2AJPA

Crystal structure of a human pyridoxal kinase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
308
structure length
303
Chain Sequence
SRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a human pyridoxal kinase
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Pyridoxal kinase
total genus 99
structure length 303
sequence length 308
chains with identical sequence B
ec nomenclature ec 2.7.1.35: Pyridoxal kinase.
pdb deposition date 2005-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2ajpA00
1LIOA 5C40A 4E69A 3DRWA 3RQ2A 2A9YA 3K9EA 4LC4A 4DU5A 4LBXA 1LIKA 4LCAA 3RSGA 3RO4A 3Q1YA 2R3BA 1U2XA 2VARA 1JXIA 1V1AA 3Q92A 4S1IA 1C3QA 3FHXA 3BGKA 3JULA 1RKSA 3RTGA 3RS8A 3IBQA 3IN1A 1YGJA 4LBGA 1LIIA 2AJRA 4E8WA 4K9IA 3KD6A 3PZSA 2F02A 4KALA 4C5LA 4XDAA 2AX3A 3IQ0A 4U7XA 4KAHA 3RU2A 3FHYA 3NCAA 1ESQA 1RKAA 2YXTA 3B1RA 3NL2A 1RFUA 1GC5A 1TD2A 4S1IB 3VASA 4E8YA 3RTEA 4XF6A 3UBOA 2C49A 2YXUA 2JG1A 3RQ6A 5C41A 2DCNA 2AFBA 3RSFA 2JGVA 2QCVA 3RS9A 3NL6A 3LKIA 1RFVA 2AWDA 1TYYA 2HW1A 3UMOA 4E84A 3B1PA 3B1OA 3LOOA 3HICA 2AA0A 1VM7A 2I6AA 4K8PA 3UQ6A 5CGAA 2I5BA 4UBEA 1KYHA 4EOHA 3GO7A 3NM3A 4EUMA 3H74A 3RTAA 5CGEA 1TZ3A 3B3LA 5TRWA 3RQ5A 3RPHA 5F11A 1LHRA 2PKNA 3B1QA 3IH0A 3UMPA 4C5NA 4C5MA 3HPDA 2DDOA 2PKMA 3N1CA 5BYEA 3EWMA 4XCKA 2NWHA 1UA4A 3IKHA 2HQQA 3MBJA 2HLZA 3RRJA 3I3YA 3DZVA 3OTXA 4K8CA 2R3EA 3LJSA 5TQIA 4K8TA 3NL3A 3ZS7A 4C5KA 2QHPA 3UQDA 3RSQA 3KZHA 3RRFA 5CM5A 4DC3A 3H49A 3HYOA 3RQHA 2RBCA 4B8RA 1GQTA 1YHJA 4N08A 5EYNA 4C5JA 3RQQA 4KADA 3RU3A 1WYEA 2I6BA 3NM1A 1V19A 3RRBA 4K9CA 4EN4A 3PL2A 5BYCA 1EKKA 1TZ6A 3NBVA 3NL5A 2ABSA 3VAQA 2A9ZA 3LHXA 2AB8A 2DDWA 2PKFA 5C3YA 4KANA 4S1MA 1EKQA 4YWRA 3RPZA 3RQ8A 1V1BA 4N09A 3B1NA 2FV7A 1LIJA 3UQ9A 2V78A 4JKSA 4E8ZA 3GO6A 4PVVA 2PKKA 3MBHA 3NC9A 1JXHA 2C4EA 3QA2A 3RSSA 2AJPA 1VI9A 4K93A 4O1GA 5BYDA 1VK4A 4B8SA 2ABQA 3NC2A 4O1LA 2Q5RA 4WJMA 1YGKA 3W4SA 3RTBA 4E3AA 3QAIA 3RQXA 2DDMA 2JG5A 2F7KA 2XTBA 4K8KA 1BX4A 3RREA 3RT7A 4X8FA 1UB0A 3BF5A 4JJPA 1L2LA 1ESJA 1RFTA 3KTNA 5F0ZA 5EY7A 3UQEA 4KBEA 4XF7A 3RTDA 1LHPA 4GM6A 3RM5A 1RK2A 3KEUA 4YL5A 3RTCA 3CQDA 3GBUA 4EBUA 4S1HA 5B6AA 1DGMA 5C3ZA 1V1SA 3RT9A 3NBWA 3IE7A 5BYFA 1RKDA 3K5WA 4JKUA 3RY7A 5COJA
chains in the Genus database with same CATH superfamily
1LIOA 4HV4A 5C40A 2JFGA 3DRWA 4C12A 3RQ2A 2A9YA 3K9EA 4CVMA 3NRSA 4LC4A 4E69A 4DU5A 4LBXA 1LIKA 4LCAA 3RSGA 2Y67A 1O5ZA 3RO4A 3Q1YA 2R3BA 1U2XA 2VARA 1JBVA 1JXIA 2JFHA 1V1AA 3Q92A 4S1IA 1C3QA 3FHXA 3BGKA 3JULA 1RKSA 3RTGA 3RS8A 3IBQA 3IN1A 1YGJA 2Y68A 1LIIA 2AJRA 4LBGA 4K9IA 4E8WA 3KD6A 3PZSA 2F02A 4KALA 4C5LA 4XDAA 1P31A 2AX3A 2Y66A 2AM1A 4ZIYA 3IQ0A 4U7XA 4KAHA 3RU2A 3FHYA 3NCAA 1ESQA 1RKAA 2YXTA 3B1RA 3HJ6A 1RFUA 2F00A 1GC5A 1TD2A 1W7KA 3NL2A 4S1IB 4XF6A 3RTEA 3UBOA 2C49A 2YXUA 2JG1A 3RQ6A 5C41A 2DCNA 1FGSA 2AFBA 2VTEA 3RSFA 1UAGA 2JGVA 2QCVA 3RS9A 3NL6A 3LKIA 3LK7A 1RFVA 2AWDA 1TYYA 2HW1A 2UUPA 3UMOA 4E84A 5A5FA 3B1PA 3B1OA 3LOOA 3HICA 2AA0A 2GC6A 1VM7A 1W78A 1J6UA 2I6AA 4K8PA 2AM2A 3UQ6A 5CGAA 1P3DA 2I5BA 4UBEA 1KYHA 4UAGA 4EOHA 3GO7A 3NM3A 4EUMA 3H74A 3RTAA 5CGEA 1JBWA 1TZ3A 3B3LA 5TRWA 3RQ5A 3RPHA 5F11A 1LHRA 3ZM6A 2PKNA 1GG4A 3B1QA 3IH0A 3UMPA 3ZM5A 4C13A 4C5NA 4C5MA 3EAGA 3HPDA 2DDOA 2PKMA 3N1CA 5BYEA 3EWMA 4XCKA 2NWHA 1UA4A 1GQQA 3IKHA 2HQQA 3MBJA 2HLZA 3RRJA 3I3YA 3DZVA 3OTXA 2WTZA 4K8CA 2R3EA 4CVKA 3LJSA 5TQIA 4K8TA 3HN7A 1GQYA 3NL3A 3ZS7A 2QHPA 4C5KA 4CVLA 3UQDA 4E8YA 3RSQA 3KZHA 2XJAA 3VASA 3RRFA 5CM5A 4QDIA 4DC3A 3H49A 3PYZA 2JFFA 3HYOA 2VOSA 3RQHA 2RBCA 3ZL8A 2WJPA 4B8RA 1GQTA 1YHJA 2GCAA 2XPCA 4N08A 5EYNA 3RQQA 4C5JA 4KADA 3RU3A 1WYEA 2I6BA 3NM1A 1V19A 3RRBA 4K9CA 4EN4A 3PL2A 5BYCA 1EKKA 1TZ6A 3NBVA 3NL5A 2ABSA 3VAQA 2A9ZA 3LHXA 2AB8A 2DDWA 2PKFA 5C3YA 4KANA 4S1MA 1EKQA 2X5OA 4YWRA 3RPZA 1V1BA 4N09A 3RQ8A 3B1NA 2FV7A 1LIJA 3UQ9A 2V78A 4JKSA 4E8ZA 3GO6A 4PVVA 2PKKA 2UUOA 3MBHA 1JXHA 2C4EA 3NC9A 3QA2A 3RSSA 2AJPA 1VI9A 4K93A 4O1GA 1EEHA 5BYDA 3QCZA 1VK4A 4B8SA 1E0DA 2ABQA 3NC2A 2VORA 4O1LA 2Q5RA 4WJMA 1YGKA 4BUBA 3N2AA 3W4SA 3RTBA 4BUCA 4E3AA 3QAIA 3RQXA 2DDMA 2GC5A 2JG5A 2F7KA 2XTBA 4K8KA 1BX4A 3RREA 3RT7A 3UAGA 4X8FA 4QF5A 1UB0A 3BF5A 4JJPA 1L2LA 1ESJA 1RFTA 3KTNA 5F0ZA 2UAGA 5EY7A 3UQEA 4KBEA 4XF7A 3RTDA 1LHPA 4GM6A 3RM5A 1RK2A 3KEUA 4YL5A 3RTCA 3CQDA 3GBUA 4EBUA 4S1HA 5A5EA 5B6AA 2GCBA 1DGMA 5C3ZA 1V1SA 2Y1OA 3RT9A 2VTDA 3NBWA 3IE7A 5BYFA 1RKDA 1E8CA 3K5WA 4JKUA 3RY7A 5COJA
chains in the Genus database with same CATH topology
1LIOA 5C40A 4E69A 3DRWA 3RQ2A 2A9YA 3K9EA 4LC4A 4DU5A 4LBXA 1LIKA 4LCAA 3RSGA 3RO4A 3Q1YA 2R3BA 1U2XA 2VARA 1JXIA 1V1AA 3Q92A 4S1IA 1C3QA 3FHXA 3BGKA 3JULA 1RKSA 3RTGA 3RS8A 3IBQA 3IN1A 1YGJA 4LBGA 1LIIA 2AJRA 4E8WA 4K9IA 3KD6A 3PZSA 2F02A 4KALA 4C5LA 4XDAA 2AX3A 3IQ0A 4U7XA 4KAHA 3RU2A 3FHYA 3NCAA 1ESQA 1RKAA 2YXTA 3B1RA 3HJ6A 1RFUA 1GC5A 1TD2A 3NL2A 4S1IB 3VASA 3RTEA 4XF6A 3UBOA 4E8YA 2C49A 2YXUA 2JG1A 3RQ6A 5C41A 2DCNA 2AFBA 3RSFA 2JGVA 2QCVA 3RS9A 3NL6A 3LKIA 1RFVA 2AWDA 1TYYA 2HW1A 3UMOA 4E84A 3B1PA 3B1OA 3LOOA 3HICA 2AA0A 1VM7A 2I6AA 4K8PA 3UQ6A 5CGAA 2I5BA 4UBEA 1KYHA 4EOHA 3GO7A 3NM3A 4EUMA 3H74A 3RTAA 5CGEA 1TZ3A 3B3LA 5TRWA 3RQ5A 3RPHA 5F11A 1LHRA 2PKNA 3B1QA 3IH0A 3UMPA 4C5NA 4C5MA 3HPDA 2DDOA 2PKMA 3N1CA 5BYEA 3EWMA 4XCKA 2NWHA 1UA4A 3IKHA 2HQQA 3MBJA 2HLZA 3RRJA 3I3YA 3DZVA 3OTXA 4K8CA 2R3EA 3LJSA 5TQIA 4K8TA 3NL3A 3ZS7A 4C5KA 2QHPA 3UQDA 3RSQA 3KZHA 3RRFA 5CM5A 4DC3A 3H49A 3HYOA 3RQHA 2RBCA 4B8RA 1GQTA 1YHJA 4N08A 5EYNA 4C5JA 3RQQA 4KADA 3RU3A 1WYEA 2I6BA 3NM1A 1V19A 3RRBA 4K9CA 4EN4A 3PL2A 5BYCA 1EKKA 1TZ6A 3NBVA 3NL5A 2ABSA 3VAQA 2A9ZA 3LHXA 2AB8A 2DDWA 2PKFA 5C3YA 4KANA 4S1MA 1EKQA 4YWRA 3RPZA 3RQ8A 1V1BA 4N09A 3B1NA 2FV7A 1LIJA 3UQ9A 2V78A 4JKSA 4E8ZA 3GO6A 4PVVA 2PKKA 3MBHA 3NC9A 1JXHA 2C4EA 3QA2A 3RSSA 2AJPA 1VI9A 4K93A 4O1GA 5BYDA 1VK4A 4B8SA 2ABQA 3NC2A 4O1LA 2Q5RA 4WJMA 1YGKA 3W4SA 3RTBA 4E3AA 3QAIA 3RQXA 2DDMA 2JG5A 2F7KA 2XTBA 4K8KA 1BX4A 3RREA 3RT7A 4X8FA 1UB0A 3BF5A 4JJPA 1L2LA 1ESJA 1RFTA 3KTNA 5F0ZA 5EY7A 3UQEA 4KBEA 4XF7A 3RTDA 1LHPA 4GM6A 3RM5A 1RK2A 3KEUA 4YL5A 3RTCA 3CQDA 3GBUA 4EBUA 4S1HA 5B6AA 1DGMA 5C3ZA 1V1SA 3RT9A 3NBWA 3IE7A 5BYFA 1RKDA 3K5WA 4JKUA 3RY7A 5COJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LIO A;  5C40 A;  4E69 A;  3DRW A;  3RQ2 A;  2A9Y A;  3K9E A;  4LC4 A;  4DU5 A;  4LBX A;  1LIK A;  4LCA A;  3RSG A;  3RO4 A;  3Q1Y A;  2R3B A;  1U2X A;  2VAR A;  1JXI A;  1V1A A;  3Q92 A;  4S1I A;  1C3Q A;  3FHX A;  3BGK A;  3JUL A;  1RKS A;  3RTG A;  3RS8 A;  3IBQ A;  3IN1 A;  1YGJ A;  4LBG A;  1LII A;  2AJR A;  4E8W A;  4K9I A;  3KD6 A;  3PZS A;  2F02 A;  4KAL A;  4C5L A;  4XDA A;  2AX3 A;  3IQ0 A;  4U7X A;  4KAH A;  3RU2 A;  3FHY A;  3NCA A;  1ESQ A;  1RKA A;  2YXT A;  3B1R A;  3NL2 A;  1RFU A;  1GC5 A;  1TD2 A;  4S1I B;  3VAS A;  4E8Y A;  3RTE A;  4XF6 A;  3UBO A;  2C49 A;  2YXU A;  2JG1 A;  3RQ6 A;  5C41 A;  2DCN A;  2AFB A;  3RSF A;  2JGV A;  2QCV A;  3RS9 A;  3NL6 A;  3LKI A;  1RFV A;  2AWD A;  1TYY A;  2HW1 A;  3UMO A;  4E84 A;  3B1P A;  3B1O A;  3LOO A;  3HIC A;  2AA0 A;  1VM7 A;  2I6A A;  4K8P A;  3UQ6 A;  5CGA A;  2I5B A;  4UBE A;  1KYH A;  4EOH A;  3GO7 A;  3NM3 A;  4EUM A;  3H74 A;  3RTA A;  5CGE A;  1TZ3 A;  3B3L A;  5TRW A;  3RQ5 A;  3RPH A;  5F11 A;  1LHR A;  2PKN A;  3B1Q A;  3IH0 A;  3UMP A;  4C5N A;  4C5M A;  3HPD A;  2DDO A;  2PKM A;  3N1C A;  5BYE A;  3EWM A;  4XCK A;  2NWH A;  1UA4 A;  3IKH A;  2HQQ A;  3MBJ A;  2HLZ A;  3RRJ A;  3I3Y A;  3DZV A;  3OTX A;  4K8C A;  2R3E A;  3LJS A;  5TQI A;  4K8T A;  3NL3 A;  3ZS7 A;  4C5K A;  2QHP A;  3UQD A;  3RSQ A;  3KZH A;  3RRF A;  5CM5 A;  4DC3 A;  3H49 A;  3HYO A;  3RQH A;  2RBC A;  4B8R A;  1GQT A;  1YHJ A;  4N08 A;  5EYN A;  4C5J A;  3RQQ A;  4KAD A;  3RU3 A;  1WYE A;  2I6B A;  3NM1 A;  1V19 A;  3RRB A;  4K9C A;  4EN4 A;  3PL2 A;  5BYC A;  1EKK A;  1TZ6 A;  3NBV A;  3NL5 A;  2ABS A;  3VAQ A;  2A9Z A;  3LHX A;  2AB8 A;  2DDW A;  2PKF A;  5C3Y A;  4KAN A;  4S1M A;  1EKQ A;  4YWR A;  3RPZ A;  3RQ8 A;  1V1B A;  4N09 A;  3B1N A;  2FV7 A;  1LIJ A;  3UQ9 A;  2V78 A;  4JKS A;  4E8Z A;  3GO6 A;  4PVV A;  2PKK A;  3MBH A;  3NC9 A;  1JXH A;  2C4E A;  3QA2 A;  3RSS A;  2AJP A;  1VI9 A;  4K93 A;  4O1G A;  5BYD A;  1VK4 A;  4B8S A;  2ABQ A;  3NC2 A;  4O1L A;  2Q5R A;  4WJM A;  1YGK A;  3W4S A;  3RTB A;  4E3A A;  3QAI A;  3RQX A;  2DDM A;  2JG5 A;  2F7K A;  2XTB A;  4K8K A;  1BX4 A;  3RRE A;  3RT7 A;  4X8F A;  1UB0 A;  3BF5 A;  4JJP A;  1L2L A;  1ESJ A;  1RFT A;  3KTN A;  5F0Z A;  5EY7 A;  3UQE A;  4KBE A;  4XF7 A;  3RTD A;  1LHP A;  4GM6 A;  3RM5 A;  1RK2 A;  3KEU A;  4YL5 A;  3RTC A;  3CQD A;  3GBU A;  4EBU A;  4S1H A;  5B6A A;  1DGM A;  5C3Z A;  1V1S A;  3RT9 A;  3NBW A;  3IE7 A;  5BYF A;  1RKD A;  3K5W A;  4JKU A;  3RY7 A;  5COJ A; 
#chains in the Genus database with same CATH topology
 1LIO A;  4HV4 A;  5C40 A;  2JFG A;  3DRW A;  4C12 A;  3RQ2 A;  2A9Y A;  3K9E A;  4CVM A;  3NRS A;  4LC4 A;  4E69 A;  4DU5 A;  4LBX A;  1LIK A;  4LCA A;  3RSG A;  2Y67 A;  1O5Z A;  3RO4 A;  3Q1Y A;  2R3B A;  1U2X A;  2VAR A;  1JBV A;  1JXI A;  2JFH A;  1V1A A;  3Q92 A;  4S1I A;  1C3Q A;  3FHX A;  3BGK A;  3JUL A;  1RKS A;  3RTG A;  3RS8 A;  3IBQ A;  3IN1 A;  1YGJ A;  2Y68 A;  1LII A;  2AJR A;  4LBG A;  4K9I A;  4E8W A;  3KD6 A;  3PZS A;  2F02 A;  4KAL A;  4C5L A;  4XDA A;  1P31 A;  2AX3 A;  2Y66 A;  2AM1 A;  4ZIY A;  3IQ0 A;  4U7X A;  4KAH A;  3RU2 A;  3FHY A;  3NCA A;  1ESQ A;  1RKA A;  2YXT A;  3B1R A;  3HJ6 A;  1RFU A;  2F00 A;  1GC5 A;  1TD2 A;  1W7K A;  3NL2 A;  4S1I B;  4XF6 A;  3RTE A;  3UBO A;  2C49 A;  2YXU A;  2JG1 A;  3RQ6 A;  5C41 A;  2DCN A;  1FGS A;  2AFB A;  2VTE A;  3RSF A;  1UAG A;  2JGV A;  2QCV A;  3RS9 A;  3NL6 A;  3LKI A;  3LK7 A;  1RFV A;  2AWD A;  1TYY A;  2HW1 A;  2UUP A;  3UMO A;  4E84 A;  5A5F A;  3B1P A;  3B1O A;  3LOO A;  3HIC A;  2AA0 A;  2GC6 A;  1VM7 A;  1W78 A;  1J6U A;  2I6A A;  4K8P A;  2AM2 A;  3UQ6 A;  5CGA A;  1P3D A;  2I5B A;  4UBE A;  1KYH A;  4UAG A;  4EOH A;  3GO7 A;  3NM3 A;  4EUM A;  3H74 A;  3RTA A;  5CGE A;  1JBW A;  1TZ3 A;  3B3L A;  5TRW A;  3RQ5 A;  3RPH A;  5F11 A;  1LHR A;  3ZM6 A;  2PKN A;  1GG4 A;  3B1Q A;  3IH0 A;  3UMP A;  3ZM5 A;  4C13 A;  4C5N A;  4C5M A;  3EAG A;  3HPD A;  2DDO A;  2PKM A;  3N1C A;  5BYE A;  3EWM A;  4XCK A;  2NWH A;  1UA4 A;  1GQQ A;  3IKH A;  2HQQ A;  3MBJ A;  2HLZ A;  3RRJ A;  3I3Y A;  3DZV A;  3OTX A;  2WTZ A;  4K8C A;  2R3E A;  4CVK A;  3LJS A;  5TQI A;  4K8T A;  3HN7 A;  1GQY A;  3NL3 A;  3ZS7 A;  2QHP A;  4C5K A;  4CVL A;  3UQD A;  4E8Y A;  3RSQ A;  3KZH A;  2XJA A;  3VAS A;  3RRF A;  5CM5 A;  4QDI A;  4DC3 A;  3H49 A;  3PYZ A;  2JFF A;  3HYO A;  2VOS A;  3RQH A;  2RBC A;  3ZL8 A;  2WJP A;  4B8R A;  1GQT A;  1YHJ A;  2GCA A;  2XPC A;  4N08 A;  5EYN A;  3RQQ A;  4C5J A;  4KAD A;  3RU3 A;  1WYE A;  2I6B A;  3NM1 A;  1V19 A;  3RRB A;  4K9C A;  4EN4 A;  3PL2 A;  5BYC A;  1EKK A;  1TZ6 A;  3NBV A;  3NL5 A;  2ABS A;  3VAQ A;  2A9Z A;  3LHX A;  2AB8 A;  2DDW A;  2PKF A;  5C3Y A;  4KAN A;  4S1M A;  1EKQ A;  2X5O A;  4YWR A;  3RPZ A;  1V1B A;  4N09 A;  3RQ8 A;  3B1N A;  2FV7 A;  1LIJ A;  3UQ9 A;  2V78 A;  4JKS A;  4E8Z A;  3GO6 A;  4PVV A;  2PKK A;  2UUO A;  3MBH A;  1JXH A;  2C4E A;  3NC9 A;  3QA2 A;  3RSS A;  2AJP A;  1VI9 A;  4K93 A;  4O1G A;  1EEH A;  5BYD A;  3QCZ A;  1VK4 A;  4B8S A;  1E0D A;  2ABQ A;  3NC2 A;  2VOR A;  4O1L A;  2Q5R A;  4WJM A;  1YGK A;  4BUB A;  3N2A A;  3W4S A;  3RTB A;  4BUC A;  4E3A A;  3QAI A;  3RQX A;  2DDM A;  2GC5 A;  2JG5 A;  2F7K A;  2XTB A;  4K8K A;  1BX4 A;  3RRE A;  3RT7 A;  3UAG A;  4X8F A;  4QF5 A;  1UB0 A;  3BF5 A;  4JJP A;  1L2L A;  1ESJ A;  1RFT A;  3KTN A;  5F0Z A;  2UAG A;  5EY7 A;  3UQE A;  4KBE A;  4XF7 A;  3RTD A;  1LHP A;  4GM6 A;  3RM5 A;  1RK2 A;  3KEU A;  4YL5 A;  3RTC A;  3CQD A;  3GBU A;  4EBU A;  4S1H A;  5A5E A;  5B6A A;  2GCB A;  1DGM A;  5C3Z A;  1V1S A;  2Y1O A;  3RT9 A;  2VTD A;  3NBW A;  3IE7 A;  5BYF A;  1RKD A;  1E8C A;  3K5W A;  4JKU A;  3RY7 A;  5COJ A; 
#chains in the Genus database with same CATH homology
 1LIO A;  5C40 A;  4E69 A;  3DRW A;  3RQ2 A;  2A9Y A;  3K9E A;  4LC4 A;  4DU5 A;  4LBX A;  1LIK A;  4LCA A;  3RSG A;  3RO4 A;  3Q1Y A;  2R3B A;  1U2X A;  2VAR A;  1JXI A;  1V1A A;  3Q92 A;  4S1I A;  1C3Q A;  3FHX A;  3BGK A;  3JUL A;  1RKS A;  3RTG A;  3RS8 A;  3IBQ A;  3IN1 A;  1YGJ A;  4LBG A;  1LII A;  2AJR A;  4E8W A;  4K9I A;  3KD6 A;  3PZS A;  2F02 A;  4KAL A;  4C5L A;  4XDA A;  2AX3 A;  3IQ0 A;  4U7X A;  4KAH A;  3RU2 A;  3FHY A;  3NCA A;  1ESQ A;  1RKA A;  2YXT A;  3B1R A;  3HJ6 A;  1RFU A;  1GC5 A;  1TD2 A;  3NL2 A;  4S1I B;  3VAS A;  3RTE A;  4XF6 A;  3UBO A;  4E8Y A;  2C49 A;  2YXU A;  2JG1 A;  3RQ6 A;  5C41 A;  2DCN A;  2AFB A;  3RSF A;  2JGV A;  2QCV A;  3RS9 A;  3NL6 A;  3LKI A;  1RFV A;  2AWD A;  1TYY A;  2HW1 A;  3UMO A;  4E84 A;  3B1P A;  3B1O A;  3LOO A;  3HIC A;  2AA0 A;  1VM7 A;  2I6A A;  4K8P A;  3UQ6 A;  5CGA A;  2I5B A;  4UBE A;  1KYH A;  4EOH A;  3GO7 A;  3NM3 A;  4EUM A;  3H74 A;  3RTA A;  5CGE A;  1TZ3 A;  3B3L A;  5TRW A;  3RQ5 A;  3RPH A;  5F11 A;  1LHR A;  2PKN A;  3B1Q A;  3IH0 A;  3UMP A;  4C5N A;  4C5M A;  3HPD A;  2DDO A;  2PKM A;  3N1C A;  5BYE A;  3EWM A;  4XCK A;  2NWH A;  1UA4 A;  3IKH A;  2HQQ A;  3MBJ A;  2HLZ A;  3RRJ A;  3I3Y A;  3DZV A;  3OTX A;  4K8C A;  2R3E A;  3LJS A;  5TQI A;  4K8T A;  3NL3 A;  3ZS7 A;  4C5K A;  2QHP A;  3UQD A;  3RSQ A;  3KZH A;  3RRF A;  5CM5 A;  4DC3 A;  3H49 A;  3HYO A;  3RQH A;  2RBC A;  4B8R A;  1GQT A;  1YHJ A;  4N08 A;  5EYN A;  4C5J A;  3RQQ A;  4KAD A;  3RU3 A;  1WYE A;  2I6B A;  3NM1 A;  1V19 A;  3RRB A;  4K9C A;  4EN4 A;  3PL2 A;  5BYC A;  1EKK A;  1TZ6 A;  3NBV A;  3NL5 A;  2ABS A;  3VAQ A;  2A9Z A;  3LHX A;  2AB8 A;  2DDW A;  2PKF A;  5C3Y A;  4KAN A;  4S1M A;  1EKQ A;  4YWR A;  3RPZ A;  3RQ8 A;  1V1B A;  4N09 A;  3B1N A;  2FV7 A;  1LIJ A;  3UQ9 A;  2V78 A;  4JKS A;  4E8Z A;  3GO6 A;  4PVV A;  2PKK A;  3MBH A;  3NC9 A;  1JXH A;  2C4E A;  3QA2 A;  3RSS A;  2AJP A;  1VI9 A;  4K93 A;  4O1G A;  5BYD A;  1VK4 A;  4B8S A;  2ABQ A;  3NC2 A;  4O1L A;  2Q5R A;  4WJM A;  1YGK A;  3W4S A;  3RTB A;  4E3A A;  3QAI A;  3RQX A;  2DDM A;  2JG5 A;  2F7K A;  2XTB A;  4K8K A;  1BX4 A;  3RRE A;  3RT7 A;  4X8F A;  1UB0 A;  3BF5 A;  4JJP A;  1L2L A;  1ESJ A;  1RFT A;  3KTN A;  5F0Z A;  5EY7 A;  3UQE A;  4KBE A;  4XF7 A;  3RTD A;  1LHP A;  4GM6 A;  3RM5 A;  1RK2 A;  3KEU A;  4YL5 A;  3RTC A;  3CQD A;  3GBU A;  4EBU A;  4S1H A;  5B6A A;  1DGM A;  5C3Z A;  1V1S A;  3RT9 A;  3NBW A;  3IE7 A;  5BYF A;  1RKD A;  3K5W A;  4JKU A;  3RY7 A;  5COJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...