5HROB 1YJRA 1RT1A 3K5NA 1Y5IB 2RT3A 3UD3P 4B02A 1KVJA 4F3QA 4K4TA 1G7CB 3V5RA 1R0AB 2ZVSA 3KMSA 2N7YA 1FRJA 3M8SA 1UVLA 5DO2A 3Q2SC 1AFIA 1IJEB 3BR8A 5GAHU 2UVVA 2OMOA 3THTA 3DC2A 4NLGA 5EUHA 1WI8A 4I56A 2MHNA 3OL8A 3RAMA 5GADU 4XIUA 2A2DA 3MZIA 1NO8A 3C46A 3VAFA 4KR0B 3U1LA 1YVFA 3ZFVA 4NZ6A 1ELOA 1YRUA 4OI4A 4YP3A 3ISND 2JEFA 1FE4A 1S97A 2FGOA 2KRBA 1DARA 4M5DB 2UVUA 1QUPA 1UFWA 2MKHA 2RE1A 2HNYB 2MY8A 2V8DA 3IGNA 4RBVA 3V6HA 3LOUA 4Y2CA 2E9RX 5KFKA 5D4PA 3BGUA 1R7IA 3DXBA 1CQMA 3UFCX 1YWXA 4QR1A 1W2BR 1N52B 1WNEA 3CCUS 4WKRA 2JLFA 5CYMB 4XO0A 4DN0A 4FPRA 4ZS6A 2ZKUA 1FVSA 1WTFA 1REVB 3BQ2A 2Q43A 3ZZTA 1ZM2A 4JV0A 4TNOA 2E5GA 3HVAA 4AXJA 3MUVP 3I82A 2I38A 1O8BA 4DV2F 4HT7A 3I5CA 4Q2MA 1IKWB 2GGPB 2QV6A 3I32A 4DUYF 1LK7A 4WFBQ 2E5HA 4F4XA 5K8PA 2QEXS 3PW2A 5BR8F 2F7VA 1RT6A 4XDDA 4G3IA 3KK2A 4V19J 3GFYA 3KHGA 4BWMA 3PZPA 4ZHRA 4O3SA 1C0TB 3ZC4A 2VG7A 5FDLA 3TAMA 3KJVA 2C2DA 5GAGI 3I87A 1S0VA 5LXYA 5L1JA 3T1AA 4NXMF 1HD0A 4PXBA 2DVIA 3WX4A 5SZTA 3MURP 5JVHQ 4FNIA 4H4MA 2MQOA 4L72B 1TL3B 2MQMA 1RI7A 1N0UA 3T1YF 3IWLA 4FVCA 1R31A 4CTAA 3OXLA 2N3LA 2PI5A 2F8MA 4KTQA 2MKCA 2VC0A 5D78A 4EZ6A 4X62F 3R1HA 2RQKA 1YJ9S 1MWYA 2L9NA 1P6TA 2HS4A 2L08A 3HVTA 2ZNZA 4JOUA 5GAEU 4ZA1A 1Y3JA 3DRPB 3VR1A 3KTQA 2ZUGA 1YJVA 1VBYA 2HNDA 4UOCA 2OKQA 2VUGA 5LMNF 2R2SA 1JLFB 2NXUA 4NZ7A 4DSFA 3OBIA 4DJBA 2HGMA 3C8YA 3JTNA 1FK9A 2DGSA 1K1QA 4IR9A 2BW2A 4NOHA 2CFXA 3UW1A 5KFFA 4C8YA 2JFKA 2E29A 4RKUC 3G6VA 1NK9A 5D3GA 2ACYA 4UW2A 2K7JA 3OVBA 3HX9A 2W7OA 1A9NB 3CEDA 4USHA 4RUCA 2AJ4A 2HWTA 3OPKA 3H2UB 3RB0A 2BZ2A 3F73A 2KJVA 3MUMP 4OI2A 3CDBA 3UQSA 3SV4A 3T5HA 4NCAA 3D5MA 4EBEA 2CJAA 2X1FA 1UWBB 3VAMA 2AX0A 2YWGA 5AXKA 5DDRC 3MXHP 2MYFA 2LXIA 1TQLA 3MEGB 2B4UA 2Q6CA 2ZH7A 4EYIB 4C0HA 4I6WA 4NLRA 2G4BA 2F40A 4I0WA 2G1DA 3VAHA 3PW5A 2FLLA 2CG4A 3EPGA 5I3UB 4IG0A 2GNKA 3MD3A 1YHQS 4RNHA 2DHSA 4TXSA 5HLFB 1U1QA 2DNNA 1MSWD 4AXIA 2E5JA 2HVHA 3NGKA 2Y1IA 2IM0A 1RTHB 2YNFA 3DLLQ 1HPZA 4DL4A 2YKNB 3I5BA 3M4XA 2MKKA 2AYMA 1B0PA 4URQU 4J9OA 4FF1A 4OHYA 2H5EA 2EK1A 1T02A 3AY0A 3I55S 3UCUP 2O3DA 3IGVA 3SEOA 3NCQA 5KOXA 4YEAA 4YB6A 3I0SB 2CDQA 3CIMA 2J0WA 1PILA 3M2UA 2LU2A 1JB0C 1U1NA 3BR9A 1T3NA 3IC1A 4ZVHA 3T6BA 1H2TZ 5KG1A 4OHWA 4W92B 4DR3F 1XR7A 4KPYA 3S01A 4ELTA 2FPHX 3DM2A 4M8LA 2XLIA 4QCLA 1UEVA 2DNLA 2VPWB 1HI8A 4B9NA 1TUVA 1APSA 4DPOA 2RS2A 3J7YI 1FKPB 1U24A 2BOPA 3DMJA 2V9KA 4RW8A 5HP1B 2OSRA 3N01A 2YWHA 2LDYA 2L9DA 1DTQA 4DFMA 2RF2A 3CCSS 5ADZA 1HNZF 3LALA 1FDNA 3U27A 3OL6A 5CCLA 3GIKA 5J2MB 1WEXA 2X51A 4YR2A 3IXQA 5HL7Q 1RT7B 3K5MA 2OPQB 2DO0A 3I4PA 2XCAA 5T7LA 1RP5A 4QWDA 5CYQB 4B9VA 3KHLA 2ZJRQ 1LFPA 2FLOA 3I4HX 4NLYA 3GIIA 4B9UA 3EGZA 2YKAA 2MZTA 3OL7A 4DV1F 3O1LA 1X4DA 3E2EA 1X5PA 2GHPA 5KT5A 1D3WA 1JLQB 2BJEA 3E51A 2YTCA 3QIPA 5JXSA 3PKYA 4ED3A 1ULRA 3DGPA 4MK9A 3T1HF 4AE5A 1XMBA 4QYRA 1F0XA 3UPFA 3G9CA 1AFJA 5KT4A 3MM7B 3NBPB 3HO1A 2BM1A 1N5SA 2HQIA 2XY6A 3KNAA 4R5PB 5I3QA 1KFSA 4I7FA 2FIUA 4K5SA 1OPIA 2YY3A 2VOOA 4RW4A 3LAKA 3FRYA 5E3RA 3JAMY 5IM0B 3H5XA 5CXTA 3MMAA 2HHWA 4ZPAA 3LUYA 4C11B 3DN9A 4PXCA 4N5SA 3G96A 3G6YA 1XMQF 2XMKA 2ZHAA 4B3OB 5IT0A 3N9UC 3DLEA 1IKYA 1NK7A 5L1KA 4O3PA 4DFKA 4GO7X 5BJRA 3N79A 4YDDB 4ZPCA 2C3PA 4BC9A 2ZDPA 3QJPA 2GO9A 4I6YA 4TY8B 1FNMA 1Y00A 2HMIA 3PR5B 2BYCA 1HNIB 4QR0A 2JX2A 4LMZA 1S1XA 2EW9A 5H9EJ 1S1WA 2I5JB 1QUVA 4NXNF 5J1EA 4PWDA 1GQEA 2DITA 1HWLA 3H20A 5E7OB 2FJXA 3K0JA 3AJ1A 4IFVB 5J1NA 1UJ6A 4ED8A 4ECTA 3BSAA 4MYUA 4NLSA 1ZETA 1SJ3P 4AL7A 3CULA 2YQ3A 4OMFG 5A8RB 3QAUA 5KG3A 3VZIA 1UVMA 5E2QA 4DG1B 4YMEA 1FRIA 1KQSR