2AJPA

Crystal structure of a human pyridoxal kinase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
308
structure length
303
Chain Sequence
SRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a human pyridoxal kinase
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Pyridoxal kinase
total genus 99
structure length 303
sequence length 308
chains with identical sequence B
ec nomenclature ec 2.7.1.35: Pyridoxal kinase.
pdb deposition date 2005-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2ajpA00
3RTBA 4EUMA 2AB8A 4K93A 1GC5A 1VK4A 3B1NA 3IH0A 4C5MA 1ESQA 2PKKA 3RQQA 4N09A 3RS8A 3NL3A 3UQEA 3RT7A 3RREA 1YHJA 2Q5RA 5B6AA 3NC2A 3RQ5A 2C4EA 3PL2A 5EYNA 3MBHA 4K8KA 2F7KA 2AA0A 4C5JA 1ESJA 5BYDA 3JULA 5BYCA 1TYYA 3IE7A 1EKKA 3RM5A 1V19A 3UQ6A 4E8YA 1JXIA 2JGVA 4YL5A 4K8CA 2JG5A 3DRWA 2PKMA 2A9YA 3B1RA 1VM7A 3KZHA 2AJPA 4S1IA 3RU3A 3VAQA 2I6BA 3I3YA 3NBVA 4XF7A 4X8FA 3UMOA 3NC9A 1KYHA 2HLZA 3NL2A 2RBCA 2PKNA 3NM3A 2ABQA 3DZVA 4LCAA 4O1GA 1V1BA 3RS9A 3RSFA 3Q92A 3HICA 3LHXA 4PVVA 1UA4A 2DDMA 5EY7A 5F11A 3RTCA 2A9ZA 3HYOA 1VI9A 2YXUA 4XDAA 4DU5A 5C3YA 3RU2A 3RT9A 3RTDA 2HW1A 3HPDA 3NM1A 3RSSA 2HQQA 4LBGA 4GM6A 3QAIA 3RRBA 2AX3A 4K9CA 2I5BA 4K8PA 1BX4A 4K8TA 4S1MA 3KEUA 1RFTA 4S1IB 3GO6A 5CM5A 3RQXA 3RO4A 4XCKA 2JG1A 1V1SA 1LIJA 3IKHA 4EBUA 5F0ZA 2VARA 3RSQA 3RQ2A 3RPHA 2XTBA 3CQDA 3B1OA 3LKIA 3RPZA 2R3BA 3RQ8A 3RTGA 3K5WA 3IN1A 4K9IA 3RQHA 5CGAA 4KBEA 3RRFA 4LC4A 2ABSA 2AFBA 3ZS7A 3LJSA 3K9EA 5TQIA 4O1LA 4EN4A 2QHPA 3NL5A 1YGJA 3BF5A 4C5NA 1LIIA 1GQTA 3NCAA 4LBXA 1RKAA 2DCNA 2C49A 4JKSA 4E84A 5BYEA 3IBQA 3UBOA 5TRWA 4EOHA 3IQ0A 3UQ9A 1LHPA 5CGEA 2V78A 1RKDA 3BGKA 1RFUA 2NWHA 4WJMA 5BYFA 3OTXA 4KAHA 3EWMA 3GBUA 3H74A 3VASA 1UB0A 4U7XA 4KANA 3B1PA 3RRJA 4E8WA 1DGMA 3UMPA 3RQ6A 3RTAA 1LHRA 1LIKA 2YXTA 3N1CA 2AJRA 3FHXA 3NL6A 2AWDA 4E69A 2DDOA 5COJA 4XF6A 4JJPA 2QCVA 4E8ZA 1C3QA 3QA2A 3KD6A 1U2XA 2I6AA 4C5LA 1TD2A 4B8RA 4B8SA 2PKFA 2DDWA 4KADA 1RKSA 4JKUA 3RTEA 3B1QA 3B3LA 2FV7A 1YGKA 3GO7A 1RFVA 1V1AA 3H49A 4KALA 1WYEA 5C41A 3KTNA 3FHYA 4UBEA 3RY7A 1TZ3A 3UQDA 3W4SA 4DC3A 4E3AA 2R3EA 5C3ZA 1EKQA 3PZSA 3NBWA 3LOOA 1JXHA 3Q1YA 4S1HA 4C5KA 4N08A 1L2LA 2F02A 3RSGA 3MBJA 5C40A 1TZ6A 1RK2A 1LIOA 4YWRA
chains in the Genus database with same CATH superfamily
3QCZA 2UAGA 2AB8A 3RTBA 4K93A 1GC5A 1VK4A 3B1NA 3IH0A 4BUBA 4C5MA 1ESQA 1J6UA 2PKKA 4CVKA 3RQQA 4N09A 3RS8A 3NL3A 3UQEA 3RT7A 3RREA 1YHJA 2Q5RA 5B6AA 3NC2A 3RQ5A 2C4EA 3PL2A 5EYNA 3MBHA 4K8KA 2F7KA 1GG4A 2AA0A 4C5JA 1ESJA 5BYDA 3HJ6A 3JULA 1JBVA 5BYCA 1TYYA 3IE7A 1EKKA 5A5FA 2GC5A 3RM5A 1V19A 3UQ6A 2Y1OA 4E8YA 1JXIA 2AM1A 2VOSA 2JGVA 4YL5A 4K8CA 2JG5A 3DRWA 2PKMA 2A9YA 3B1RA 1VM7A 1W7KA 3KZHA 2AJPA 4S1IA 3RU3A 2XJAA 3VAQA 2I6BA 3I3YA 3NBVA 4XF7A 5A5EA 4X8FA 3UMOA 2WTZA 3NC9A 1KYHA 2HLZA 3NL2A 2RBCA 2PKNA 3NM3A 2ABQA 4C12A 4C13A 2VTEA 3DZVA 4LCAA 4O1GA 1V1BA 3RS9A 1O5ZA 3RSFA 3Q92A 3HICA 3LHXA 4PVVA 1UA4A 1P31A 2DDMA 5EY7A 5F11A 3RTCA 2A9ZA 3HYOA 4CVLA 1VI9A 2YXUA 1UAGA 4XDAA 4DU5A 5C3YA 3PYZA 3RT9A 3RU2A 2JFHA 3RTDA 2HW1A 3HPDA 3NM1A 1P3DA 4EUMA 3RSSA 2HQQA 3ZM6A 4LBGA 4GM6A 3QAIA 3RRBA 2AX3A 4K9CA 2I5BA 4K8PA 1BX4A 4K8TA 4S1MA 3KEUA 1RFTA 4S1IB 3GO6A 5CM5A 3RQXA 3RO4A 4XCKA 2JG1A 1V1SA 1LIJA 3IKHA 1FGSA 4EBUA 5F0ZA 2VARA 3RSQA 3RQ2A 3RPHA 2XTBA 1E8CA 3CQDA 2WJPA 3B1OA 2VORA 3LKIA 3RPZA 2R3BA 3RQ8A 4UAGA 3RTGA 4ZIYA 3K5WA 2Y67A 3HN7A 3IN1A 2Y68A 4YWRA 4K9IA 3RQHA 5CGAA 4KBEA 3RRFA 4LC4A 3EAGA 2ABSA 2AFBA 3ZS7A 3LJSA 3K9EA 5TQIA 4O1LA 4EN4A 2QHPA 3NL5A 1YGJA 3BF5A 4QDIA 1LIIA 4C5NA 1GQTA 3NCAA 4LBXA 1RKAA 2DCNA 2C49A 4JKSA 4E84A 4HV4A 5BYEA 3IBQA 3UBOA 4CVMA 5TRWA 3N2AA 4EOHA 3IQ0A 3UQ9A 2VTDA 1LHPA 1JBWA 5CGEA 1RKDA 2V78A 3BGKA 1RFUA 3LK7A 2NWHA 4WJMA 5BYFA 3OTXA 4KAHA 3EWMA 3GBUA 3H74A 2AM2A 3VASA 1UB0A 4U7XA 4KANA 3B1PA 4QF5A 3RRJA 3ZM5A 4E8WA 1DGMA 3UMPA 3RQ6A 3RTAA 1LHRA 1LIKA 2YXTA 3N1CA 2AJRA 3FHXA 3NL6A 2AWDA 2XPCA 2DDOA 3ZL8A 5COJA 4E69A 4XF6A 4JJPA 2QCVA 4E8ZA 1C3QA 2GCBA 3QA2A 2UUOA 3KD6A 2JFFA 1E0DA 1U2XA 2GC6A 2I6AA 4C5LA 1TD2A 2X5OA 4B8RA 4B8SA 1W78A 2PKFA 2DDWA 4KADA 3UAGA 1RKSA 4JKUA 3RTEA 1EEHA 3B1QA 3B3LA 2FV7A 1YGKA 2F00A 1RFVA 1V1AA 3GO7A 3H49A 4KALA 1GQQA 1WYEA 5C41A 3KTNA 3FHYA 4UBEA 3RY7A 4BUCA 1TZ3A 3UQDA 3W4SA 4DC3A 4E3AA 2R3EA 5C3ZA 1EKQA 2UUPA 3NRSA 3PZSA 3NBWA 2Y66A 1JXHA 3LOOA 3Q1YA 4S1HA 4N08A 1L2LA 4C5KA 1GQYA 2F02A 3RSGA 3MBJA 5C40A 1TZ6A 1RK2A 2JFGA 1LIOA 2GCAA
chains in the Genus database with same CATH topology
3RTBA 4EUMA 2AB8A 4K93A 1GC5A 1VK4A 3B1NA 3IH0A 4C5MA 1ESQA 2PKKA 3RQQA 4N09A 3RS8A 3NL3A 3UQEA 3RT7A 3RREA 1YHJA 2Q5RA 5B6AA 3NC2A 3RQ5A 2C4EA 3PL2A 5EYNA 3MBHA 4K8KA 2F7KA 2AA0A 4C5JA 1ESJA 5BYDA 3HJ6A 3JULA 5BYCA 1TYYA 3IE7A 1EKKA 3RM5A 1V19A 3UQ6A 4E8YA 1JXIA 2JGVA 4YL5A 4K8CA 2JG5A 3DRWA 2PKMA 2A9YA 3B1RA 1VM7A 3KZHA 2AJPA 4S1IA 3RU3A 3VAQA 2I6BA 3I3YA 3NBVA 4XF7A 4X8FA 3UMOA 3NC9A 1KYHA 2HLZA 3NL2A 2RBCA 2PKNA 3NM3A 2ABQA 3DZVA 4LCAA 4O1GA 1V1BA 3RS9A 3RSFA 3Q92A 3HICA 3LHXA 4PVVA 1UA4A 2DDMA 5EY7A 5F11A 3RTCA 2A9ZA 3HYOA 1VI9A 2YXUA 4XDAA 4DU5A 5C3YA 3RU2A 3RT9A 3RTDA 2HW1A 3HPDA 3NM1A 3RSSA 2HQQA 4LBGA 4GM6A 3QAIA 3RRBA 2AX3A 4K9CA 2I5BA 4K8PA 1BX4A 4K8TA 4S1MA 3KEUA 1RFTA 4S1IB 3GO6A 5CM5A 3RQXA 3RO4A 4XCKA 2JG1A 1V1SA 1LIJA 3IKHA 4EBUA 5F0ZA 2VARA 3RSQA 3RQ2A 3RPHA 2XTBA 3CQDA 3B1OA 3LKIA 3RPZA 2R3BA 3RQ8A 3RTGA 3K5WA 3IN1A 4K9IA 3RQHA 5CGAA 4KBEA 3RRFA 4LC4A 2ABSA 2AFBA 3ZS7A 3LJSA 3K9EA 5TQIA 4O1LA 4EN4A 2QHPA 3NL5A 1YGJA 3BF5A 4C5NA 1LIIA 1GQTA 3NCAA 4LBXA 1RKAA 2DCNA 2C49A 4JKSA 4E84A 5BYEA 3IBQA 3UBOA 5TRWA 4EOHA 3IQ0A 3UQ9A 1LHPA 5CGEA 2V78A 1RKDA 3BGKA 1RFUA 2NWHA 4WJMA 5BYFA 3OTXA 4KAHA 3EWMA 3GBUA 3H74A 3VASA 1UB0A 4U7XA 4KANA 3B1PA 3RRJA 4E8WA 1DGMA 3UMPA 3RQ6A 3RTAA 1LHRA 1LIKA 2YXTA 3N1CA 2AJRA 3FHXA 3NL6A 2AWDA 4E69A 2DDOA 5COJA 4XF6A 4JJPA 2QCVA 4E8ZA 1C3QA 3QA2A 3KD6A 1U2XA 2I6AA 4C5LA 1TD2A 4B8RA 4B8SA 2PKFA 2DDWA 4KADA 1RKSA 4JKUA 3RTEA 3B1QA 3B3LA 2FV7A 1YGKA 3GO7A 1RFVA 1V1AA 3H49A 4KALA 1WYEA 5C41A 3KTNA 3FHYA 4UBEA 3RY7A 1TZ3A 3UQDA 3W4SA 4DC3A 4E3AA 2R3EA 5C3ZA 1EKQA 3PZSA 3NBWA 3LOOA 1JXHA 3Q1YA 4S1HA 4C5KA 4N08A 1L2LA 2F02A 3RSGA 3MBJA 5C40A 1TZ6A 1RK2A 1LIOA 4YWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RTB A;  4EUM A;  2AB8 A;  4K93 A;  1GC5 A;  1VK4 A;  3B1N A;  3IH0 A;  4C5M A;  1ESQ A;  2PKK A;  3RQQ A;  4N09 A;  3RS8 A;  3NL3 A;  3UQE A;  3RT7 A;  3RRE A;  1YHJ A;  2Q5R A;  5B6A A;  3NC2 A;  3RQ5 A;  2C4E A;  3PL2 A;  5EYN A;  3MBH A;  4K8K A;  2F7K A;  2AA0 A;  4C5J A;  1ESJ A;  5BYD A;  3JUL A;  5BYC A;  1TYY A;  3IE7 A;  1EKK A;  3RM5 A;  1V19 A;  3UQ6 A;  4E8Y A;  1JXI A;  2JGV A;  4YL5 A;  4K8C A;  2JG5 A;  3DRW A;  2PKM A;  2A9Y A;  3B1R A;  1VM7 A;  3KZH A;  2AJP A;  4S1I A;  3RU3 A;  3VAQ A;  2I6B A;  3I3Y A;  3NBV A;  4XF7 A;  4X8F A;  3UMO A;  3NC9 A;  1KYH A;  2HLZ A;  3NL2 A;  2RBC A;  2PKN A;  3NM3 A;  2ABQ A;  3DZV A;  4LCA A;  4O1G A;  1V1B A;  3RS9 A;  3RSF A;  3Q92 A;  3HIC A;  3LHX A;  4PVV A;  1UA4 A;  2DDM A;  5EY7 A;  5F11 A;  3RTC A;  2A9Z A;  3HYO A;  1VI9 A;  2YXU A;  4XDA A;  4DU5 A;  5C3Y A;  3RU2 A;  3RT9 A;  3RTD A;  2HW1 A;  3HPD A;  3NM1 A;  3RSS A;  2HQQ A;  4LBG A;  4GM6 A;  3QAI A;  3RRB A;  2AX3 A;  4K9C A;  2I5B A;  4K8P A;  1BX4 A;  4K8T A;  4S1M A;  3KEU A;  1RFT A;  4S1I B;  3GO6 A;  5CM5 A;  3RQX A;  3RO4 A;  4XCK A;  2JG1 A;  1V1S A;  1LIJ A;  3IKH A;  4EBU A;  5F0Z A;  2VAR A;  3RSQ A;  3RQ2 A;  3RPH A;  2XTB A;  3CQD A;  3B1O A;  3LKI A;  3RPZ A;  2R3B A;  3RQ8 A;  3RTG A;  3K5W A;  3IN1 A;  4K9I A;  3RQH A;  5CGA A;  4KBE A;  3RRF A;  4LC4 A;  2ABS A;  2AFB A;  3ZS7 A;  3LJS A;  3K9E A;  5TQI A;  4O1L A;  4EN4 A;  2QHP A;  3NL5 A;  1YGJ A;  3BF5 A;  4C5N A;  1LII A;  1GQT A;  3NCA A;  4LBX A;  1RKA A;  2DCN A;  2C49 A;  4JKS A;  4E84 A;  5BYE A;  3IBQ A;  3UBO A;  5TRW A;  4EOH A;  3IQ0 A;  3UQ9 A;  1LHP A;  5CGE A;  2V78 A;  1RKD A;  3BGK A;  1RFU A;  2NWH A;  4WJM A;  5BYF A;  3OTX A;  4KAH A;  3EWM A;  3GBU A;  3H74 A;  3VAS A;  1UB0 A;  4U7X A;  4KAN A;  3B1P A;  3RRJ A;  4E8W A;  1DGM A;  3UMP A;  3RQ6 A;  3RTA A;  1LHR A;  1LIK A;  2YXT A;  3N1C A;  2AJR A;  3FHX A;  3NL6 A;  2AWD A;  4E69 A;  2DDO A;  5COJ A;  4XF6 A;  4JJP A;  2QCV A;  4E8Z A;  1C3Q A;  3QA2 A;  3KD6 A;  1U2X A;  2I6A A;  4C5L A;  1TD2 A;  4B8R A;  4B8S A;  2PKF A;  2DDW A;  4KAD A;  1RKS A;  4JKU A;  3RTE A;  3B1Q A;  3B3L A;  2FV7 A;  1YGK A;  3GO7 A;  1RFV A;  1V1A A;  3H49 A;  4KAL A;  1WYE A;  5C41 A;  3KTN A;  3FHY A;  4UBE A;  3RY7 A;  1TZ3 A;  3UQD A;  3W4S A;  4DC3 A;  4E3A A;  2R3E A;  5C3Z A;  1EKQ A;  3PZS A;  3NBW A;  3LOO A;  1JXH A;  3Q1Y A;  4S1H A;  4C5K A;  4N08 A;  1L2L A;  2F02 A;  3RSG A;  3MBJ A;  5C40 A;  1TZ6 A;  1RK2 A;  1LIO A;  4YWR A; 
#chains in the Genus database with same CATH topology
 3QCZ A;  2UAG A;  2AB8 A;  3RTB A;  4K93 A;  1GC5 A;  1VK4 A;  3B1N A;  3IH0 A;  4BUB A;  4C5M A;  1ESQ A;  1J6U A;  2PKK A;  4CVK A;  3RQQ A;  4N09 A;  3RS8 A;  3NL3 A;  3UQE A;  3RT7 A;  3RRE A;  1YHJ A;  2Q5R A;  5B6A A;  3NC2 A;  3RQ5 A;  2C4E A;  3PL2 A;  5EYN A;  3MBH A;  4K8K A;  2F7K A;  1GG4 A;  2AA0 A;  4C5J A;  1ESJ A;  5BYD A;  3HJ6 A;  3JUL A;  1JBV A;  5BYC A;  1TYY A;  3IE7 A;  1EKK A;  5A5F A;  2GC5 A;  3RM5 A;  1V19 A;  3UQ6 A;  2Y1O A;  4E8Y A;  1JXI A;  2AM1 A;  2VOS A;  2JGV A;  4YL5 A;  4K8C A;  2JG5 A;  3DRW A;  2PKM A;  2A9Y A;  3B1R A;  1VM7 A;  1W7K A;  3KZH A;  2AJP A;  4S1I A;  3RU3 A;  2XJA A;  3VAQ A;  2I6B A;  3I3Y A;  3NBV A;  4XF7 A;  5A5E A;  4X8F A;  3UMO A;  2WTZ A;  3NC9 A;  1KYH A;  2HLZ A;  3NL2 A;  2RBC A;  2PKN A;  3NM3 A;  2ABQ A;  4C12 A;  4C13 A;  2VTE A;  3DZV A;  4LCA A;  4O1G A;  1V1B A;  3RS9 A;  1O5Z A;  3RSF A;  3Q92 A;  3HIC A;  3LHX A;  4PVV A;  1UA4 A;  1P31 A;  2DDM A;  5EY7 A;  5F11 A;  3RTC A;  2A9Z A;  3HYO A;  4CVL A;  1VI9 A;  2YXU A;  1UAG A;  4XDA A;  4DU5 A;  5C3Y A;  3PYZ A;  3RT9 A;  3RU2 A;  2JFH A;  3RTD A;  2HW1 A;  3HPD A;  3NM1 A;  1P3D A;  4EUM A;  3RSS A;  2HQQ A;  3ZM6 A;  4LBG A;  4GM6 A;  3QAI A;  3RRB A;  2AX3 A;  4K9C A;  2I5B A;  4K8P A;  1BX4 A;  4K8T A;  4S1M A;  3KEU A;  1RFT A;  4S1I B;  3GO6 A;  5CM5 A;  3RQX A;  3RO4 A;  4XCK A;  2JG1 A;  1V1S A;  1LIJ A;  3IKH A;  1FGS A;  4EBU A;  5F0Z A;  2VAR A;  3RSQ A;  3RQ2 A;  3RPH A;  2XTB A;  1E8C A;  3CQD A;  2WJP A;  3B1O A;  2VOR A;  3LKI A;  3RPZ A;  2R3B A;  3RQ8 A;  4UAG A;  3RTG A;  4ZIY A;  3K5W A;  2Y67 A;  3HN7 A;  3IN1 A;  2Y68 A;  4YWR A;  4K9I A;  3RQH A;  5CGA A;  4KBE A;  3RRF A;  4LC4 A;  3EAG A;  2ABS A;  2AFB A;  3ZS7 A;  3LJS A;  3K9E A;  5TQI A;  4O1L A;  4EN4 A;  2QHP A;  3NL5 A;  1YGJ A;  3BF5 A;  4QDI A;  1LII A;  4C5N A;  1GQT A;  3NCA A;  4LBX A;  1RKA A;  2DCN A;  2C49 A;  4JKS A;  4E84 A;  4HV4 A;  5BYE A;  3IBQ A;  3UBO A;  4CVM A;  5TRW A;  3N2A A;  4EOH A;  3IQ0 A;  3UQ9 A;  2VTD A;  1LHP A;  1JBW A;  5CGE A;  1RKD A;  2V78 A;  3BGK A;  1RFU A;  3LK7 A;  2NWH A;  4WJM A;  5BYF A;  3OTX A;  4KAH A;  3EWM A;  3GBU A;  3H74 A;  2AM2 A;  3VAS A;  1UB0 A;  4U7X A;  4KAN A;  3B1P A;  4QF5 A;  3RRJ A;  3ZM5 A;  4E8W A;  1DGM A;  3UMP A;  3RQ6 A;  3RTA A;  1LHR A;  1LIK A;  2YXT A;  3N1C A;  2AJR A;  3FHX A;  3NL6 A;  2AWD A;  2XPC A;  2DDO A;  3ZL8 A;  5COJ A;  4E69 A;  4XF6 A;  4JJP A;  2QCV A;  4E8Z A;  1C3Q A;  2GCB A;  3QA2 A;  2UUO A;  3KD6 A;  2JFF A;  1E0D A;  1U2X A;  2GC6 A;  2I6A A;  4C5L A;  1TD2 A;  2X5O A;  4B8R A;  4B8S A;  1W78 A;  2PKF A;  2DDW A;  4KAD A;  3UAG A;  1RKS A;  4JKU A;  3RTE A;  1EEH A;  3B1Q A;  3B3L A;  2FV7 A;  1YGK A;  2F00 A;  1RFV A;  1V1A A;  3GO7 A;  3H49 A;  4KAL A;  1GQQ A;  1WYE A;  5C41 A;  3KTN A;  3FHY A;  4UBE A;  3RY7 A;  4BUC A;  1TZ3 A;  3UQD A;  3W4S A;  4DC3 A;  4E3A A;  2R3E A;  5C3Z A;  1EKQ A;  2UUP A;  3NRS A;  3PZS A;  3NBW A;  2Y66 A;  1JXH A;  3LOO A;  3Q1Y A;  4S1H A;  4N08 A;  1L2L A;  4C5K A;  1GQY A;  2F02 A;  3RSG A;  3MBJ A;  5C40 A;  1TZ6 A;  1RK2 A;  2JFG A;  1LIO A;  2GCA A; 
#chains in the Genus database with same CATH homology
 3RTB A;  4EUM A;  2AB8 A;  4K93 A;  1GC5 A;  1VK4 A;  3B1N A;  3IH0 A;  4C5M A;  1ESQ A;  2PKK A;  3RQQ A;  4N09 A;  3RS8 A;  3NL3 A;  3UQE A;  3RT7 A;  3RRE A;  1YHJ A;  2Q5R A;  5B6A A;  3NC2 A;  3RQ5 A;  2C4E A;  3PL2 A;  5EYN A;  3MBH A;  4K8K A;  2F7K A;  2AA0 A;  4C5J A;  1ESJ A;  5BYD A;  3HJ6 A;  3JUL A;  5BYC A;  1TYY A;  3IE7 A;  1EKK A;  3RM5 A;  1V19 A;  3UQ6 A;  4E8Y A;  1JXI A;  2JGV A;  4YL5 A;  4K8C A;  2JG5 A;  3DRW A;  2PKM A;  2A9Y A;  3B1R A;  1VM7 A;  3KZH A;  2AJP A;  4S1I A;  3RU3 A;  3VAQ A;  2I6B A;  3I3Y A;  3NBV A;  4XF7 A;  4X8F A;  3UMO A;  3NC9 A;  1KYH A;  2HLZ A;  3NL2 A;  2RBC A;  2PKN A;  3NM3 A;  2ABQ A;  3DZV A;  4LCA A;  4O1G A;  1V1B A;  3RS9 A;  3RSF A;  3Q92 A;  3HIC A;  3LHX A;  4PVV A;  1UA4 A;  2DDM A;  5EY7 A;  5F11 A;  3RTC A;  2A9Z A;  3HYO A;  1VI9 A;  2YXU A;  4XDA A;  4DU5 A;  5C3Y A;  3RU2 A;  3RT9 A;  3RTD A;  2HW1 A;  3HPD A;  3NM1 A;  3RSS A;  2HQQ A;  4LBG A;  4GM6 A;  3QAI A;  3RRB A;  2AX3 A;  4K9C A;  2I5B A;  4K8P A;  1BX4 A;  4K8T A;  4S1M A;  3KEU A;  1RFT A;  4S1I B;  3GO6 A;  5CM5 A;  3RQX A;  3RO4 A;  4XCK A;  2JG1 A;  1V1S A;  1LIJ A;  3IKH A;  4EBU A;  5F0Z A;  2VAR A;  3RSQ A;  3RQ2 A;  3RPH A;  2XTB A;  3CQD A;  3B1O A;  3LKI A;  3RPZ A;  2R3B A;  3RQ8 A;  3RTG A;  3K5W A;  3IN1 A;  4K9I A;  3RQH A;  5CGA A;  4KBE A;  3RRF A;  4LC4 A;  2ABS A;  2AFB A;  3ZS7 A;  3LJS A;  3K9E A;  5TQI A;  4O1L A;  4EN4 A;  2QHP A;  3NL5 A;  1YGJ A;  3BF5 A;  4C5N A;  1LII A;  1GQT A;  3NCA A;  4LBX A;  1RKA A;  2DCN A;  2C49 A;  4JKS A;  4E84 A;  5BYE A;  3IBQ A;  3UBO A;  5TRW A;  4EOH A;  3IQ0 A;  3UQ9 A;  1LHP A;  5CGE A;  2V78 A;  1RKD A;  3BGK A;  1RFU A;  2NWH A;  4WJM A;  5BYF A;  3OTX A;  4KAH A;  3EWM A;  3GBU A;  3H74 A;  3VAS A;  1UB0 A;  4U7X A;  4KAN A;  3B1P A;  3RRJ A;  4E8W A;  1DGM A;  3UMP A;  3RQ6 A;  3RTA A;  1LHR A;  1LIK A;  2YXT A;  3N1C A;  2AJR A;  3FHX A;  3NL6 A;  2AWD A;  4E69 A;  2DDO A;  5COJ A;  4XF6 A;  4JJP A;  2QCV A;  4E8Z A;  1C3Q A;  3QA2 A;  3KD6 A;  1U2X A;  2I6A A;  4C5L A;  1TD2 A;  4B8R A;  4B8S A;  2PKF A;  2DDW A;  4KAD A;  1RKS A;  4JKU A;  3RTE A;  3B1Q A;  3B3L A;  2FV7 A;  1YGK A;  3GO7 A;  1RFV A;  1V1A A;  3H49 A;  4KAL A;  1WYE A;  5C41 A;  3KTN A;  3FHY A;  4UBE A;  3RY7 A;  1TZ3 A;  3UQD A;  3W4S A;  4DC3 A;  4E3A A;  2R3E A;  5C3Z A;  1EKQ A;  3PZS A;  3NBW A;  3LOO A;  1JXH A;  3Q1Y A;  4S1H A;  4C5K A;  4N08 A;  1L2L A;  2F02 A;  3RSG A;  3MBJ A;  5C40 A;  1TZ6 A;  1RK2 A;  1LIO A;  4YWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...