2AJQB

Structure of replicative dna polymerase provides insigts into the mechanisms for processivity, frameshifting and editing
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA Primer
publication title Structure of replicative DNA polymerase provides insigts into the mechanisms for processivity, frameshifting and editing
rcsb
source organism Enterobacteria phage t7
molecule tags Transferase,transcription/dna
total genus 26
structure length 105
sequence length 105
chains with identical sequence I
ec nomenclature
pdb deposition date 2005-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ajqB00
4MA9A 2RIIA 2R3XA 4PGTA 2I9HA 2JSYA 2HYXA 3ZL5A 3HHVA 4DSRA 2B5XA 1A0FA 1KTEA 2M80A 5INYA 2DJ0A 2VLTA 2HRNA 3U5RE 4OFNA 4G19A 3VI5A 4KA0A 3I9V2 2H6ZA 2E2MA 3F0IA 3O76A 5CRGA 1XOAA 1S3AA 5JWRB 1F2EA 3ZVJD 4IGJA 4OFMA 5ECSA 1ERUA 3VK9A 1MD4A 1X0RA 5DDLA 1XBSA 3FW2A 4I6XA 10GSA 4KSOA 2G0FA 3FY7A 3BCKA 2L4QA 1UC7A 3PR8A 4F0BA 4EE0A 1ZYEA 3EC3A 1M9AA 4V1Ag 3LYKA 5IPHA 3ERWA 3Q6OA 1FVKA 2MBSA 4ML6A 3VPQA 1X9MB 2E2GA 2K8VA 4F82A 3CYNA 1B9YC 3TJJA 1W89A 3ZREA 4MJBA 4L8EA 2WZ9A 2PUKC 5C04A 1TXXA 3EYTA 2C0EA 3TOUA 3LQ7A 4L0WA 3DEXA 3I43A 2DSAA 2VLUA 1M2BA 5A4WA 1VF2A 4ZB6A 4XS4A 3MWHA 1AW9A 3FK8A 2AYTA 2ON5A 1ON4A 3CRUA 3NZNA 4D73B 4FYCA 3TGZA 2BMXA 4K7OA 2L4CA 4FYBA 1Z7RA 4JEDA 3M1GA 5ECPB 5JWQB 5IPGA 5HR3A 3UBLA 2A2SA 3TJGA 2OACA 2H71A 2JL4A 2YV9A 3VWUA 1GLQA 2ZUPA 5AN1A 5H5RA 3KH7A 3TUEA 1ZMAA 5EPFA 3G9BA 6GSYA 1W4VA 3DIEA 2IPAA 2P31A 2P5QA 1RW1A 4IHUA 4MJEA 1B9XC 5D73A 4PQ1A 3GHAA 3H1NA 4KGIA 4LL1B 3TRPA 2KLXA 1ST9A 4GQFA 1HYUA 8GSSA 3D6IA 1VRSD 1OAZA 2C0DA 1HNBA 4KCAA 1MDJA 3IRAA 3FZ5A 1GP1A 2R6KA 11GSA 2GSRA 3CMIA 3PINA 2GT6A 4ECBA 1HQOA 3WYWA 3EU4A 3DVWA 2IFQB 3F8UA 5KN2A 1J9BA 3D4MA 3IOSA 4TR4A 3HXSA 4QL9A 3DWVA 1PRXA 4V2MA 1QQ2A 1LU4A 2WULA 4MH2A 5B8BA 2H72A 5DVBA 1JZDA 2ON7A 4IKHA 3VI7A 2DJ3A 5IQYA 2F3MA 3GA4A 2NVLA 3F6FA 3P8WA 1PX6A 1OC3A 5J5NA 2PMTA 1V2AA 3QAGA 3HJPA 9GSSA 3V1WA 1DE1A 3ZMKA 3D0ZA 4JBBA 12GSA 4MF5A 3KM6A 4XS1A 3UARA 2B7KA 4X1UA 4PNGA 1T7PB 2OE0A 4ISDA 2VL2C 5FHIA 2B5YA 5DAKB 1G6YA 1R5AA 3CSHA 2ES7A 4ZXGA 2MBTA 1PQNA 3IK7A 3CRTA 4Z7XA 1V58A 5KN3A 5KEJA 1ILOA 3A3TA 3DXBA 4I2TA 5F0GA 1K0DA 5D8IA 4WR5A 4HUAA 5G30A 4V2LA 3IV4A 2QC7A 2YP6A 4KDYA 3C1RA 3TKRA 2CA8A 3F63A 3EURA 3QDNA 3A2VA 3VURA 3DRNA 4IJIA 3TCOA 1O81A 2HSHA 1KEBA 2HZEB 3M3MA 2C3QA 5ECKB 3C1SA 1T3BA 3KIJA 4HU9A 5HQPA 2HNLA 17GSA 3L4NA 2O89A 1GSQA 3F9UA 13GSA 6GSSA 2H19A 3RAZA 4AGSA 4KX4A 2VCZA 1GWCA 2DC5A 4WEYA 2HXKA 4EDZA 5DALB 4JU5A 5D93A 3QCPA 3RBTA 3ISOA 4GWRA 2PGTA 3RHCA 3APQA 1TK5B 1G7OA 1KNGA 1URMA 3ERGA 2DIYA 2FWFA 2H30A 3WGXA 4N0VA 1XW5A 3A2WA 2VL3A 1B4PA 4N10A 4F0CA 4MMMA 3EWLA 3CSIA 2K18A 2YJHA 4J2FA 3DMLA 1FO5A 1AIUA 3CSJA 5FT3A 5ECQB 2KHPA 6GSTA 3ZMLA 4KAEA 3GTUA 3TKPA 4E8HA 1AQWA 2PWJA 4MH3A 3W8SA 2B1KA 2PERA 1XXUA 4ILFA 4FYUA 7GSSA 4IJ3A 5J41A 5GAPD 3GN3A 4ZL9A 1Y25A 2V32A 3KJYA 4KDUA 3PGTA 3FR6A 4POMA 2GS3A 2XC2A 2XPEA 2J9HA 4BVYA 2CV4A 2H1DA 3GIXA 3S9FA 3FZ4A 4K6XA 4GSNA 1USBA 1GSUA 2VM2A 5DAKA 2CAIA 5JWOB 1V40A 2KP1A 1SL1B 1X5CA 4MF7A 5LNKe 2V41A 1K3YA 3L9SA 5AIVA 3WGDA 4O7HA 1K0NA 1XCCA 1I9DA 14GSA 3D5JA 2B1LA 4AF2A 2OBKA 2MZCA 3CTFA 5GSTA 2E7PA 4N0ZA 4QL7A 4HJMA 3SBCA 1F3AA 1CQHA 4DSQA 3KMOA 1EWXA 4IBPA 4ULXA 1NM3A 1A8LA 1F37A 1ERWA 3HJMA 4K2DA 4NXIA 1RK4A 3DGQA 4PX1A 4E8EA 2GVPA 3HY2A 3MNGA 3TOTA 2F8AA 3TRQA 1V98A 2PN8A 5DQYA 5IMCA 2TRXA 2QGVA 2VO4A 4TR0A 1TK8B 2A4VA 1X5DA 5DALA 2K9FA 1H4OA 4IP6A 2D2ZA 4IQ1A 1YKCA 1BG5A 1FB6A 1XZOA 3ZIVA 4IQAA 2VL2A 3I6AA 3WT1A 2NDOA 1K0BA 5CAXA 3E3EA 1B4QA 3FZ9A 2XHFA 3IK9A 2FY6A 1EEMA 3WGEA 4XRAA 3UEMA 2OE3A 1TW9A 1Z3EA 2CZ2A 3TJBA 1SD8A 3MSZA 2YNXA 5IMVA 4KDXA 5G1LA 4TR1A 2HE3A 4OO5A 4POLA 4EVMA 1SJ6A 4F03A 2H6YA 1ZYQB 4HS1A 5KN0A 4L5OA 5CRWA 5ECHB 2YWMA 4Q5RA 4KUNA 3FZAA 3C71A 1IYIA 4HU7A 1OE7A 2MMOA 2LQQA 4YAPA 5G2ZA 3IAM2 5DQSA 1JHBA 3DKSA 3LORA 2V1MA 2DLXA 1QUWA 5E4WA 4ZIJA 4ML1A 1O8WA 1E6BA 2B3SA 3Q74A 2QSIA 5L71A 2AJQB 1TDIA 2X8CA 1C72A 1T00A 2H75A 4TOPA 3O6TA 2R5GA 3UJ1A 1GH2A 4MPGA 1YQ1A 2IMDA 5DBQA 4ACSA 1SYXA 16GSA 1BQ7A 1PA3A 3C73A 2GGTA 1VF4A 4YQVA 2B5EA 4NMUA 3HZ4A 2CAQA 2MMZA 4K7NA 1HNCA 1O85A 2CVDA 4O5RA 1XIYA 3GX0A 5F8BA 4F9ZA 2FUG2 4RQRA 3GUSA 3VPTA 1SJIA 2IN3A 3F3QA 1GUHA 5ECNB 5IMAA 3FRCA 4K7IA 4TN8A 1THOA 1SKWB 1XPVA 1A2JA 3ME7A 1RQMA 3RHBA 5D96A 1MTCA 4XS6A 2CVKA 2IL3A 2GDRA 3GFKA 2AHEA 4GTUA 1EOHA 1GNWA 4KB3A 3H8QA 4BPYA 5ECRB 1MEKA 1M2DA 4EF0A 1Z9HA 2FWHA 1YF1A 2GSSA 2HSYA 2L6CA 3UMAA 2OADA 2GLRA 4NV5A 4EKZA 2O87A 1X5EA 5ECIB 3GKXA 3KTBA 2N5AA 1AC1A 1XOBA 4WF5A 2QKEA 1U88A 1TU7A 2O8VB 2LKUA 1JZOA 3TJKA 4G2EA 4FIWA 4DSSA 1A2MA 4OMVA 1YDKA 3FEUA 1T1VA 3G7IA 2C3TA 3HZ8A 1M9BA 3D4TA 1SU9A 1OE8A 3LEFA 3IBHA 4ID0A 1FB0A 1VGLA 1EP8A 3J7Yk 1GSDA 3GTUB 4LLRA 5CRDA 1PGTA 1BX9A 2X64A 2YOIA 5F06A 5DCGA 5HFGA 4ZB8A 2LNTA 4IVFA 4RI6A 4ZILA 3F4RA 1GUMA 4NV2A 2C1YA 2H01A 1GL8A 2J23A 4Q5NA 3LG6A 2WB9A 3VLNA 2F8FA 1YF0A 2PPTA 3GH6A 1CQGA 2C4JA 5GZZB 3IC4A 2JZSA 1UVZA 1QMVA 2JZTA 1TJDA 2C8UA 4OO4A 3JCML 2H76A 1AQXA 2PU9C 1J0FA 4RQXA 1T8EB 2H74A 4ZB9A 2FHEA 2LRNA 3UAPA 1YKAA 5ID2A 4YQUA 1J08A 1PN9A 1O7UA 3LYPA 4HZ4A 1FAAA 1R26A 4GF0A 2GTUA 1UA5A 1WP0A 1XWGA 1JZRA 4IELA 5B8AA 4L0UA 1WE0A 2H1GA 5EL8A 1Y6EA 2VCVA 2ZNMA 5GAND 2V6KA 4MJAA 4L5LA 2LSTA 4WBRD 5JCGA 4IS0A 5FWGA 4GQCA 4WKWA 2EIQA 5G1KA 4YH2A 2LUSA 4EXJA 3R2QA 1EGOA 4NHZA 2YJ7A 1Q4JA 2EC4A 3QOUA 2DJJA 2R2JA 1JFUA 2CQ9A 5ELAA 1GRXA 5H5SA 1K3OA 5DJLA 4OWYA 3IA1A 4YAVA 3E0UA 4ZL8A 2HLSA 2GQKA 3H79A 2K8SA 2H0IA 5IIZA 1LJRA 3UL3A 5AIXA 2DJ1A 1EEJA 3VWWA 5J9BA 3ED3A 4EC0A 1XWKA 5ECMB 3HA9A 3Q18A 2Z9SA 3GYKA 1JLWA 2V6OA 4JRRA 5ELGA 4LL4B 4TR1B 1A24A 3LSZA 2YCDA 2VM1A 4KSMA 1WIKA 3GH9A 4K1FA 3GV1A 3M0FA 5J9CA 3IDVA 1V57A 20GSA 2IIYA 1B8XA 2X8GA 1EV9A 5CNWA 2L57A 1H75A 1TK0B 1WJKA 4PURA 3QAWA 2VOCA 4OCEA 1ZL9A 5A5KA 1F3BA 2FCHA 1XW6A 2YWOA 1M7TA 1XW9A 4PXOA 2NTOA 4PQIA 1U87A 1R7HA 5B7CA 2VD0A 4TXVA 2WCIA 1SJZA 1LBKA 2GSTA 1A23A 2CT6A 2VCXA 3L9UA 4MJCA 5B6NA 1FHEA 1Q98A 2AB6A 1UN2A 1KBNA 2B6MA 4HJ2A 2EIOA 1TRWA 3KH9A 4G10A 3L9VA 5E59A 1ZZYA 5D9VA 1G7EA 5CRHA 3KP9A 3ZZXA 2IMIA 6GSXA 2NBSA 4HEA2 2FLSA 3TB2A 5B6MA 3GL3A 2N5FA 1B48A 5IOWA 2LV3A 2LRCA 4JR4A 4TR3A 2A2RA 3ERFA 1SK2A 1ACVA 3TDGA 2YV7A 2CX3A 1GSSA 2KOKA 5LCZA 1A8YA 2K6VA 1TOFA 5D9TA 2JZRA 1X9WB 5EY6A 1FVJA 3VWVA 4XTSA 1WMJA 1AXDA 2FD3A 5J3RA 1R4WA 3GRXA 1E2YA 2VCWA 2F51A 5IOXA 3F4TA 4FH8A 3ZYWA 3HDCA 2HFDA 1TI1A 4WXTA 2RM6A 3HVVA 5CP1A 4MABA 1PD21 5ABRA 3ZIJA 1S3DA 4TXOA 1WOUA 1YZXA 2FWEA 4F2IA 1YY7A 3G7YA 3P90A 3H4KA 1AQVA 2AUVA 4HOJA 2WRTA 4DSSB 1BEDA 4IW9A 1Z5YE 2H8LA 3US3A 3EINA 2PVOC 5A4VA 4HDEA 4MZWA 1ZCPA 4AJ7A 1K0MA 3BOAA 4MK3A 1XVQA 2XPDA 22GSA 5ENUA 3KP8A 5HFIA 5IMDA 3MDKA 3RPNA 2V2GA 3ZLPA 4POBA 2DMMA 1PMTA 5CYYA 2HRFA 1PSQA 4WF4A 5F05A 3QFBC 2RM5A 2VLVA 1A2LA 2YPMA 3L0HA 3LWAA 1OC9A 2LTKA 2L5LA 3C8EA 5JCWA 3UVHA 1TU8A 2LS5A 1GTUA 3QR6A 3F3RA 3EE2A 2IWTA 2C80A 3LJRA 4ZBBA 4Q5FA 4MLYA 3HVSA 4ZL7A 3ZVJA 2LEGA 3EVIA 4V1Ap 5ECOB 1SD9A 2YWIA 3DYRA 4BL7A 3HD5A 2GZPA 2H0GA 1BAYA 5AISA 1O6JA 2I81A 5IMFA 2NPBA 2GZYA 3QMXA 2LQOA 3HVXA 1XWBA 4OFTA 1SENA 3LXTA 5ID2B 19GSA 4CW9A 2H1AA 4MZCA 3GKKA 3TKSC 1GUKA 3UBKA 1GSFA 2H6XA 1SL2B 3WT2A 3GSTA 1PKZA 2CZ3A 4BVXA 4FO5A 2I4AA 4I8BA 3QD9A 4WR4A 1WRYA 1SKSB 3M9JA 1WPIA 3SWLA 3IXRA 6GSVA 3WD6A 3NOFA 1EGRA 1EV4A 1QK8A 3DD3A 2GSQA 1QGVA 2P0GA 4MPFA 2DMLA 2E0QA 3KMNA 5A4UA 3KTLA 4JE1A 1OYJA 4TRXA 5C00A 3H93A 1TP9A 4NWYA 4XHMA 3UOMA 3ZRDA 3FKFA 1FOVA 2VL9A 2WFCA 1OKDA 1HNAA 1AAZA 5G5EA 1DUGA 4EUYA 2AAWA 1DSBA 3P2AA 1SK1A 2JADA 4K0GA 3RDWA 4I2UA 4EDYA 1O8XA 3KEBA 2GQMA 1HD2A 3GNJA 1SL0B 2LJKA 4POKA 2TIRA 1K0OA 1VF3A 3LFLA 3ZFLA 4MDCA 3BBYA 3BJ5A 3KCMA 5F07A 2RUEA 1EP7A 4IN0A 3F6DA 2M46A 1QFNA 1TRSA 4PNFA 5JCUA 4G9HA 1I5GA 2YWNA 1TTZA 2R37A 1U6TA 1R5PA 1DE2A 4K0NA 4LA1A 18GSA 1F9MA 4JZQA 3IAS2 4V2NA 4ECJA 2O7KA 4X0XA 4H86A 2VAFA 2OJLA 2OBIA 2CX4A 1MDIA 1BJXA 2H70A 1BYEA 3GURA 3GKNA 4KNDA 3A2XA 2N5BA 4TW5A 4I97A 3N5OA 5J4UA 3IE3A 4HQZA 4DEJA 4LMWA 1JLVA 4HQSA 4XIHA 2DIZA 1YJ6A 2HI7A 1TRVA 5D9WA 2OA7A 2I1UA 2JACA 2H0HA 1M99A 3IPZA 2ALBA 3MAKA 1QXHA 1VF1A 2VUPA 3D21A 3FR9A 3G7JA 3VWXA 5EVOA 4CHSA 3CBUA 2ZCTA 3J7Yb 4GCIA 4NAXA 1TI3A 2F9SA 3QFAC 4CDOA 3HCZA 3RPPA 3L78A 3KZQA 3C7MA 2REMA 2LJRA 1AUCA 1ERVA 5CREA 2B7JA 1GTAA 4Q5QA 2BTOT 3EMPA 3UIWA 2IMEA 4O92A 2HZFA 4GLTA 4GXZA 2XBQA 2FA4A 4GSTA 4ECIA 2OKAA 5HR2A 3M9KA 2YN1A 4AJ8A 1XWAA 6GSUA 4D73A 3EMXA 3M8NA 1Z6MA 1K0CA 4X43A 4KE3A 5DJMA 3KD0A 3W8JA 5CO3A 4K9ZA 4TXOB 2MYGA 2X99A 4MP4A 4I5QA 4KH7A 1U3AA 2P5RA 4HI7A 1K3LA 4RUVA 4WETA 3NIVA 1THXA 5HR0A 4KW6A 4XCSA 4MF6A 5LD0A 3E9JB 4BWSA 3K8NA 4N30A 3HKRA 2JSZA 4LMVA 3DVXA 5DCHA 1N2AA 2BJXA 2H73A 4OCFA 1XVWA 2O85A 1ERTA 4MZBA 4PUAA 4TKYA 2C0GA 1G6WA 2M72A 3TKSA 2IMFA 1PKWA 1YEXA 2DJKA 3ZFBA 1GTBA 4ZBAA 1IYHA 5G5FA 3BD2A 4BA7A 1U3IA 4XRDA 2X8HA 1OC8A 2HT9A 1XFLA 2L5OA 2MMNA 3GSSA 3U6VA 2IFQA 1G0TA 4K8MA 4J57E 1OC9B 1Z7PA 2GQLA 2LJAA 2YZHA 3CXGA 3I69A 5AGYA 1EOGA 1TRUA 3ME8A 1M2AA 1GSEA 3CTGA 4OD7A 2FWGA 3O3TA 1GLPA 1Z6NA 3ZITA 4PUFC 3TJFA 5COHA 2GZZA 3IR4A 4GSSA 3EU3A 4J56E 2VIMA 1GNEA 5GSSA 4P3YB 2JU5A 2DJ2A 2WGRA 4NPBA 3UVTA 1PL1A 3QAVA 2PVQA 2RUFA 1K0AA 2H1BA 3QPMA 5D9XA 4HZ2A 4BWQA 5IO0A 5G31A 2FA8A 3OR5A 4YQMA 3ZTLA 2H66A 1ZGNA 1JZWA 2WS2A 2PBJA 3IHQA 2AV4A 4ZBDA 2CVBA 1O73A 1ABAA 4WBJA 2VD1A 3D22A 3TKSE 4GRFA 1YEPA 1A0RP 3LXZA 1X9SB 3GL5A 5IO2A 2GT5A 2I3YA 2LRTA 3LGCA 3FR3A 1PL2A 4IP1A 1T4ZA 3PH9A 3P7XA 1S3CA 1OVNA 3HYPA 5IM9A 1DBYA 1OKTA 3KXOA 1GULA 2LNSA 2R4VA 4XS4B 3APOA 4ECCA 3N9JA 4PQHA 2KP2A 6GSWA 1PX7A 1NSWA 2L59A 3A5WA 1T4YA 2YZUA 4EL1A 4N11A 4TVEA 2MMAA 3FYGA 1N8JA 2HZEA 2VCTA 5ECLB 2XBIA 4DVCA 5IMZA 3HJOA 1TKDB 3BCIA 1SYRA 5H5QA 1GSYA 3F4SA 2G2QA 3KGKA 3VFIA 1GTIA 1NW2A 3AY8A 3W6GA 1FG4A 1WWJA 2EIRA 4RI7A 1SKRB 1NHOA 1V9WA 4AJ6A 2C0FA 5KN1A 2FNOA 3TRXA 1MDKA 1XWCA 1ML6A 1NHYA 4MCUA 3GKMA 3TKQA 4NHWA 3Q19A 4KCEA 2TRCP 2WDUA 1M0UA 2IJYA 3FHKA 1F6MC 1FW1A 2KUCA 2FGXA 4JR6A 1MD3A 1SK0A 2OE1A 2RLIA 3GX8A 2VCQA 2L6DA 2YANA 2WJUA 3GMFA 4O32A 1ZOFA 4EO3A 2IMKA 1EZKA 5HR1A 2DBCA 3APSA 5HFKA 4QQ7A 2C3NA
chains in the Genus database with same CATH superfamily
4MA9A 2RIIA 2R3XA 4PGTA 2I9HA 2JSYA 2HYXA 3ZL5A 3HHVA 4DSRA 2B5XA 1A0FA 1KTEA 2M80A 5INYA 2DJ0A 2VLTA 2HRNA 3U5RE 4OFNA 4G19A 3VI5A 4KA0A 3I9V2 2H6ZA 2E2MA 3F0IA 3O76A 5CRGA 1XOAA 1S3AA 5JWRB 1F2EA 3ZVJD 4IGJA 4OFMA 4O5UA 3CQFA 5ECSA 1ERUA 3VK9A 1MD4A 1X0RA 5DDLA 1XBSA 3FW2A 4I6XA 10GSA 4KSOA 2G0FA 3FY7A 3BCKA 2L4QA 1UC7A 3PR8A 4F0BA 4EE0A 1ZYEA 3EC3A 1M9AA 4V1Ag 3LYKA 5IPHA 3ERWA 3Q6OA 1FVKA 2MBSA 4ML6A 3VPQA 1X9MB 2E2GA 2K8VA 4F82A 3CYNA 1B9YC 3TJJA 4O5QA 1W89A 3ZREA 4MJBA 4L8EA 2WZ9A 2PUKC 5C04A 1TXXA 3EYTA 2C0EA 3TOUA 3LQ7A 4L0WA 3DEXA 3I43A 2DSAA 3R3EA 2VLUA 1M2BA 5A4WA 1VF2A 4ZB6A 4XS4A 3MWHA 1AW9A 3FK8A 2AYTA 2ON5A 1ON4A 3CRUA 3NZNA 4D73B 4FYCA 3TGZA 2BMXA 4K7OA 2L4CA 4FYBA 4MNNA 1Z7RA 4JEDA 3M1GA 5ECPB 5JWQB 5IPGA 5HR3A 3UBLA 2A2SA 3TJGA 2OACA 2H71A 2A2PA 2JL4A 2YV9A 3VWUA 1GLQA 2ZUPA 5AN1A 5H5RA 3KH7A 3TUEA 1ZMAA 5EPFA 3G9BA 6GSYA 1W4VA 3DIEA 2IPAA 2P31A 2P5QA 1RW1A 4IHUA 4MJEA 1B9XC 5D73A 1ZYNA 4PQ1A 3GHAA 3H1NA 4KGIA 4LL1B 3TRPA 2KLXA 1ST9A 4GQFA 1HYUA 3LW9A 8GSSA 3D6IA 1VRSD 1OAZA 2C0DA 1HNBA 4KCAA 1MDJA 3IRAA 3FZ5A 1GP1A 2R6KA 11GSA 2GSRA 3CMIA 3PINA 2QA1A 2GT6A 4ECBA 1HQOA 3WYWA 3EU4A 3DVWA 2IFQB 3F8UA 5KN2A 1J9BA 3D4MA 3IOSA 4TR4A 3HXSA 4QL9A 2QA2A 3DWVA 1PRXA 4V2MA 1QQ2A 1LU4A 2WULA 4MH2A 5B8BA 2H72A 5DVBA 1JZDA 2ON7A 4IKHA 3VI7A 2DJ3A 5IQYA 2F3MA 3GA4A 2NVLA 3F6FA 3P8WA 1PX6A 1OC3A 5J5NA 2PMTA 1V2AA 3QAGA 3HJPA 9GSSA 5KOXA 3V1WA 1DE1A 3ZMKA 3D0ZA 4JBBA 12GSA 4MF5A 3KM6A 4XS1A 3UARA 2B7KA 4X1UA 4PNGA 1T7PB 2OE0A 4ISDA 2VL2C 5FHIA 2B5YA 5DAKB 1G6YA 1R5AA 3CSHA 2ES7A 4ZXGA 2MBTA 1PQNA 3IK7A 3CRTA 4Z7XA 1V58A 5KN3A 4USSA 5KEJA 1ILOA 3A3TA 3DXBA 4I2TA 5F0GA 1K0DA 5D8IA 4WR5A 4HUAA 5G30A 4V2LA 3IV4A 2QC7A 2YP6A 1FOHA 4KDYA 3C1RA 3TKRA 2CA8A 3F63A 3EURA 3QDNA 3A2VA 3VURA 3DRNA 4IJIA 3TCOA 1O81A 2HSHA 1KEBA 2HZEB 3M3MA 2C3QA 5ECKB 3C1SA 1T3BA 3KIJA 4HU9A 5HQPA 2HNLA 17GSA 3L4NA 2O89A 5BMUA 1GSQA 3F9UA 13GSA 6GSSA 2H19A 3RAZA 4AGSA 4KX4A 2VCZA 1GWCA 2DC5A 4WEYA 2HXKA 4EDZA 5DALB 4JU5A 5D93A 3QCPA 3RBTA 3ISOA 4GWRA 2PGTA 3RHCA 4YKGA 3APQA 1TK5B 1G7OA 4G0KA 1KNGA 1URMA 3ERGA 2DIYA 2FWFA 2H30A 3WGXA 4N0VA 1XW5A 3A2WA 2VL3A 1B4PA 4N10A 4F0CA 4MMMA 3EWLA 3CSIA 2K18A 2YJHA 4J2FA 3DMLA 1FO5A 1AIUA 3CSJA 5FT3A 5ECQB 2KHPA 6GSTA 3ZMLA 4KAEA 3GTUA 3TKPA 4E8HA 1AQWA 2PWJA 4MH3A 3W8SA 2B1KA 2PERA 1XXUA 4ILFA 4FYUA 7GSSA 1PN0A 4IJ3A 5J41A 5GAPD 3GN3A 4ZL9A 1Y25A 2V32A 3KJYA 4KDUA 3PGTA 3FR6A 4POMA 2GS3A 2XC2A 2XPEA 2J9HA 4BVYA 2CV4A 2H1DA 3GIXA 3S9FA 3FZ4A 4K6XA 4GSNA 1USBA 1GSUA 2VM2A 5DAKA 2CAIA 5JWOB 1V40A 2KP1A 1SL1B 1X5CA 4MF7A 5LNKe 2V41A 1K3YA 3L9SA 5AIVA 3WGDA 4O7HA 1K0NA 1XCCA 1I9DA 14GSA 3D5JA 2B1LA 4AF2A 2OBKA 2MZCA 3CTFA 5GSTA 2E7PA 4N0ZA 4QL7A 4HJMA 3SBCA 1F3AA 1CQHA 4DSQA 3KMOA 1EWXA 4IBPA 4ULXA 1NM3A 1A8LA 1F37A 1ERWA 3HJMA 2HSMA 4K2DA 4NXIA 1RK4A 3DGQA 4PX1A 4E8EA 2GVPA 3HY2A 3MNGA 3TOTA 2F8AA 3TRQA 1V98A 2PN8A 5DQYA 5IMCA 2TRXA 2QGVA 2VO4A 4TR0A 1TK8B 2A4VA 1X5DA 2K9FA 5DALA 1H4OA 4IP6A 2D2ZA 4IQ1A 1YKCA 1BG5A 1FB6A 1XZOA 3ZIVA 4IQAA 2VL2A 3I6AA 3WT1A 2NDOA 1K0BA 5CAXA 3E3EA 1B4QA 3FZ9A 2XHFA 3IK9A 2FY6A 1EEMA 3WGEA 4XRAA 3UEMA 2OE3A 1TW9A 1Z3EA 2CZ2A 3TJBA 1SD8A 3MSZA 2YNXA 5IMVA 2A4HA 4KDXA 5G1LA 4TR1A 2HE3A 4OO5A 4POLA 4EVMA 3EPTA 1SJ6A 4F03A 2H6YA 1ZYQB 4HS1A 5KN0A 4L5OA 5CRWA 5ECHB 2YWMA 3HVNA 4Q5RA 4KUNA 3FZAA 3C71A 1IYIA 4HU7A 1OE7A 2MMOA 2LQQA 4YAPA 5G2ZA 3IAM2 5DQSA 1JHBA 3DKSA 3LORA 2V1MA 2DLXA 1QUWA 5E4WA 4ZIJA 4ML1A 1O8WA 1E6BA 2B3SA 3Q74A 2QSIA 5L71A 4PTSA 2AJQB 1TDIA 2X8CA 1C72A 1T00A 2H75A 4TOPA 3O6TA 2R5GA 3UJ1A 1GH2A 4MPGA 1YQ1A 2IMDA 5DBQA 4ACSA 1SYXA 16GSA 1BQ7A 1PA3A 3C73A 2GGTA 1VF4A 4EIPA 4YQVA 2B5EA 4NMUA 3HZ4A 2CAQA 2MMZA 4K7NA 1HNCA 1O85A 2CVDA 4O5RA 1XIYA 3GX0A 5F8BA 4F9ZA 2FUG2 4RQRA 3GUSA 3VPTA 1SJIA 2IN3A 3F3QA 1GUHA 5ECNB 5IMAA 3FRCA 4K7IA 4TN8A 1THOA 1SKWB 1XPVA 1A2JA 3ME7A 1RQMA 3RHBA 5D96A 1MTCA 4XS6A 2CVKA 2IL3A 2GDRA 3GFKA 2AHEA 4GTUA 1EOHA 1GNWA 4K5RA 4KB3A 3H8QA 4BPYA 5ECRB 1MEKA 1M2DA 4EF0A 1Z9HA 2FWHA 1YF1A 2GSSA 2HSYA 2L6CA 3UMAA 2OADA 2GLRA 4NV5A 4Z2TA 4EKZA 2O87A 1X5EA 5ECIB 3GKXA 3KTBA 2N5AA 1AC1A 1XOBA 3FMWA 4WF5A 2QKEA 1U88A 1TU7A 2O8VB 2LKUA 5BRTA 1JZOA 3TJKA 4G2EA 4YKFA 4FIWA 4DSSA 1A2MA 4OMVA 1YDKA 3FEUA 1T1VA 3G7IA 2C3TA 3HZ8A 1M9BA 3D4TA 1SU9A 1OE8A 3LEFA 3IBHA 4ID0A 1FB0A 1VGLA 1EP8A 3J7Yk 1GSDA 3GTUB 4LLRA 5CRDA 1PGTA 1BX9A 2X64A 2YOIA 5F06A 5DCGA 5HFGA 4ZB8A 2LNTA 4IVFA 4RI6A 4ZILA 3F4RA 1GUMA 4NV2A 2C1YA 2H01A 1GL8A 2J23A 4Q5NA 3LG6A 2WB9A 3VLNA 2R0GA 2F8FA 1YF0A 2PPTA 3GH6A 1CQGA 2C4JA 5GZZB 3IC4A 2JZSA 4BVYB 5KOWA 1UVZA 1QMVA 2JZTA 1TJDA 2C8UA 4OO4A 3JCML 2H76A 1AQXA 2PU9C 1J0FA 4RQXA 1T8EB 2H74A 1XG8A 4ZB9A 2FHEA 2LRNA 3UAPA 1YKAA 5ID2A 4YQUA 1J08A 1PN9A 1O7UA 3LYPA 4HZ4A 1FAAA 1R26A 4GF0A 2GTUA 1UA5A 1WP0A 1XWGA 1JZRA 4IELA 5B8AA 4L0UA 1WE0A 2H1GA 1Y6EA 2VCVA 5EL8A 2ZNMA 5GAND 2V6KA 4MJAA 4L5LA 2LSTA 4WBRD 5JCGA 4IS0A 5FWGA 4GQCA 4WKWA 2EIQA 5G1KA 4YH2A 2LUSA 4EXJA 3R2QA 1EGOA 4NHZA 2YJ7A 1Q4JA 2EC4A 3QOUA 2DJJA 2R2JA 1JFUA 2CQ9A 5ELAA 2R0CA 1GRXA 5H5SA 1K3OA 5DJLA 4OWYA 3IA1A 4YAVA 3E0UA 4ZL8A 2HLSA 2GQKA 3H79A 2K8SA 2H0IA 5IIZA 1LJRA 3UL3A 5AIXA 2DJ1A 1EEJA 3VWWA 5J9BA 3ED3A 4EC0A 1XWKA 5ECMB 1M3JA 3HA9A 3Q18A 2Z9SA 3GYKA 1JLWA 2V6OA 4JRRA 5ELGA 4LL4B 4TR1B 1A24A 3LSZA 2YCDA 2VM1A 4KSMA 1WIKA 3GH9A 4K1FA 3GV1A 3M0FA 5J9CA 3IDVA 1V57A 20GSA 2IIYA 1B8XA 2X8GA 1EV9A 4Z2UA 5CNWA 2L57A 1H75A 1TK0B 1WJKA 4PURA 3QAWA 2VOCA 4OCEA 1ZL9A 5A5KA 1F3BA 2FCHA 1XW6A 2YWOA 1M7TA 1XW9A 4PXOA 2NTOA 4PQIA 1U87A 1R7HA 5B7CA 2VD0A 4TXVA 2WCIA 1SJZA 1LBKA 2GSTA 1A23A 2CT6A 2VCXA 3L9UA 4MJCA 5B6NA 1FHEA 1Q98A 2AB6A 1UN2A 1KBNA 2B6MA 4HJ2A 2EIOA 1TRWA 3KH9A 4G10A 3L9VA 5E59A 1ZZYA 5D9VA 1G7EA 5CRHA 3IHGA 3KP9A 3ZZXA 2IMIA 6GSXA 2NBSA 4HEA2 2FLSA 3TB2A 5B6MA 3GL3A 2N5FA 1B48A 5IOWA 2LV3A 2LRCA 4JR4A 4TR3A 2A2RA 3ERFA 1SK2A 1ACVA 3TDGA 2YV7A 2CX3A 1GSSA 4HSCX 2KOKA 4KF9A 5LCZA 1A8YA 2K6VA 1TOFA 5D9TA 4BIKA 2JZRA 1X9WB 5EY6A 1FVJA 3VWVA 4XTSA 1WMJA 1AXDA 2FD3A 5J3RA 1R4WA 3GRXA 1E2YA 2VCWA 2F51A 5IOXA 3F4TA 4FH8A 3ZYWA 3HDCA 2HFDA 1TI1A 3IC8A 4WXTA 2RM6A 3HVVA 5CP1A 4MABA 1S3RA 1PD21 5ABRA 3ZIJA 1S3DA 4TXOA 1WOUA 1YZXA 2FWEA 4F2IA 1YY7A 3G7YA 3P90A 3H4KA 1AQVA 2AUVA 4HOJA 2WRTA 4DSSB 1BEDA 4IW9A 1Z5YE 2H8LA 3US3A 3EINA 2PVOC 5A4VA 4HDEA 4MZWA 1ZCPA 4AJ7A 1K0MA 3BOAA 4MK3A 1XVQA 2XPDA 22GSA 5ENUA 3KP8A 5HFIA 5IMDA 3MDKA 3RPNA 2V2GA 3ZLPA 4POBA 2DMMA 1PMTA 4A5PA 5CYYA 2HRFA 1PSQA 4G0LA 4WF4A 5F05A 3QFBC 2RM5A 2VLVA 1A2LA 2YPMA 3L0HA 3LWAA 1OC9A 2LTKA 2L5LA 3C8EA 5JCWA 3UVHA 1TU8A 2LS5A 1GTUA 3QR6A 3F3RA 3EE2A 2IWTA 2C80A 3LJRA 4ZBBA 4Q5FA 4MLYA 3HVSA 4K5SA 4ZL7A 3ZVJA 2LEGA 3EVIA 4V1Ap 5ECOB 1SD9A 2YWIA 3DYRA 4BL7A 3HD5A 2GZPA 2H0GA 1BAYA 5AISA 1O6JA 4EIQA 2I81A 5IMFA 2NPBA 2GZYA 3QMXA 2LQOA 3HVXA 1XWBA 4OFTA 1SENA 3LXTA 5ID2B 19GSA 4CW9A 2H1AA 4MZCA 3GKKA 3TKSC 1GUKA 3UBKA 1GSFA 2H6XA 4X4JA 1SL2B 3WT2A 3GSTA 1PKZA 2CZ3A 4BVXA 4FO5A 2I4AA 4I8BA 3QD9A 4WR4A 1WRYA 1SKSB 3M9JA 1WPIA 3SWLA 3IXRA 6GSVA 4G0IA 3WD6A 3NOFA 1EGRA 1EV4A 1QK8A 3DD3A 2GSQA 1QGVA 2P0GA 4MPFA 2DMLA 2E0QA 3KMNA 5A4UA 3KTLA 4JE1A 1OYJA 4TRXA 5C00A 3H93A 1TP9A 4NWYA 4XHMA 3UOMA 3ZRDA 3FKFA 1FOVA 2VL9A 2WFCA 1OKDA 1HNAA 1AAZA 5G5EA 1DUGA 4EUYA 2AAWA 1DSBA 3P2AA 1SK1A 2JADA 4K0GA 2DKHA 3RDWA 4I2UA 4EDYA 1O8XA 3KEBA 2GQMA 1HD2A 3GNJA 1SL0B 2LJKA 4POKA 2TIRA 1K0OA 1VF3A 3LFLA 3ZFLA 4MDCA 3BBYA 3BJ5A 3KCMA 5F07A 2RUEA 1EP7A 4IN0A 3F6DA 2M46A 1QFNA 1TRSA 4PNFA 5JCUA 4G9HA 1I5GA 2YWNA 1TTZA 2R37A 1U6TA 1R5PA 1DE2A 4K0NA 4LA1A 18GSA 1F9MA 4JZQA 3IAS2 4V2NA 4ECJA 2O7KA 4X0XA 4H86A 2VAFA 3PPUA 2OJLA 2OBIA 2CX4A 1MDIA 1BJXA 2H70A 1BYEA 3GURA 3GKNA 4KNDA 3A2XA 2N5BA 4TW5A 4I97A 3N5OA 5J4UA 3IE3A 4HQZA 4FQUA 2UZ8A 4DEJA 4LMWA 1JLVA 4HQSA 4XIHA 2DIZA 1YJ6A 2HI7A 1TRVA 5D9WA 2OA7A 2I1UA 2JACA 2H0HA 1M99A 3IPZA 2ALBA 3MAKA 1QXHA 1VF1A 2VUPA 4CY8A 3D21A 3FR9A 3G7JA 3VWXA 5EVOA 4CHSA 3CBUA 2ZCTA 3J7Yb 4GCIA 4NAXA 1TI3A 2F9SA 3QFAC 4CDOA 3HCZA 3RPPA 3L78A 3KZQA 3C7MA 2REMA 2LJRA 1AUCA 1ERVA 5CREA 2B7JA 1GTAA 4Q5QA 2BTOT 3EMPA 3UIWA 2IMEA 4O92A 2HZFA 4GLTA 4GXZA 2XBQA 2FA4A 2DKIA 4GSTA 4ECIA 2OKAA 5HR2A 3M9KA 1ZYPA 2YN1A 4AJ8A 1XWAA 6GSUA 4D73A 3EMXA 3M8NA 1Z6MA 1K0CA 4K2XA 4X43A 2HRKA 4KE3A 5DJMA 3KD0A 4CY6A 3W8JA 5CO3A 4K9ZA 4TXOB 2MYGA 4ICYA 2X99A 4MP4A 4I5QA 4KH7A 1U3AA 2P5RA 4HI7A 1K3LA 4RUVA 4WETA 3NIVA 1THXA 5HR0A 4KW6A 4XCSA 4MF6A 5LD0A 3E9JB 4BWSA 3K8NA 4N30A 3HKRA 2JSZA 4LMVA 3DVXA 5DCHA 1N2AA 2BJXA 2H73A 4OCFA 1XVWA 2O85A 1ERTA 4MZBA 4PUAA 4TKYA 1M3IA 2C0GA 1G6WA 2M72A 3TKSA 2IMFA 1PKWA 1YEXA 2DJKA 3ZFBA 1GTBA 4ZBAA 1IYHA 5G5FA 3BD2A 4BA7A 1U3IA 4XRDA 2X8HA 1OC8A 2HT9A 1XFLA 2L5OA 2MMNA 3GSSA 3U6VA 2IFQA 1G0TA 4K8MA 4J57E 1OC9B 1Z7PA 2GQLA 2LJAA 2YZHA 3CXGA 3I69A 5AGYA 1EOGA 1TRUA 3ME8A 1M2AA 1GSEA 3CTGA 4OD7A 2FWGA 3O3TA 1GLPA 1Z6NA 3ZITA 4PUFC 3TJFA 5COHA 2GZZA 3IR4A 4GSSA 3EU3A 4J56E 2VIMA 1GNEA 4BL7B 5GSSA 4P3YB 2JU5A 2DJ2A 2WGRA 4NPBA 3UVTA 1PL1A 3QAVA 2PVQA 2RUFA 1K0AA 2H1BA 3QPMA 5D9XA 4HZ2A 4BWQA 5IO0A 5G31A 2FA8A 3OR5A 4YQMA 3ZTLA 2H66A 1ZGNA 1JZWA 2WS2A 2HRAA 2PBJA 3IHQA 2AV4A 4ZBDA 2CVBA 1O73A 1ABAA 3MIXA 4WBJA 2VD1A 3D22A 3TKSE 4GRFA 1YEPA 1A0RP 3LXZA 1X9SB 3GL5A 5IO2A 2GT5A 4BVXB 2I3YA 2LRTA 3MYDA 3LGCA 3FR3A 1PL2A 4IP1A 1T4ZA 3PH9A 3P7XA 1S3CA 1OVNA 3HYPA 5IM9A 1DBYA 1OKTA 3KXOA 1GULA 2LNSA 2R4VA 4XS4B 3APOA 4ECCA 3N9JA 3A5IA 4PQHA 2KP2A 6GSWA 1PX7A 4Z2RA 1NSWA 2L59A 3A5WA 1T4YA 2YZUA 4EL1A 4N11A 4TVEA 2MMAA 3FYGA 1N8JA 2HZEA 2VCTA 2R0PA 5ECLB 2XBIA 4DVCA 5IMZA 3HJOA 1TKDB 3BCIA 1SYRA 5H5QA 1GSYA 3F4SA 2G2QA 3KGKA 3VFIA 1GTIA 1NW2A 3AY8A 3W6GA 1FG4A 1WWJA 1PFOA 2EIRA 4RI7A 1SKRB 1NHOA 1V9WA 4AJ6A 2C0FA 5KN1A 2FNOA 3TRXA 1MDKA 1XWCA 1ML6A 1NHYA 2X49A 4MCUA 3GKMA 3TKQA 4NHWA 3Q19A 4KCEA 2TRCP 2WDUA 1M0UA 2IJYA 3FHKA 1F6MC 1FW1A 2KUCA 2FGXA 4JR6A 1MD3A 1SK0A 2OE1A 2RLIA 3GX8A 2VCQA 2L6DA 2YANA 2WJUA 3GMFA 4O32A 1ZOFA 4EO3A 2IMKA 1EZKA 5HR1A 2DBCA 3APSA 5HFKA 4QQ7A 2C3NA 2X4AA
chains in the Genus database with same CATH topology
4MA9A 2RIIA 2R3XA 4PGTA 2I9HA 2JSYA 2HYXA 3ZL5A 3HHVA 4DSRA 2B5XA 1A0FA 1KTEA 2M80A 5INYA 2DJ0A 2VLTA 2HRNA 3U5RE 4OFNA 4G19A 3VI5A 4KA0A 3I9V2 2H6ZA 2E2MA 3F0IA 3O76A 5CRGA 1XOAA 1S3AA 5JWRB 1F2EA 3ZVJD 4IGJA 4OFMA 4O5UA 5ECSA 1ERUA 3VK9A 1MD4A 1X0RA 5DDLA 1XBSA 3FW2A 4I6XA 10GSA 4KSOA 2G0FA 3FY7A 3BCKA 2L4QA 1UC7A 3PR8A 4F0BA 4EE0A 1ZYEA 3EC3A 1M9AA 4V1Ag 3LYKA 5IPHA 3ERWA 3Q6OA 1FVKA 2MBSA 4ML6A 3VPQA 1X9MB 2E2GA 2K8VA 4F82A 3CYNA 1B9YC 3TJJA 4O5QA 1W89A 3ZREA 4MJBA 4L8EA 2WZ9A 2PUKC 5C04A 1TXXA 3EYTA 2C0EA 3TOUA 3LQ7A 4L0WA 3DEXA 3I43A 2DSAA 3R3EA 2VLUA 1M2BA 5A4WA 1VF2A 4ZB6A 4XS4A 3MWHA 1AW9A 3FK8A 2AYTA 2ON5A 1ON4A 3CRUA 3NZNA 4D73B 4FYCA 3TGZA 2BMXA 4K7OA 2L4CA 4FYBA 4MNNA 1Z7RA 4JEDA 3M1GA 5ECPB 5JWQB 5IPGA 5HR3A 3UBLA 2A2SA 3TJGA 2OACA 2H71A 2A2PA 2JL4A 2YV9A 3VWUA 1GLQA 2ZUPA 5AN1A 5H5RA 3KH7A 3TUEA 1ZMAA 5EPFA 3G9BA 6GSYA 1W4VA 3DIEA 2IPAA 2P31A 2P5QA 1RW1A 4IHUA 4MJEA 1B9XC 5D73A 1ZYNA 4PQ1A 3GHAA 3H1NA 4KGIA 4LL1B 3TRPA 2KLXA 1ST9A 4GQFA 1HYUA 3LW9A 8GSSA 3D6IA 1VRSD 1OAZA 2C0DA 1HNBA 4KCAA 1MDJA 3IRAA 3FZ5A 1GP1A 2R6KA 11GSA 2GSRA 3CMIA 3PINA 2QA1A 2GT6A 4ECBA 1HQOA 3WYWA 3EU4A 3DVWA 2IFQB 3F8UA 5KN2A 1J9BA 3D4MA 3IOSA 4TR4A 3HXSA 4QL9A 2QA2A 3DWVA 1PRXA 4V2MA 1QQ2A 1LU4A 2WULA 4MH2A 5B8BA 2H72A 5DVBA 1JZDA 2ON7A 4IKHA 3VI7A 2DJ3A 5IQYA 2F3MA 3GA4A 2NVLA 3F6FA 3P8WA 1PX6A 1OC3A 5J5NA 2PMTA 1V2AA 3QAGA 3HJPA 9GSSA 5KOXA 3V1WA 1DE1A 3ZMKA 3D0ZA 4JBBA 12GSA 4MF5A 3KM6A 4XS1A 3UARA 2B7KA 4X1UA 4PNGA 1T7PB 2OE0A 4ISDA 2VL2C 5FHIA 2B5YA 5DAKB 1G6YA 1R5AA 3CSHA 2ES7A 4ZXGA 2MBTA 1PQNA 3IK7A 3CRTA 4Z7XA 1V58A 5KN3A 4USSA 5KEJA 1ILOA 3A3TA 3DXBA 4I2TA 5F0GA 1K0DA 5D8IA 4WR5A 4HUAA 5G30A 4V2LA 3IV4A 2QC7A 2YP6A 1FOHA 4KDYA 3C1RA 3TKRA 2CA8A 3F63A 3EURA 3QDNA 3A2VA 3VURA 3DRNA 4IJIA 3TCOA 1O81A 2HSHA 1KEBA 2HZEB 3M3MA 2C3QA 5ECKB 3C1SA 1T3BA 3KIJA 4HU9A 5HQPA 2HNLA 17GSA 3L4NA 2O89A 5BMUA 1GSQA 3F9UA 13GSA 6GSSA 2H19A 3RAZA 4AGSA 4KX4A 2VCZA 1GWCA 2DC5A 4WEYA 2HXKA 4EDZA 5DALB 4JU5A 5D93A 3QCPA 3RBTA 3ISOA 4GWRA 2PGTA 3RHCA 4YKGA 3APQA 1TK5B 1G7OA 4G0KA 1KNGA 1URMA 3ERGA 2DIYA 2FWFA 2H30A 3WGXA 4N0VA 1XW5A 3A2WA 2VL3A 1B4PA 4N10A 4F0CA 4MMMA 3EWLA 3CSIA 2K18A 2YJHA 4J2FA 3DMLA 1FO5A 1AIUA 3CSJA 5FT3A 5ECQB 2KHPA 6GSTA 3ZMLA 4KAEA 3GTUA 3TKPA 4E8HA 1AQWA 2PWJA 4MH3A 3W8SA 2B1KA 2PERA 1XXUA 4ILFA 4FYUA 7GSSA 1PN0A 4IJ3A 5J41A 5GAPD 3GN3A 4ZL9A 1Y25A 2V32A 3KJYA 4KDUA 3PGTA 3FR6A 4POMA 2GS3A 2XC2A 2XPEA 2J9HA 4BVYA 2CV4A 2H1DA 3GIXA 3S9FA 3FZ4A 4K6XA 4GSNA 1USBA 1GSUA 2VM2A 5DAKA 2CAIA 5JWOB 1V40A 2KP1A 1SL1B 1X5CA 4MF7A 5LNKe 2V41A 1K3YA 3L9SA 5AIVA 3WGDA 4O7HA 1K0NA 1XCCA 1I9DA 14GSA 3D5JA 2B1LA 4AF2A 2OBKA 2MZCA 3CTFA 5GSTA 2E7PA 4N0ZA 4QL7A 4HJMA 3SBCA 1F3AA 1CQHA 4DSQA 3KMOA 1EWXA 4IBPA 4ULXA 1NM3A 1A8LA 1F37A 1ERWA 3HJMA 2HSMA 4K2DA 4NXIA 1RK4A 3DGQA 4PX1A 4E8EA 2GVPA 3HY2A 3MNGA 3TOTA 2F8AA 3TRQA 1V98A 2PN8A 5DQYA 5IMCA 2TRXA 2QGVA 2VO4A 4TR0A 1TK8B 2A4VA 1X5DA 2K9FA 5DALA 1H4OA 4IP6A 2D2ZA 4IQ1A 1YKCA 1BG5A 1FB6A 1XZOA 3ZIVA 4IQAA 2VL2A 3I6AA 3WT1A 2NDOA 1K0BA 5CAXA 3E3EA 1B4QA 3FZ9A 2XHFA 3IK9A 2FY6A 1EEMA 3WGEA 4XRAA 3UEMA 2OE3A 1TW9A 1Z3EA 2CZ2A 3TJBA 1SD8A 3MSZA 2YNXA 5IMVA 2A4HA 4KDXA 5G1LA 4TR1A 2HE3A 4OO5A 4POLA 4EVMA 3EPTA 1SJ6A 4F03A 2H6YA 1ZYQB 4HS1A 5KN0A 4L5OA 5CRWA 5ECHB 2YWMA 4Q5RA 4KUNA 3FZAA 3C71A 1IYIA 4HU7A 1OE7A 2MMOA 2LQQA 4YAPA 5G2ZA 3IAM2 5DQSA 1JHBA 3DKSA 3LORA 2V1MA 2DLXA 1QUWA 5E4WA 4ZIJA 4ML1A 1O8WA 1E6BA 2B3SA 3Q74A 2QSIA 5L71A 4PTSA 2AJQB 1TDIA 2X8CA 1C72A 1T00A 2H75A 4TOPA 3O6TA 2R5GA 3UJ1A 1GH2A 4MPGA 1YQ1A 2IMDA 5DBQA 4ACSA 1SYXA 16GSA 1BQ7A 1PA3A 3C73A 2GGTA 1VF4A 4EIPA 4YQVA 2B5EA 4NMUA 3HZ4A 2CAQA 2MMZA 4K7NA 1HNCA 1O85A 2CVDA 4O5RA 1XIYA 3GX0A 5F8BA 4F9ZA 2FUG2 4RQRA 3GUSA 3VPTA 1SJIA 2IN3A 3F3QA 1GUHA 5ECNB 5IMAA 3FRCA 4K7IA 4TN8A 1THOA 1SKWB 1XPVA 1A2JA 3ME7A 1RQMA 3RHBA 5D96A 1MTCA 4XS6A 2CVKA 2IL3A 2GDRA 3GFKA 2AHEA 4GTUA 1EOHA 1GNWA 4K5RA 4KB3A 3H8QA 4BPYA 5ECRB 1MEKA 1M2DA 4EF0A 1Z9HA 2FWHA 1YF1A 2GSSA 2HSYA 2L6CA 3UMAA 2OADA 2GLRA 4NV5A 4Z2TA 4EKZA 2O87A 1X5EA 5ECIB 3GKXA 3KTBA 2N5AA 1AC1A 1XOBA 3FMWA 4WF5A 2QKEA 1U88A 1TU7A 2O8VB 2LKUA 5BRTA 1JZOA 3TJKA 4G2EA 4YKFA 4FIWA 4DSSA 1A2MA 4OMVA 1YDKA 3FEUA 1T1VA 3G7IA 2C3TA 3HZ8A 1M9BA 3D4TA 1SU9A 1OE8A 3LEFA 3IBHA 4ID0A 1FB0A 1VGLA 1EP8A 3J7Yk 1GSDA 3GTUB 4LLRA 5CRDA 1PGTA 1BX9A 2X64A 2YOIA 5F06A 5DCGA 5HFGA 4ZB8A 2LNTA 4IVFA 4RI6A 4ZILA 3F4RA 1GUMA 4NV2A 2C1YA 2H01A 1GL8A 2J23A 4Q5NA 3LG6A 2WB9A 3VLNA 2R0GA 2F8FA 1YF0A 2PPTA 3GH6A 1CQGA 2C4JA 5GZZB 3IC4A 2JZSA 4BVYB 5KOWA 1UVZA 1QMVA 2JZTA 1TJDA 2C8UA 4OO4A 3JCML 2H76A 1AQXA 2PU9C 1J0FA 4RQXA 1T8EB 2H74A 4ZB9A 2FHEA 2LRNA 3UAPA 1YKAA 5ID2A 4YQUA 1J08A 1PN9A 1O7UA 3LYPA 4HZ4A 1FAAA 1R26A 4GF0A 2GTUA 1UA5A 1WP0A 1XWGA 1JZRA 4IELA 5B8AA 4L0UA 1WE0A 2H1GA 1Y6EA 2VCVA 5EL8A 2ZNMA 5GAND 2V6KA 4MJAA 4L5LA 2LSTA 4WBRD 5JCGA 4IS0A 5FWGA 4GQCA 4WKWA 2EIQA 5G1KA 4YH2A 2LUSA 4EXJA 3R2QA 1EGOA 4NHZA 2YJ7A 1Q4JA 2EC4A 3QOUA 2DJJA 2R2JA 1JFUA 2CQ9A 5ELAA 2R0CA 1GRXA 5H5SA 1K3OA 5DJLA 4OWYA 3IA1A 4YAVA 3E0UA 4ZL8A 2HLSA 2GQKA 3H79A 2K8SA 2H0IA 5IIZA 1LJRA 3UL3A 5AIXA 2DJ1A 1EEJA 3VWWA 5J9BA 3ED3A 4EC0A 1XWKA 5ECMB 3HA9A 3Q18A 2Z9SA 3GYKA 1JLWA 2V6OA 4JRRA 5ELGA 4LL4B 4TR1B 1A24A 3LSZA 2YCDA 2VM1A 4KSMA 1WIKA 3GH9A 4K1FA 3GV1A 3M0FA 5J9CA 3IDVA 1V57A 20GSA 2IIYA 1B8XA 2X8GA 1EV9A 4Z2UA 5CNWA 2L57A 1H75A 1TK0B 1WJKA 4PURA 3QAWA 2VOCA 4OCEA 1ZL9A 5A5KA 1F3BA 2FCHA 1XW6A 2YWOA 1M7TA 1XW9A 4PXOA 2NTOA 4PQIA 1U87A 1R7HA 5B7CA 2VD0A 4TXVA 2WCIA 1SJZA 1LBKA 2GSTA 1A23A 2CT6A 2VCXA 3L9UA 4MJCA 5B6NA 1FHEA 1Q98A 2AB6A 1UN2A 1KBNA 2B6MA 4HJ2A 2EIOA 1TRWA 3KH9A 4G10A 3L9VA 5E59A 1ZZYA 5D9VA 1G7EA 5CRHA 3IHGA 3KP9A 3ZZXA 2IMIA 6GSXA 2NBSA 4HEA2 2FLSA 3TB2A 5B6MA 3GL3A 2N5FA 1B48A 5IOWA 2LV3A 2LRCA 4JR4A 4TR3A 2A2RA 3ERFA 1SK2A 1ACVA 3TDGA 2YV7A 2CX3A 1GSSA 2KOKA 4KF9A 5LCZA 1A8YA 2K6VA 1TOFA 5D9TA 2JZRA 1X9WB 5EY6A 1FVJA 3VWVA 4XTSA 1WMJA 1AXDA 2FD3A 5J3RA 1R4WA 3GRXA 1E2YA 2VCWA 2F51A 5IOXA 3F4TA 4FH8A 3ZYWA 3HDCA 2HFDA 1TI1A 3IC8A 4WXTA 2RM6A 3HVVA 5CP1A 4MABA 1PD21 5ABRA 3ZIJA 1S3DA 4TXOA 1WOUA 1YZXA 2FWEA 4F2IA 1YY7A 3G7YA 3P90A 3H4KA 1AQVA 2AUVA 4HOJA 2WRTA 4DSSB 1BEDA 4IW9A 1Z5YE 2H8LA 3US3A 3EINA 2PVOC 5A4VA 4HDEA 4MZWA 1ZCPA 4AJ7A 1K0MA 3BOAA 4MK3A 1XVQA 2XPDA 22GSA 5ENUA 3KP8A 5HFIA 5IMDA 3MDKA 3RPNA 2V2GA 3ZLPA 4POBA 2DMMA 1PMTA 4A5PA 5CYYA 2HRFA 1PSQA 4G0LA 4WF4A 5F05A 3QFBC 2RM5A 2VLVA 1A2LA 2YPMA 3L0HA 3LWAA 1OC9A 2LTKA 2L5LA 3C8EA 5JCWA 3UVHA 1TU8A 2LS5A 1GTUA 3QR6A 3F3RA 3EE2A 2IWTA 2C80A 3LJRA 4ZBBA 4Q5FA 4MLYA 3HVSA 4K5SA 4ZL7A 3ZVJA 2LEGA 3EVIA 4V1Ap 5ECOB 1SD9A 2YWIA 3DYRA 4BL7A 3HD5A 2GZPA 2H0GA 1BAYA 5AISA 1O6JA 4EIQA 2I81A 5IMFA 2NPBA 2GZYA 3QMXA 2LQOA 3HVXA 1XWBA 4OFTA 1SENA 3LXTA 5ID2B 19GSA 4CW9A 2H1AA 4MZCA 3GKKA 3TKSC 1GUKA 3UBKA 1GSFA 2H6XA 4X4JA 1SL2B 3WT2A 3GSTA 1PKZA 2CZ3A 4BVXA 4FO5A 2I4AA 4I8BA 3QD9A 4WR4A 1WRYA 1SKSB 3M9JA 1WPIA 3SWLA 3IXRA 6GSVA 4G0IA 3WD6A 3NOFA 1EGRA 1EV4A 1QK8A 3DD3A 2GSQA 1QGVA 2P0GA 4MPFA 2DMLA 2E0QA 3KMNA 5A4UA 3KTLA 4JE1A 1OYJA 4TRXA 5C00A 3H93A 1TP9A 4NWYA 4XHMA 3UOMA 3ZRDA 3FKFA 1FOVA 2VL9A 2WFCA 1OKDA 1HNAA 1AAZA 5G5EA 1DUGA 4EUYA 2AAWA 1DSBA 3P2AA 1SK1A 2JADA 4K0GA 2DKHA 3RDWA 4I2UA 4EDYA 1O8XA 3KEBA 2GQMA 1HD2A 3GNJA 1SL0B 2LJKA 4POKA 2TIRA 1K0OA 1VF3A 3LFLA 3ZFLA 4MDCA 3BBYA 3BJ5A 3KCMA 5F07A 2RUEA 1EP7A 4IN0A 3F6DA 2M46A 1QFNA 1TRSA 4PNFA 5JCUA 4G9HA 1I5GA 2YWNA 1TTZA 2R37A 1U6TA 1R5PA 1DE2A 4K0NA 4LA1A 18GSA 1F9MA 4JZQA 3IAS2 4V2NA 4ECJA 2O7KA 4X0XA 4H86A 2VAFA 3PPUA 2OJLA 2OBIA 2CX4A 1MDIA 1BJXA 2H70A 1BYEA 3GURA 3GKNA 4KNDA 3A2XA 2N5BA 4TW5A 4I97A 3N5OA 5J4UA 3IE3A 4HQZA 4FQUA 2UZ8A 4DEJA 4LMWA 1JLVA 4HQSA 4XIHA 2DIZA 1YJ6A 2HI7A 1TRVA 5D9WA 2OA7A 2I1UA 2JACA 2H0HA 1M99A 3IPZA 2ALBA 3MAKA 1QXHA 1VF1A 2VUPA 4CY8A 3D21A 3FR9A 3G7JA 3VWXA 5EVOA 4CHSA 3CBUA 2ZCTA 3J7Yb 4GCIA 4NAXA 1TI3A 2F9SA 3QFAC 4CDOA 3HCZA 3RPPA 3L78A 3KZQA 3C7MA 2REMA 2LJRA 1AUCA 1ERVA 5CREA 2B7JA 1GTAA 4Q5QA 2BTOT 3EMPA 3UIWA 2IMEA 4O92A 2HZFA 4GLTA 4GXZA 2XBQA 2FA4A 2DKIA 4GSTA 4ECIA 2OKAA 5HR2A 3M9KA 1ZYPA 2YN1A 4AJ8A 1XWAA 6GSUA 4D73A 3EMXA 3M8NA 1Z6MA 1K0CA 4K2XA 4X43A 2HRKA 4KE3A 5DJMA 3KD0A 4CY6A 3W8JA 5CO3A 4K9ZA 4TXOB 2MYGA 4ICYA 2X99A 4MP4A 4I5QA 4KH7A 1U3AA 2P5RA 4HI7A 1K3LA 4RUVA 4WETA 3NIVA 1THXA 5HR0A 4KW6A 4XCSA 4MF6A 5LD0A 3E9JB 4BWSA 3K8NA 4N30A 3HKRA 2JSZA 4LMVA 3DVXA 5DCHA 1N2AA 2BJXA 2H73A 4OCFA 1XVWA 2O85A 1ERTA 4MZBA 4PUAA 4TKYA 2C0GA 1G6WA 2M72A 3TKSA 2IMFA 1PKWA 1YEXA 2DJKA 3ZFBA 1GTBA 4ZBAA 1IYHA 5G5FA 3BD2A 4BA7A 1U3IA 4XRDA 2X8HA 1OC8A 2HT9A 1XFLA 2L5OA 2MMNA 3GSSA 3U6VA 2IFQA 1G0TA 4K8MA 4J57E 1OC9B 1Z7PA 2GQLA 2LJAA 2YZHA 3CXGA 3I69A 5AGYA 1EOGA 1TRUA 3ME8A 1M2AA 1GSEA 3CTGA 4OD7A 2FWGA 3O3TA 1GLPA 1Z6NA 3ZITA 4PUFC 3TJFA 5COHA 2GZZA 3IR4A 4GSSA 3EU3A 4J56E 2VIMA 1GNEA 4BL7B 5GSSA 4P3YB 2JU5A 2DJ2A 2WGRA 4NPBA 3UVTA 1PL1A 3QAVA 2PVQA 2RUFA 1K0AA 2H1BA 3QPMA 5D9XA 4HZ2A 4BWQA 5IO0A 5G31A 2FA8A 3OR5A 4YQMA 3ZTLA 2H66A 1ZGNA 1JZWA 2WS2A 2HRAA 2PBJA 3IHQA 2AV4A 4ZBDA 2CVBA 1O73A 1ABAA 3MIXA 4WBJA 2VD1A 3D22A 3TKSE 4GRFA 1YEPA 1A0RP 3LXZA 1X9SB 3GL5A 5IO2A 2GT5A 4BVXB 2I3YA 2LRTA 3MYDA 3LGCA 3FR3A 1PL2A 4IP1A 1T4ZA 3PH9A 3P7XA 1S3CA 1OVNA 3HYPA 5IM9A 1DBYA 1OKTA 3KXOA 1GULA 2LNSA 2R4VA 4XS4B 3APOA 4ECCA 3N9JA 3A5IA 4PQHA 2KP2A 6GSWA 1PX7A 4Z2RA 1NSWA 2L59A 3A5WA 1T4YA 2YZUA 4EL1A 4N11A 4TVEA 2MMAA 3FYGA 1N8JA 2HZEA 2VCTA 2R0PA 5ECLB 2XBIA 4DVCA 5IMZA 3HJOA 1TKDB 3BCIA 1SYRA 5H5QA 1GSYA 3F4SA 2G2QA 3KGKA 3VFIA 1GTIA 1NW2A 3AY8A 3W6GA 1FG4A 1WWJA 2EIRA 4RI7A 1SKRB 1NHOA 1V9WA 4AJ6A 2C0FA 5KN1A 2FNOA 3TRXA 1MDKA 1XWCA 1ML6A 1NHYA 2X49A 4MCUA 3GKMA 3TKQA 4NHWA 3Q19A 4KCEA 2TRCP 2WDUA 1M0UA 2IJYA 3FHKA 1F6MC 1FW1A 2KUCA 2FGXA 4JR6A 1MD3A 1SK0A 2OE1A 2RLIA 3GX8A 2VCQA 2L6DA 2YANA 2WJUA 3GMFA 4O32A 1ZOFA 4EO3A 2IMKA 1EZKA 5HR1A 2DBCA 3APSA 5HFKA 4QQ7A 2C3NA 2X4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MA9 A;  2RII A;  2R3X A;  4PGT A;  2I9H A;  2JSY A;  2HYX A;  3ZL5 A;  3HHV A;  4DSR A;  2B5X A;  1A0F A;  1KTE A;  2M80 A;  5INY A;  2DJ0 A;  2VLT A;  2HRN A;  3U5R E;  4OFN A;  4G19 A;  3VI5 A;  4KA0 A;  3I9V 2;  2H6Z A;  2E2M A;  3F0I A;  3O76 A;  5CRG A;  1XOA A;  1S3A A;  5JWR B;  1F2E A;  3ZVJ D;  4IGJ A;  4OFM A;  5ECS A;  1ERU A;  3VK9 A;  1MD4 A;  1X0R A;  5DDL A;  1XBS A;  3FW2 A;  4I6X A;  10GS A;  4KSO A;  2G0F A;  3FY7 A;  3BCK A;  2L4Q A;  1UC7 A;  3PR8 A;  4F0B A;  4EE0 A;  1ZYE A;  3EC3 A;  1M9A A;  4V1A g;  3LYK A;  5IPH A;  3ERW A;  3Q6O A;  1FVK A;  2MBS A;  4ML6 A;  3VPQ A;  1X9M B;  2E2G A;  2K8V A;  4F82 A;  3CYN A;  1B9Y C;  3TJJ A;  1W89 A;  3ZRE A;  4MJB A;  4L8E A;  2WZ9 A;  2PUK C;  5C04 A;  1TXX A;  3EYT A;  2C0E A;  3TOU A;  3LQ7 A;  4L0W A;  3DEX A;  3I43 A;  2DSA A;  2VLU A;  1M2B A;  5A4W A;  1VF2 A;  4ZB6 A;  4XS4 A;  3MWH A;  1AW9 A;  3FK8 A;  2AYT A;  2ON5 A;  1ON4 A;  3CRU A;  3NZN A;  4D73 B;  4FYC A;  3TGZ A;  2BMX A;  4K7O A;  2L4C A;  4FYB A;  1Z7R A;  4JED A;  3M1G A;  5ECP B;  5JWQ B;  5IPG A;  5HR3 A;  3UBL A;  2A2S A;  3TJG A;  2OAC A;  2H71 A;  2JL4 A;  2YV9 A;  3VWU A;  1GLQ A;  2ZUP A;  5AN1 A;  5H5R A;  3KH7 A;  3TUE A;  1ZMA A;  5EPF A;  3G9B A;  6GSY A;  1W4V A;  3DIE A;  2IPA A;  2P31 A;  2P5Q A;  1RW1 A;  4IHU A;  4MJE A;  1B9X C;  5D73 A;  4PQ1 A;  3GHA A;  3H1N A;  4KGI A;  4LL1 B;  3TRP A;  2KLX A;  1ST9 A;  4GQF A;  1HYU A;  8GSS A;  3D6I A;  1VRS D;  1OAZ A;  2C0D A;  1HNB A;  4KCA A;  1MDJ A;  3IRA A;  3FZ5 A;  1GP1 A;  2R6K A;  11GS A;  2GSR A;  3CMI A;  3PIN A;  2GT6 A;  4ECB A;  1HQO A;  3WYW A;  3EU4 A;  3DVW A;  2IFQ B;  3F8U A;  5KN2 A;  1J9B A;  3D4M A;  3IOS A;  4TR4 A;  3HXS A;  4QL9 A;  3DWV A;  1PRX A;  4V2M A;  1QQ2 A;  1LU4 A;  2WUL A;  4MH2 A;  5B8B A;  2H72 A;  5DVB A;  1JZD A;  2ON7 A;  4IKH A;  3VI7 A;  2DJ3 A;  5IQY A;  2F3M A;  3GA4 A;  2NVL A;  3F6F A;  3P8W A;  1PX6 A;  1OC3 A;  5J5N A;  2PMT A;  1V2A A;  3QAG A;  3HJP A;  9GSS A;  3V1W A;  1DE1 A;  3ZMK A;  3D0Z A;  4JBB A;  12GS A;  4MF5 A;  3KM6 A;  4XS1 A;  3UAR A;  2B7K A;  4X1U A;  4PNG A;  1T7P B;  2OE0 A;  4ISD A;  2VL2 C;  5FHI A;  2B5Y A;  5DAK B;  1G6Y A;  1R5A A;  3CSH A;  2ES7 A;  4ZXG A;  2MBT A;  1PQN A;  3IK7 A;  3CRT A;  4Z7X A;  1V58 A;  5KN3 A;  5KEJ A;  1ILO A;  3A3T A;  3DXB A;  4I2T A;  5F0G A;  1K0D A;  5D8I A;  4WR5 A;  4HUA A;  5G30 A;  4V2L A;  3IV4 A;  2QC7 A;  2YP6 A;  4KDY A;  3C1R A;  3TKR A;  2CA8 A;  3F63 A;  3EUR A;  3QDN A;  3A2V A;  3VUR A;  3DRN A;  4IJI A;  3TCO A;  1O81 A;  2HSH A;  1KEB A;  2HZE B;  3M3M A;  2C3Q A;  5ECK B;  3C1S A;  1T3B A;  3KIJ A;  4HU9 A;  5HQP A;  2HNL A;  17GS A;  3L4N A;  2O89 A;  1GSQ A;  3F9U A;  13GS A;  6GSS A;  2H19 A;  3RAZ A;  4AGS A;  4KX4 A;  2VCZ A;  1GWC A;  2DC5 A;  4WEY A;  2HXK A;  4EDZ A;  5DAL B;  4JU5 A;  5D93 A;  3QCP A;  3RBT A;  3ISO A;  4GWR A;  2PGT A;  3RHC A;  3APQ A;  1TK5 B;  1G7O A;  1KNG A;  1URM A;  3ERG A;  2DIY A;  2FWF A;  2H30 A;  3WGX A;  4N0V A;  1XW5 A;  3A2W A;  2VL3 A;  1B4P A;  4N10 A;  4F0C A;  4MMM A;  3EWL A;  3CSI A;  2K18 A;  2YJH A;  4J2F A;  3DML A;  1FO5 A;  1AIU A;  3CSJ A;  5FT3 A;  5ECQ B;  2KHP A;  6GST A;  3ZML A;  4KAE A;  3GTU A;  3TKP A;  4E8H A;  1AQW A;  2PWJ A;  4MH3 A;  3W8S A;  2B1K A;  2PER A;  1XXU A;  4ILF A;  4FYU A;  7GSS A;  4IJ3 A;  5J41 A;  5GAP D;  3GN3 A;  4ZL9 A;  1Y25 A;  2V32 A;  3KJY A;  4KDU A;  3PGT A;  3FR6 A;  4POM A;  2GS3 A;  2XC2 A;  2XPE A;  2J9H A;  4BVY A;  2CV4 A;  2H1D A;  3GIX A;  3S9F A;  3FZ4 A;  4K6X A;  4GSN A;  1USB A;  1GSU A;  2VM2 A;  5DAK A;  2CAI A;  5JWO B;  1V40 A;  2KP1 A;  1SL1 B;  1X5C A;  4MF7 A;  5LNK e;  2V41 A;  1K3Y A;  3L9S A;  5AIV A;  3WGD A;  4O7H A;  1K0N A;  1XCC A;  1I9D A;  14GS A;  3D5J A;  2B1L A;  4AF2 A;  2OBK A;  2MZC A;  3CTF A;  5GST A;  2E7P A;  4N0Z A;  4QL7 A;  4HJM A;  3SBC A;  1F3A A;  1CQH A;  4DSQ A;  3KMO A;  1EWX A;  4IBP A;  4ULX A;  1NM3 A;  1A8L A;  1F37 A;  1ERW A;  3HJM A;  4K2D A;  4NXI A;  1RK4 A;  3DGQ A;  4PX1 A;  4E8E A;  2GVP A;  3HY2 A;  3MNG A;  3TOT A;  2F8A A;  3TRQ A;  1V98 A;  2PN8 A;  5DQY A;  5IMC A;  2TRX A;  2QGV A;  2VO4 A;  4TR0 A;  1TK8 B;  2A4V A;  1X5D A;  5DAL A;  2K9F A;  1H4O A;  4IP6 A;  2D2Z A;  4IQ1 A;  1YKC A;  1BG5 A;  1FB6 A;  1XZO A;  3ZIV A;  4IQA A;  2VL2 A;  3I6A A;  3WT1 A;  2NDO A;  1K0B A;  5CAX A;  3E3E A;  1B4Q A;  3FZ9 A;  2XHF A;  3IK9 A;  2FY6 A;  1EEM A;  3WGE A;  4XRA A;  3UEM A;  2OE3 A;  1TW9 A;  1Z3E A;  2CZ2 A;  3TJB A;  1SD8 A;  3MSZ A;  2YNX A;  5IMV A;  4KDX A;  5G1L A;  4TR1 A;  2HE3 A;  4OO5 A;  4POL A;  4EVM A;  1SJ6 A;  4F03 A;  2H6Y A;  1ZYQ B;  4HS1 A;  5KN0 A;  4L5O A;  5CRW A;  5ECH B;  2YWM A;  4Q5R A;  4KUN A;  3FZA A;  3C71 A;  1IYI A;  4HU7 A;  1OE7 A;  2MMO A;  2LQQ A;  4YAP A;  5G2Z A;  3IAM 2;  5DQS A;  1JHB A;  3DKS A;  3LOR A;  2V1M A;  2DLX A;  1QUW A;  5E4W A;  4ZIJ A;  4ML1 A;  1O8W A;  1E6B A;  2B3S A;  3Q74 A;  2QSI A;  5L71 A;  2AJQ B;  1TDI A;  2X8C A;  1C72 A;  1T00 A;  2H75 A;  4TOP A;  3O6T A;  2R5G A;  3UJ1 A;  1GH2 A;  4MPG A;  1YQ1 A;  2IMD A;  5DBQ A;  4ACS A;  1SYX A;  16GS A;  1BQ7 A;  1PA3 A;  3C73 A;  2GGT A;  1VF4 A;  4YQV A;  2B5E A;  4NMU A;  3HZ4 A;  2CAQ A;  2MMZ A;  4K7N A;  1HNC A;  1O85 A;  2CVD A;  4O5R A;  1XIY A;  3GX0 A;  5F8B A;  4F9Z A;  2FUG 2;  4RQR A;  3GUS A;  3VPT A;  1SJI A;  2IN3 A;  3F3Q A;  1GUH A;  5ECN B;  5IMA A;  3FRC A;  4K7I A;  4TN8 A;  1THO A;  1SKW B;  1XPV A;  1A2J A;  3ME7 A;  1RQM A;  3RHB A;  5D96 A;  1MTC A;  4XS6 A;  2CVK A;  2IL3 A;  2GDR A;  3GFK A;  2AHE A;  4GTU A;  1EOH A;  1GNW A;  4KB3 A;  3H8Q A;  4BPY A;  5ECR B;  1MEK A;  1M2D A;  4EF0 A;  1Z9H A;  2FWH A;  1YF1 A;  2GSS A;  2HSY A;  2L6C A;  3UMA A;  2OAD A;  2GLR A;  4NV5 A;  4EKZ A;  2O87 A;  1X5E A;  5ECI B;  3GKX A;  3KTB A;  2N5A A;  1AC1 A;  1XOB A;  4WF5 A;  2QKE A;  1U88 A;  1TU7 A;  2O8V B;  2LKU A;  1JZO A;  3TJK A;  4G2E A;  4FIW A;  4DSS A;  1A2M A;  4OMV A;  1YDK A;  3FEU A;  1T1V A;  3G7I A;  2C3T A;  3HZ8 A;  1M9B A;  3D4T A;  1SU9 A;  1OE8 A;  3LEF A;  3IBH A;  4ID0 A;  1FB0 A;  1VGL A;  1EP8 A;  3J7Y k;  1GSD A;  3GTU B;  4LLR A;  5CRD A;  1PGT A;  1BX9 A;  2X64 A;  2YOI A;  5F06 A;  5DCG A;  5HFG A;  4ZB8 A;  2LNT A;  4IVF A;  4RI6 A;  4ZIL A;  3F4R A;  1GUM A;  4NV2 A;  2C1Y A;  2H01 A;  1GL8 A;  2J23 A;  4Q5N A;  3LG6 A;  2WB9 A;  3VLN A;  2F8F A;  1YF0 A;  2PPT A;  3GH6 A;  1CQG A;  2C4J A;  5GZZ B;  3IC4 A;  2JZS A;  1UVZ A;  1QMV A;  2JZT A;  1TJD A;  2C8U A;  4OO4 A;  3JCM L;  2H76 A;  1AQX A;  2PU9 C;  1J0F A;  4RQX A;  1T8E B;  2H74 A;  4ZB9 A;  2FHE A;  2LRN A;  3UAP A;  1YKA A;  5ID2 A;  4YQU A;  1J08 A;  1PN9 A;  1O7U A;  3LYP A;  4HZ4 A;  1FAA A;  1R26 A;  4GF0 A;  2GTU A;  1UA5 A;  1WP0 A;  1XWG A;  1JZR A;  4IEL A;  5B8A A;  4L0U A;  1WE0 A;  2H1G A;  5EL8 A;  1Y6E A;  2VCV A;  2ZNM A;  5GAN D;  2V6K A;  4MJA A;  4L5L A;  2LST A;  4WBR D;  5JCG A;  4IS0 A;  5FWG A;  4GQC A;  4WKW A;  2EIQ A;  5G1K A;  4YH2 A;  2LUS A;  4EXJ A;  3R2Q A;  1EGO A;  4NHZ A;  2YJ7 A;  1Q4J A;  2EC4 A;  3QOU A;  2DJJ A;  2R2J A;  1JFU A;  2CQ9 A;  5ELA A;  1GRX A;  5H5S A;  1K3O A;  5DJL A;  4OWY A;  3IA1 A;  4YAV A;  3E0U A;  4ZL8 A;  2HLS A;  2GQK A;  3H79 A;  2K8S A;  2H0I A;  5IIZ A;  1LJR A;  3UL3 A;  5AIX A;  2DJ1 A;  1EEJ A;  3VWW A;  5J9B A;  3ED3 A;  4EC0 A;  1XWK A;  5ECM B;  3HA9 A;  3Q18 A;  2Z9S A;  3GYK A;  1JLW A;  2V6O A;  4JRR A;  5ELG A;  4LL4 B;  4TR1 B;  1A24 A;  3LSZ A;  2YCD A;  2VM1 A;  4KSM A;  1WIK A;  3GH9 A;  4K1F A;  3GV1 A;  3M0F A;  5J9C A;  3IDV A;  1V57 A;  20GS A;  2IIY A;  1B8X A;  2X8G A;  1EV9 A;  5CNW A;  2L57 A;  1H75 A;  1TK0 B;  1WJK A;  4PUR A;  3QAW A;  2VOC A;  4OCE A;  1ZL9 A;  5A5K A;  1F3B A;  2FCH A;  1XW6 A;  2YWO A;  1M7T A;  1XW9 A;  4PXO A;  2NTO A;  4PQI A;  1U87 A;  1R7H A;  5B7C A;  2VD0 A;  4TXV A;  2WCI A;  1SJZ A;  1LBK A;  2GST A;  1A23 A;  2CT6 A;  2VCX A;  3L9U A;  4MJC A;  5B6N A;  1FHE A;  1Q98 A;  2AB6 A;  1UN2 A;  1KBN A;  2B6M A;  4HJ2 A;  2EIO A;  1TRW A;  3KH9 A;  4G10 A;  3L9V A;  5E59 A;  1ZZY A;  5D9V A;  1G7E A;  5CRH A;  3KP9 A;  3ZZX A;  2IMI A;  6GSX A;  2NBS A;  4HEA 2;  2FLS A;  3TB2 A;  5B6M A;  3GL3 A;  2N5F A;  1B48 A;  5IOW A;  2LV3 A;  2LRC A;  4JR4 A;  4TR3 A;  2A2R A;  3ERF A;  1SK2 A;  1ACV A;  3TDG A;  2YV7 A;  2CX3 A;  1GSS A;  2KOK A;  5LCZ A;  1A8Y A;  2K6V A;  1TOF A;  5D9T A;  2JZR A;  1X9W B;  5EY6 A;  1FVJ A;  3VWV A;  4XTS A;  1WMJ A;  1AXD A;  2FD3 A;  5J3R A;  1R4W A;  3GRX A;  1E2Y A;  2VCW A;  2F51 A;  5IOX A;  3F4T A;  4FH8 A;  3ZYW A;  3HDC A;  2HFD A;  1TI1 A;  4WXT A;  2RM6 A;  3HVV A;  5CP1 A;  4MAB A;  1PD2 1;  5ABR A;  3ZIJ A;  1S3D A;  4TXO A;  1WOU A;  1YZX A;  2FWE A;  4F2I A;  1YY7 A;  3G7Y A;  3P90 A;  3H4K A;  1AQV A;  2AUV A;  4HOJ A;  2WRT A;  4DSS B;  1BED A;  4IW9 A;  1Z5Y E;  2H8L A;  3US3 A;  3EIN A;  2PVO C;  5A4V A;  4HDE A;  4MZW A;  1ZCP A;  4AJ7 A;  1K0M A;  3BOA A;  4MK3 A;  1XVQ A;  2XPD A;  22GS A;  5ENU A;  3KP8 A;  5HFI A;  5IMD A;  3MDK A;  3RPN A;  2V2G A;  3ZLP A;  4POB A;  2DMM A;  1PMT A;  5CYY A;  2HRF A;  1PSQ A;  4WF4 A;  5F05 A;  3QFB C;  2RM5 A;  2VLV A;  1A2L A;  2YPM A;  3L0H A;  3LWA A;  1OC9 A;  2LTK A;  2L5L A;  3C8E A;  5JCW A;  3UVH A;  1TU8 A;  2LS5 A;  1GTU A;  3QR6 A;  3F3R A;  3EE2 A;  2IWT A;  2C80 A;  3LJR A;  4ZBB A;  4Q5F A;  4MLY A;  3HVS A;  4ZL7 A;  3ZVJ A;  2LEG A;  3EVI A;  4V1A p;  5ECO B;  1SD9 A;  2YWI A;  3DYR A;  4BL7 A;  3HD5 A;  2GZP A;  2H0G A;  1BAY A;  5AIS A;  1O6J A;  2I81 A;  5IMF A;  2NPB A;  2GZY A;  3QMX A;  2LQO A;  3HVX A;  1XWB A;  4OFT A;  1SEN A;  3LXT A;  5ID2 B;  19GS A;  4CW9 A;  2H1A A;  4MZC A;  3GKK A;  3TKS C;  1GUK A;  3UBK A;  1GSF A;  2H6X A;  1SL2 B;  3WT2 A;  3GST A;  1PKZ A;  2CZ3 A;  4BVX A;  4FO5 A;  2I4A A;  4I8B A;  3QD9 A;  4WR4 A;  1WRY A;  1SKS B;  3M9J A;  1WPI A;  3SWL A;  3IXR A;  6GSV A;  3WD6 A;  3NOF A;  1EGR A;  1EV4 A;  1QK8 A;  3DD3 A;  2GSQ A;  1QGV A;  2P0G A;  4MPF A;  2DML A;  2E0Q A;  3KMN A;  5A4U A;  3KTL A;  4JE1 A;  1OYJ A;  4TRX A;  5C00 A;  3H93 A;  1TP9 A;  4NWY A;  4XHM A;  3UOM A;  3ZRD A;  3FKF A;  1FOV A;  2VL9 A;  2WFC A;  1OKD A;  1HNA A;  1AAZ A;  5G5E A;  1DUG A;  4EUY A;  2AAW A;  1DSB A;  3P2A A;  1SK1 A;  2JAD A;  4K0G A;  3RDW A;  4I2U A;  4EDY A;  1O8X A;  3KEB A;  2GQM A;  1HD2 A;  3GNJ A;  1SL0 B;  2LJK A;  4POK A;  2TIR A;  1K0O A;  1VF3 A;  3LFL A;  3ZFL A;  4MDC A;  3BBY A;  3BJ5 A;  3KCM A;  5F07 A;  2RUE A;  1EP7 A;  4IN0 A;  3F6D A;  2M46 A;  1QFN A;  1TRS A;  4PNF A;  5JCU A;  4G9H A;  1I5G A;  2YWN A;  1TTZ A;  2R37 A;  1U6T A;  1R5P A;  1DE2 A;  4K0N A;  4LA1 A;  18GS A;  1F9M A;  4JZQ A;  3IAS 2;  4V2N A;  4ECJ A;  2O7K A;  4X0X A;  4H86 A;  2VAF A;  2OJL A;  2OBI A;  2CX4 A;  1MDI A;  1BJX A;  2H70 A;  1BYE A;  3GUR A;  3GKN A;  4KND A;  3A2X A;  2N5B A;  4TW5 A;  4I97 A;  3N5O A;  5J4U A;  3IE3 A;  4HQZ A;  4DEJ A;  4LMW A;  1JLV A;  4HQS A;  4XIH A;  2DIZ A;  1YJ6 A;  2HI7 A;  1TRV A;  5D9W A;  2OA7 A;  2I1U A;  2JAC A;  2H0H A;  1M99 A;  3IPZ A;  2ALB A;  3MAK A;  1QXH A;  1VF1 A;  2VUP A;  3D21 A;  3FR9 A;  3G7J A;  3VWX A;  5EVO A;  4CHS A;  3CBU A;  2ZCT A;  3J7Y b;  4GCI A;  4NAX A;  1TI3 A;  2F9S A;  3QFA C;  4CDO A;  3HCZ A;  3RPP A;  3L78 A;  3KZQ A;  3C7M A;  2REM A;  2LJR A;  1AUC A;  1ERV A;  5CRE A;  2B7J A;  1GTA A;  4Q5Q A;  2BTO T;  3EMP A;  3UIW A;  2IME A;  4O92 A;  2HZF A;  4GLT A;  4GXZ A;  2XBQ A;  2FA4 A;  4GST A;  4ECI A;  2OKA A;  5HR2 A;  3M9K A;  2YN1 A;  4AJ8 A;  1XWA A;  6GSU A;  4D73 A;  3EMX A;  3M8N A;  1Z6M A;  1K0C A;  4X43 A;  4KE3 A;  5DJM A;  3KD0 A;  3W8J A;  5CO3 A;  4K9Z A;  4TXO B;  2MYG A;  2X99 A;  4MP4 A;  4I5Q A;  4KH7 A;  1U3A A;  2P5R A;  4HI7 A;  1K3L A;  4RUV A;  4WET A;  3NIV A;  1THX A;  5HR0 A;  4KW6 A;  4XCS A;  4MF6 A;  5LD0 A;  3E9J B;  4BWS A;  3K8N A;  4N30 A;  3HKR A;  2JSZ A;  4LMV A;  3DVX A;  5DCH A;  1N2A A;  2BJX A;  2H73 A;  4OCF A;  1XVW A;  2O85 A;  1ERT A;  4MZB A;  4PUA A;  4TKY A;  2C0G A;  1G6W A;  2M72 A;  3TKS A;  2IMF A;  1PKW A;  1YEX A;  2DJK A;  3ZFB A;  1GTB A;  4ZBA A;  1IYH A;  5G5F A;  3BD2 A;  4BA7 A;  1U3I A;  4XRD A;  2X8H A;  1OC8 A;  2HT9 A;  1XFL A;  2L5O A;  2MMN A;  3GSS A;  3U6V A;  2IFQ A;  1G0T A;  4K8M A;  4J57 E;  1OC9 B;  1Z7P A;  2GQL A;  2LJA A;  2YZH A;  3CXG A;  3I69 A;  5AGY A;  1EOG A;  1TRU A;  3ME8 A;  1M2A A;  1GSE A;  3CTG A;  4OD7 A;  2FWG A;  3O3T A;  1GLP A;  1Z6N A;  3ZIT A;  4PUF C;  3TJF A;  5COH A;  2GZZ A;  3IR4 A;  4GSS A;  3EU3 A;  4J56 E;  2VIM A;  1GNE A;  5GSS A;  4P3Y B;  2JU5 A;  2DJ2 A;  2WGR A;  4NPB A;  3UVT A;  1PL1 A;  3QAV A;  2PVQ A;  2RUF A;  1K0A A;  2H1B A;  3QPM A;  5D9X A;  4HZ2 A;  4BWQ A;  5IO0 A;  5G31 A;  2FA8 A;  3OR5 A;  4YQM A;  3ZTL A;  2H66 A;  1ZGN A;  1JZW A;  2WS2 A;  2PBJ A;  3IHQ A;  2AV4 A;  4ZBD A;  2CVB A;  1O73 A;  1ABA A;  4WBJ A;  2VD1 A;  3D22 A;  3TKS E;  4GRF A;  1YEP A;  1A0R P;  3LXZ A;  1X9S B;  3GL5 A;  5IO2 A;  2GT5 A;  2I3Y A;  2LRT A;  3LGC A;  3FR3 A;  1PL2 A;  4IP1 A;  1T4Z A;  3PH9 A;  3P7X A;  1S3C A;  1OVN A;  3HYP A;  5IM9 A;  1DBY A;  1OKT A;  3KXO A;  1GUL A;  2LNS A;  2R4V A;  4XS4 B;  3APO A;  4ECC A;  3N9J A;  4PQH A;  2KP2 A;  6GSW A;  1PX7 A;  1NSW A;  2L59 A;  3A5W A;  1T4Y A;  2YZU A;  4EL1 A;  4N11 A;  4TVE A;  2MMA A;  3FYG A;  1N8J A;  2HZE A;  2VCT A;  5ECL B;  2XBI A;  4DVC A;  5IMZ A;  3HJO A;  1TKD B;  3BCI A;  1SYR A;  5H5Q A;  1GSY A;  3F4S A;  2G2Q A;  3KGK A;  3VFI A;  1GTI A;  1NW2 A;  3AY8 A;  3W6G A;  1FG4 A;  1WWJ A;  2EIR A;  4RI7 A;  1SKR B;  1NHO A;  1V9W A;  4AJ6 A;  2C0F A;  5KN1 A;  2FNO A;  3TRX A;  1MDK A;  1XWC A;  1ML6 A;  1NHY A;  4MCU A;  3GKM A;  3TKQ A;  4NHW A;  3Q19 A;  4KCE A;  2TRC P;  2WDU A;  1M0U A;  2IJY A;  3FHK A;  1F6M C;  1FW1 A;  2KUC A;  2FGX A;  4JR6 A;  1MD3 A;  1SK0 A;  2OE1 A;  2RLI A;  3GX8 A;  2VCQ A;  2L6D A;  2YAN A;  2WJU A;  3GMF A;  4O32 A;  1ZOF A;  4EO3 A;  2IMK A;  1EZK A;  5HR1 A;  2DBC A;  3APS A;  5HFK A;  4QQ7 A;  2C3N A; 
#chains in the Genus database with same CATH topology
 4MA9 A;  2RII A;  2R3X A;  4PGT A;  2I9H A;  2JSY A;  2HYX A;  3ZL5 A;  3HHV A;  4DSR A;  2B5X A;  1A0F A;  1KTE A;  2M80 A;  5INY A;  2DJ0 A;  2VLT A;  2HRN A;  3U5R E;  4OFN A;  4G19 A;  3VI5 A;  4KA0 A;  3I9V 2;  2H6Z A;  2E2M A;  3F0I A;  3O76 A;  5CRG A;  1XOA A;  1S3A A;  5JWR B;  1F2E A;  3ZVJ D;  4IGJ A;  4OFM A;  4O5U A;  3CQF A;  5ECS A;  1ERU A;  3VK9 A;  1MD4 A;  1X0R A;  5DDL A;  1XBS A;  3FW2 A;  4I6X A;  10GS A;  4KSO A;  2G0F A;  3FY7 A;  3BCK A;  2L4Q A;  1UC7 A;  3PR8 A;  4F0B A;  4EE0 A;  1ZYE A;  3EC3 A;  1M9A A;  4V1A g;  3LYK A;  5IPH A;  3ERW A;  3Q6O A;  1FVK A;  2MBS A;  4ML6 A;  3VPQ A;  1X9M B;  2E2G A;  2K8V A;  4F82 A;  3CYN A;  1B9Y C;  3TJJ A;  4O5Q A;  1W89 A;  3ZRE A;  4MJB A;  4L8E A;  2WZ9 A;  2PUK C;  5C04 A;  1TXX A;  3EYT A;  2C0E A;  3TOU A;  3LQ7 A;  4L0W A;  3DEX A;  3I43 A;  2DSA A;  3R3E A;  2VLU A;  1M2B A;  5A4W A;  1VF2 A;  4ZB6 A;  4XS4 A;  3MWH A;  1AW9 A;  3FK8 A;  2AYT A;  2ON5 A;  1ON4 A;  3CRU A;  3NZN A;  4D73 B;  4FYC A;  3TGZ A;  2BMX A;  4K7O A;  2L4C A;  4FYB A;  4MNN A;  1Z7R A;  4JED A;  3M1G A;  5ECP B;  5JWQ B;  5IPG A;  5HR3 A;  3UBL A;  2A2S A;  3TJG A;  2OAC A;  2H71 A;  2A2P A;  2JL4 A;  2YV9 A;  3VWU A;  1GLQ A;  2ZUP A;  5AN1 A;  5H5R A;  3KH7 A;  3TUE A;  1ZMA A;  5EPF A;  3G9B A;  6GSY A;  1W4V A;  3DIE A;  2IPA A;  2P31 A;  2P5Q A;  1RW1 A;  4IHU A;  4MJE A;  1B9X C;  5D73 A;  1ZYN A;  4PQ1 A;  3GHA A;  3H1N A;  4KGI A;  4LL1 B;  3TRP A;  2KLX A;  1ST9 A;  4GQF A;  1HYU A;  3LW9 A;  8GSS A;  3D6I A;  1VRS D;  1OAZ A;  2C0D A;  1HNB A;  4KCA A;  1MDJ A;  3IRA A;  3FZ5 A;  1GP1 A;  2R6K A;  11GS A;  2GSR A;  3CMI A;  3PIN A;  2QA1 A;  2GT6 A;  4ECB A;  1HQO A;  3WYW A;  3EU4 A;  3DVW A;  2IFQ B;  3F8U A;  5KN2 A;  1J9B A;  3D4M A;  3IOS A;  4TR4 A;  3HXS A;  4QL9 A;  2QA2 A;  3DWV A;  1PRX A;  4V2M A;  1QQ2 A;  1LU4 A;  2WUL A;  4MH2 A;  5B8B A;  2H72 A;  5DVB A;  1JZD A;  2ON7 A;  4IKH A;  3VI7 A;  2DJ3 A;  5IQY A;  2F3M A;  3GA4 A;  2NVL A;  3F6F A;  3P8W A;  1PX6 A;  1OC3 A;  5J5N A;  2PMT A;  1V2A A;  3QAG A;  3HJP A;  9GSS A;  5KOX A;  3V1W A;  1DE1 A;  3ZMK A;  3D0Z A;  4JBB A;  12GS A;  4MF5 A;  3KM6 A;  4XS1 A;  3UAR A;  2B7K A;  4X1U A;  4PNG A;  1T7P B;  2OE0 A;  4ISD A;  2VL2 C;  5FHI A;  2B5Y A;  5DAK B;  1G6Y A;  1R5A A;  3CSH A;  2ES7 A;  4ZXG A;  2MBT A;  1PQN A;  3IK7 A;  3CRT A;  4Z7X A;  1V58 A;  5KN3 A;  4USS A;  5KEJ A;  1ILO A;  3A3T A;  3DXB A;  4I2T A;  5F0G A;  1K0D A;  5D8I A;  4WR5 A;  4HUA A;  5G30 A;  4V2L A;  3IV4 A;  2QC7 A;  2YP6 A;  1FOH A;  4KDY A;  3C1R A;  3TKR A;  2CA8 A;  3F63 A;  3EUR A;  3QDN A;  3A2V A;  3VUR A;  3DRN A;  4IJI A;  3TCO A;  1O81 A;  2HSH A;  1KEB A;  2HZE B;  3M3M A;  2C3Q A;  5ECK B;  3C1S A;  1T3B A;  3KIJ A;  4HU9 A;  5HQP A;  2HNL A;  17GS A;  3L4N A;  2O89 A;  5BMU A;  1GSQ A;  3F9U A;  13GS A;  6GSS A;  2H19 A;  3RAZ A;  4AGS A;  4KX4 A;  2VCZ A;  1GWC A;  2DC5 A;  4WEY A;  2HXK A;  4EDZ A;  5DAL B;  4JU5 A;  5D93 A;  3QCP A;  3RBT A;  3ISO A;  4GWR A;  2PGT A;  3RHC A;  4YKG A;  3APQ A;  1TK5 B;  1G7O A;  4G0K A;  1KNG A;  1URM A;  3ERG A;  2DIY A;  2FWF A;  2H30 A;  3WGX A;  4N0V A;  1XW5 A;  3A2W A;  2VL3 A;  1B4P A;  4N10 A;  4F0C A;  4MMM A;  3EWL A;  3CSI A;  2K18 A;  2YJH A;  4J2F A;  3DML A;  1FO5 A;  1AIU A;  3CSJ A;  5FT3 A;  5ECQ B;  2KHP A;  6GST A;  3ZML A;  4KAE A;  3GTU A;  3TKP A;  4E8H A;  1AQW A;  2PWJ A;  4MH3 A;  3W8S A;  2B1K A;  2PER A;  1XXU A;  4ILF A;  4FYU A;  7GSS A;  1PN0 A;  4IJ3 A;  5J41 A;  5GAP D;  3GN3 A;  4ZL9 A;  1Y25 A;  2V32 A;  3KJY A;  4KDU A;  3PGT A;  3FR6 A;  4POM A;  2GS3 A;  2XC2 A;  2XPE A;  2J9H A;  4BVY A;  2CV4 A;  2H1D A;  3GIX A;  3S9F A;  3FZ4 A;  4K6X A;  4GSN A;  1USB A;  1GSU A;  2VM2 A;  5DAK A;  2CAI A;  5JWO B;  1V40 A;  2KP1 A;  1SL1 B;  1X5C A;  4MF7 A;  5LNK e;  2V41 A;  1K3Y A;  3L9S A;  5AIV A;  3WGD A;  4O7H A;  1K0N A;  1XCC A;  1I9D A;  14GS A;  3D5J A;  2B1L A;  4AF2 A;  2OBK A;  2MZC A;  3CTF A;  5GST A;  2E7P A;  4N0Z A;  4QL7 A;  4HJM A;  3SBC A;  1F3A A;  1CQH A;  4DSQ A;  3KMO A;  1EWX A;  4IBP A;  4ULX A;  1NM3 A;  1A8L A;  1F37 A;  1ERW A;  3HJM A;  2HSM A;  4K2D A;  4NXI A;  1RK4 A;  3DGQ A;  4PX1 A;  4E8E A;  2GVP A;  3HY2 A;  3MNG A;  3TOT A;  2F8A A;  3TRQ A;  1V98 A;  2PN8 A;  5DQY A;  5IMC A;  2TRX A;  2QGV A;  2VO4 A;  4TR0 A;  1TK8 B;  2A4V A;  1X5D A;  2K9F A;  5DAL A;  1H4O A;  4IP6 A;  2D2Z A;  4IQ1 A;  1YKC A;  1BG5 A;  1FB6 A;  1XZO A;  3ZIV A;  4IQA A;  2VL2 A;  3I6A A;  3WT1 A;  2NDO A;  1K0B A;  5CAX A;  3E3E A;  1B4Q A;  3FZ9 A;  2XHF A;  3IK9 A;  2FY6 A;  1EEM A;  3WGE A;  4XRA A;  3UEM A;  2OE3 A;  1TW9 A;  1Z3E A;  2CZ2 A;  3TJB A;  1SD8 A;  3MSZ A;  2YNX A;  5IMV A;  2A4H A;  4KDX A;  5G1L A;  4TR1 A;  2HE3 A;  4OO5 A;  4POL A;  4EVM A;  3EPT A;  1SJ6 A;  4F03 A;  2H6Y A;  1ZYQ B;  4HS1 A;  5KN0 A;  4L5O A;  5CRW A;  5ECH B;  2YWM A;  3HVN A;  4Q5R A;  4KUN A;  3FZA A;  3C71 A;  1IYI A;  4HU7 A;  1OE7 A;  2MMO A;  2LQQ A;  4YAP A;  5G2Z A;  3IAM 2;  5DQS A;  1JHB A;  3DKS A;  3LOR A;  2V1M A;  2DLX A;  1QUW A;  5E4W A;  4ZIJ A;  4ML1 A;  1O8W A;  1E6B A;  2B3S A;  3Q74 A;  2QSI A;  5L71 A;  4PTS A;  2AJQ B;  1TDI A;  2X8C A;  1C72 A;  1T00 A;  2H75 A;  4TOP A;  3O6T A;  2R5G A;  3UJ1 A;  1GH2 A;  4MPG A;  1YQ1 A;  2IMD A;  5DBQ A;  4ACS A;  1SYX A;  16GS A;  1BQ7 A;  1PA3 A;  3C73 A;  2GGT A;  1VF4 A;  4EIP A;  4YQV A;  2B5E A;  4NMU A;  3HZ4 A;  2CAQ A;  2MMZ A;  4K7N A;  1HNC A;  1O85 A;  2CVD A;  4O5R A;  1XIY A;  3GX0 A;  5F8B A;  4F9Z A;  2FUG 2;  4RQR A;  3GUS A;  3VPT A;  1SJI A;  2IN3 A;  3F3Q A;  1GUH A;  5ECN B;  5IMA A;  3FRC A;  4K7I A;  4TN8 A;  1THO A;  1SKW B;  1XPV A;  1A2J A;  3ME7 A;  1RQM A;  3RHB A;  5D96 A;  1MTC A;  4XS6 A;  2CVK A;  2IL3 A;  2GDR A;  3GFK A;  2AHE A;  4GTU A;  1EOH A;  1GNW A;  4K5R A;  4KB3 A;  3H8Q A;  4BPY A;  5ECR B;  1MEK A;  1M2D A;  4EF0 A;  1Z9H A;  2FWH A;  1YF1 A;  2GSS A;  2HSY A;  2L6C A;  3UMA A;  2OAD A;  2GLR A;  4NV5 A;  4Z2T A;  4EKZ A;  2O87 A;  1X5E A;  5ECI B;  3GKX A;  3KTB A;  2N5A A;  1AC1 A;  1XOB A;  3FMW A;  4WF5 A;  2QKE A;  1U88 A;  1TU7 A;  2O8V B;  2LKU A;  5BRT A;  1JZO A;  3TJK A;  4G2E A;  4YKF A;  4FIW A;  4DSS A;  1A2M A;  4OMV A;  1YDK A;  3FEU A;  1T1V A;  3G7I A;  2C3T A;  3HZ8 A;  1M9B A;  3D4T A;  1SU9 A;  1OE8 A;  3LEF A;  3IBH A;  4ID0 A;  1FB0 A;  1VGL A;  1EP8 A;  3J7Y k;  1GSD A;  3GTU B;  4LLR A;  5CRD A;  1PGT A;  1BX9 A;  2X64 A;  2YOI A;  5F06 A;  5DCG A;  5HFG A;  4ZB8 A;  2LNT A;  4IVF A;  4RI6 A;  4ZIL A;  3F4R A;  1GUM A;  4NV2 A;  2C1Y A;  2H01 A;  1GL8 A;  2J23 A;  4Q5N A;  3LG6 A;  2WB9 A;  3VLN A;  2R0G A;  2F8F A;  1YF0 A;  2PPT A;  3GH6 A;  1CQG A;  2C4J A;  5GZZ B;  3IC4 A;  2JZS A;  4BVY B;  5KOW A;  1UVZ A;  1QMV A;  2JZT A;  1TJD A;  2C8U A;  4OO4 A;  3JCM L;  2H76 A;  1AQX A;  2PU9 C;  1J0F A;  4RQX A;  1T8E B;  2H74 A;  1XG8 A;  4ZB9 A;  2FHE A;  2LRN A;  3UAP A;  1YKA A;  5ID2 A;  4YQU A;  1J08 A;  1PN9 A;  1O7U A;  3LYP A;  4HZ4 A;  1FAA A;  1R26 A;  4GF0 A;  2GTU A;  1UA5 A;  1WP0 A;  1XWG A;  1JZR A;  4IEL A;  5B8A A;  4L0U A;  1WE0 A;  2H1G A;  1Y6E A;  2VCV A;  5EL8 A;  2ZNM A;  5GAN D;  2V6K A;  4MJA A;  4L5L A;  2LST A;  4WBR D;  5JCG A;  4IS0 A;  5FWG A;  4GQC A;  4WKW A;  2EIQ A;  5G1K A;  4YH2 A;  2LUS A;  4EXJ A;  3R2Q A;  1EGO A;  4NHZ A;  2YJ7 A;  1Q4J A;  2EC4 A;  3QOU A;  2DJJ A;  2R2J A;  1JFU A;  2CQ9 A;  5ELA A;  2R0C A;  1GRX A;  5H5S A;  1K3O A;  5DJL A;  4OWY A;  3IA1 A;  4YAV A;  3E0U A;  4ZL8 A;  2HLS A;  2GQK A;  3H79 A;  2K8S A;  2H0I A;  5IIZ A;  1LJR A;  3UL3 A;  5AIX A;  2DJ1 A;  1EEJ A;  3VWW A;  5J9B A;  3ED3 A;  4EC0 A;  1XWK A;  5ECM B;  1M3J A;  3HA9 A;  3Q18 A;  2Z9S A;  3GYK A;  1JLW A;  2V6O A;  4JRR A;  5ELG A;  4LL4 B;  4TR1 B;  1A24 A;  3LSZ A;  2YCD A;  2VM1 A;  4KSM A;  1WIK A;  3GH9 A;  4K1F A;  3GV1 A;  3M0F A;  5J9C A;  3IDV A;  1V57 A;  20GS A;  2IIY A;  1B8X A;  2X8G A;  1EV9 A;  4Z2U A;  5CNW A;  2L57 A;  1H75 A;  1TK0 B;  1WJK A;  4PUR A;  3QAW A;  2VOC A;  4OCE A;  1ZL9 A;  5A5K A;  1F3B A;  2FCH A;  1XW6 A;  2YWO A;  1M7T A;  1XW9 A;  4PXO A;  2NTO A;  4PQI A;  1U87 A;  1R7H A;  5B7C A;  2VD0 A;  4TXV A;  2WCI A;  1SJZ A;  1LBK A;  2GST A;  1A23 A;  2CT6 A;  2VCX A;  3L9U A;  4MJC A;  5B6N A;  1FHE A;  1Q98 A;  2AB6 A;  1UN2 A;  1KBN A;  2B6M A;  4HJ2 A;  2EIO A;  1TRW A;  3KH9 A;  4G10 A;  3L9V A;  5E59 A;  1ZZY A;  5D9V A;  1G7E A;  5CRH A;  3IHG A;  3KP9 A;  3ZZX A;  2IMI A;  6GSX A;  2NBS A;  4HEA 2;  2FLS A;  3TB2 A;  5B6M A;  3GL3 A;  2N5F A;  1B48 A;  5IOW A;  2LV3 A;  2LRC A;  4JR4 A;  4TR3 A;  2A2R A;  3ERF A;  1SK2 A;  1ACV A;  3TDG A;  2YV7 A;  2CX3 A;  1GSS A;  4HSC X;  2KOK A;  4KF9 A;  5LCZ A;  1A8Y A;  2K6V A;  1TOF A;  5D9T A;  4BIK A;  2JZR A;  1X9W B;  5EY6 A;  1FVJ A;  3VWV A;  4XTS A;  1WMJ A;  1AXD A;  2FD3 A;  5J3R A;  1R4W A;  3GRX A;  1E2Y A;  2VCW A;  2F51 A;  5IOX A;  3F4T A;  4FH8 A;  3ZYW A;  3HDC A;  2HFD A;  1TI1 A;  3IC8 A;  4WXT A;  2RM6 A;  3HVV A;  5CP1 A;  4MAB A;  1S3R A;  1PD2 1;  5ABR A;  3ZIJ A;  1S3D A;  4TXO A;  1WOU A;  1YZX A;  2FWE A;  4F2I A;  1YY7 A;  3G7Y A;  3P90 A;  3H4K A;  1AQV A;  2AUV A;  4HOJ A;  2WRT A;  4DSS B;  1BED A;  4IW9 A;  1Z5Y E;  2H8L A;  3US3 A;  3EIN A;  2PVO C;  5A4V A;  4HDE A;  4MZW A;  1ZCP A;  4AJ7 A;  1K0M A;  3BOA A;  4MK3 A;  1XVQ A;  2XPD A;  22GS A;  5ENU A;  3KP8 A;  5HFI A;  5IMD A;  3MDK A;  3RPN A;  2V2G A;  3ZLP A;  4POB A;  2DMM A;  1PMT A;  4A5P A;  5CYY A;  2HRF A;  1PSQ A;  4G0L A;  4WF4 A;  5F05 A;  3QFB C;  2RM5 A;  2VLV A;  1A2L A;  2YPM A;  3L0H A;  3LWA A;  1OC9 A;  2LTK A;  2L5L A;  3C8E A;  5JCW A;  3UVH A;  1TU8 A;  2LS5 A;  1GTU A;  3QR6 A;  3F3R A;  3EE2 A;  2IWT A;  2C80 A;  3LJR A;  4ZBB A;  4Q5F A;  4MLY A;  3HVS A;  4K5S A;  4ZL7 A;  3ZVJ A;  2LEG A;  3EVI A;  4V1A p;  5ECO B;  1SD9 A;  2YWI A;  3DYR A;  4BL7 A;  3HD5 A;  2GZP A;  2H0G A;  1BAY A;  5AIS A;  1O6J A;  4EIQ A;  2I81 A;  5IMF A;  2NPB A;  2GZY A;  3QMX A;  2LQO A;  3HVX A;  1XWB A;  4OFT A;  1SEN A;  3LXT A;  5ID2 B;  19GS A;  4CW9 A;  2H1A A;  4MZC A;  3GKK A;  3TKS C;  1GUK A;  3UBK A;  1GSF A;  2H6X A;  4X4J A;  1SL2 B;  3WT2 A;  3GST A;  1PKZ A;  2CZ3 A;  4BVX A;  4FO5 A;  2I4A A;  4I8B A;  3QD9 A;  4WR4 A;  1WRY A;  1SKS B;  3M9J A;  1WPI A;  3SWL A;  3IXR A;  6GSV A;  4G0I A;  3WD6 A;  3NOF A;  1EGR A;  1EV4 A;  1QK8 A;  3DD3 A;  2GSQ A;  1QGV A;  2P0G A;  4MPF A;  2DML A;  2E0Q A;  3KMN A;  5A4U A;  3KTL A;  4JE1 A;  1OYJ A;  4TRX A;  5C00 A;  3H93 A;  1TP9 A;  4NWY A;  4XHM A;  3UOM A;  3ZRD A;  3FKF A;  1FOV A;  2VL9 A;  2WFC A;  1OKD A;  1HNA A;  1AAZ A;  5G5E A;  1DUG A;  4EUY A;  2AAW A;  1DSB A;  3P2A A;  1SK1 A;  2JAD A;  4K0G A;  2DKH A;  3RDW A;  4I2U A;  4EDY A;  1O8X A;  3KEB A;  2GQM A;  1HD2 A;  3GNJ A;  1SL0 B;  2LJK A;  4POK A;  2TIR A;  1K0O A;  1VF3 A;  3LFL A;  3ZFL A;  4MDC A;  3BBY A;  3BJ5 A;  3KCM A;  5F07 A;  2RUE A;  1EP7 A;  4IN0 A;  3F6D A;  2M46 A;  1QFN A;  1TRS A;  4PNF A;  5JCU A;  4G9H A;  1I5G A;  2YWN A;  1TTZ A;  2R37 A;  1U6T A;  1R5P A;  1DE2 A;  4K0N A;  4LA1 A;  18GS A;  1F9M A;  4JZQ A;  3IAS 2;  4V2N A;  4ECJ A;  2O7K A;  4X0X A;  4H86 A;  2VAF A;  3PPU A;  2OJL A;  2OBI A;  2CX4 A;  1MDI A;  1BJX A;  2H70 A;  1BYE A;  3GUR A;  3GKN A;  4KND A;  3A2X A;  2N5B A;  4TW5 A;  4I97 A;  3N5O A;  5J4U A;  3IE3 A;  4HQZ A;  4FQU A;  2UZ8 A;  4DEJ A;  4LMW A;  1JLV A;  4HQS A;  4XIH A;  2DIZ A;  1YJ6 A;  2HI7 A;  1TRV A;  5D9W A;  2OA7 A;  2I1U A;  2JAC A;  2H0H A;  1M99 A;  3IPZ A;  2ALB A;  3MAK A;  1QXH A;  1VF1 A;  2VUP A;  4CY8 A;  3D21 A;  3FR9 A;  3G7J A;  3VWX A;  5EVO A;  4CHS A;  3CBU A;  2ZCT A;  3J7Y b;  4GCI A;  4NAX A;  1TI3 A;  2F9S A;  3QFA C;  4CDO A;  3HCZ A;  3RPP A;  3L78 A;  3KZQ A;  3C7M A;  2REM A;  2LJR A;  1AUC A;  1ERV A;  5CRE A;  2B7J A;  1GTA A;  4Q5Q A;  2BTO T;  3EMP A;  3UIW A;  2IME A;  4O92 A;  2HZF A;  4GLT A;  4GXZ A;  2XBQ A;  2FA4 A;  2DKI A;  4GST A;  4ECI A;  2OKA A;  5HR2 A;  3M9K A;  1ZYP A;  2YN1 A;  4AJ8 A;  1XWA A;  6GSU A;  4D73 A;  3EMX A;  3M8N A;  1Z6M A;  1K0C A;  4K2X A;  4X43 A;  2HRK A;  4KE3 A;  5DJM A;  3KD0 A;  4CY6 A;  3W8J A;  5CO3 A;  4K9Z A;  4TXO B;  2MYG A;  4ICY A;  2X99 A;  4MP4 A;  4I5Q A;  4KH7 A;  1U3A A;  2P5R A;  4HI7 A;  1K3L A;  4RUV A;  4WET A;  3NIV A;  1THX A;  5HR0 A;  4KW6 A;  4XCS A;  4MF6 A;  5LD0 A;  3E9J B;  4BWS A;  3K8N A;  4N30 A;  3HKR A;  2JSZ A;  4LMV A;  3DVX A;  5DCH A;  1N2A A;  2BJX A;  2H73 A;  4OCF A;  1XVW A;  2O85 A;  1ERT A;  4MZB A;  4PUA A;  4TKY A;  1M3I A;  2C0G A;  1G6W A;  2M72 A;  3TKS A;  2IMF A;  1PKW A;  1YEX A;  2DJK A;  3ZFB A;  1GTB A;  4ZBA A;  1IYH A;  5G5F A;  3BD2 A;  4BA7 A;  1U3I A;  4XRD A;  2X8H A;  1OC8 A;  2HT9 A;  1XFL A;  2L5O A;  2MMN A;  3GSS A;  3U6V A;  2IFQ A;  1G0T A;  4K8M A;  4J57 E;  1OC9 B;  1Z7P A;  2GQL A;  2LJA A;  2YZH A;  3CXG A;  3I69 A;  5AGY A;  1EOG A;  1TRU A;  3ME8 A;  1M2A A;  1GSE A;  3CTG A;  4OD7 A;  2FWG A;  3O3T A;  1GLP A;  1Z6N A;  3ZIT A;  4PUF C;  3TJF A;  5COH A;  2GZZ A;  3IR4 A;  4GSS A;  3EU3 A;  4J56 E;  2VIM A;  1GNE A;  4BL7 B;  5GSS A;  4P3Y B;  2JU5 A;  2DJ2 A;  2WGR A;  4NPB A;  3UVT A;  1PL1 A;  3QAV A;  2PVQ A;  2RUF A;  1K0A A;  2H1B A;  3QPM A;  5D9X A;  4HZ2 A;  4BWQ A;  5IO0 A;  5G31 A;  2FA8 A;  3OR5 A;  4YQM A;  3ZTL A;  2H66 A;  1ZGN A;  1JZW A;  2WS2 A;  2HRA A;  2PBJ A;  3IHQ A;  2AV4 A;  4ZBD A;  2CVB A;  1O73 A;  1ABA A;  3MIX A;  4WBJ A;  2VD1 A;  3D22 A;  3TKS E;  4GRF A;  1YEP A;  1A0R P;  3LXZ A;  1X9S B;  3GL5 A;  5IO2 A;  2GT5 A;  4BVX B;  2I3Y A;  2LRT A;  3MYD A;  3LGC A;  3FR3 A;  1PL2 A;  4IP1 A;  1T4Z A;  3PH9 A;  3P7X A;  1S3C A;  1OVN A;  3HYP A;  5IM9 A;  1DBY A;  1OKT A;  3KXO A;  1GUL A;  2LNS A;  2R4V A;  4XS4 B;  3APO A;  4ECC A;  3N9J A;  3A5I A;  4PQH A;  2KP2 A;  6GSW A;  1PX7 A;  4Z2R A;  1NSW A;  2L59 A;  3A5W A;  1T4Y A;  2YZU A;  4EL1 A;  4N11 A;  4TVE A;  2MMA A;  3FYG A;  1N8J A;  2HZE A;  2VCT A;  2R0P A;  5ECL B;  2XBI A;  4DVC A;  5IMZ A;  3HJO A;  1TKD B;  3BCI A;  1SYR A;  5H5Q A;  1GSY A;  3F4S A;  2G2Q A;  3KGK A;  3VFI A;  1GTI A;  1NW2 A;  3AY8 A;  3W6G A;  1FG4 A;  1WWJ A;  1PFO A;  2EIR A;  4RI7 A;  1SKR B;  1NHO A;  1V9W A;  4AJ6 A;  2C0F A;  5KN1 A;  2FNO A;  3TRX A;  1MDK A;  1XWC A;  1ML6 A;  1NHY A;  2X49 A;  4MCU A;  3GKM A;  3TKQ A;  4NHW A;  3Q19 A;  4KCE A;  2TRC P;  2WDU A;  1M0U A;  2IJY A;  3FHK A;  1F6M C;  1FW1 A;  2KUC A;  2FGX A;  4JR6 A;  1MD3 A;  1SK0 A;  2OE1 A;  2RLI A;  3GX8 A;  2VCQ A;  2L6D A;  2YAN A;  2WJU A;  3GMF A;  4O32 A;  1ZOF A;  4EO3 A;  2IMK A;  1EZK A;  5HR1 A;  2DBC A;  3APS A;  5HFK A;  4QQ7 A;  2C3N A;  2X4A A; 
#chains in the Genus database with same CATH homology
 4MA9 A;  2RII A;  2R3X A;  4PGT A;  2I9H A;  2JSY A;  2HYX A;  3ZL5 A;  3HHV A;  4DSR A;  2B5X A;  1A0F A;  1KTE A;  2M80 A;  5INY A;  2DJ0 A;  2VLT A;  2HRN A;  3U5R E;  4OFN A;  4G19 A;  3VI5 A;  4KA0 A;  3I9V 2;  2H6Z A;  2E2M A;  3F0I A;  3O76 A;  5CRG A;  1XOA A;  1S3A A;  5JWR B;  1F2E A;  3ZVJ D;  4IGJ A;  4OFM A;  4O5U A;  5ECS A;  1ERU A;  3VK9 A;  1MD4 A;  1X0R A;  5DDL A;  1XBS A;  3FW2 A;  4I6X A;  10GS A;  4KSO A;  2G0F A;  3FY7 A;  3BCK A;  2L4Q A;  1UC7 A;  3PR8 A;  4F0B A;  4EE0 A;  1ZYE A;  3EC3 A;  1M9A A;  4V1A g;  3LYK A;  5IPH A;  3ERW A;  3Q6O A;  1FVK A;  2MBS A;  4ML6 A;  3VPQ A;  1X9M B;  2E2G A;  2K8V A;  4F82 A;  3CYN A;  1B9Y C;  3TJJ A;  4O5Q A;  1W89 A;  3ZRE A;  4MJB A;  4L8E A;  2WZ9 A;  2PUK C;  5C04 A;  1TXX A;  3EYT A;  2C0E A;  3TOU A;  3LQ7 A;  4L0W A;  3DEX A;  3I43 A;  2DSA A;  3R3E A;  2VLU A;  1M2B A;  5A4W A;  1VF2 A;  4ZB6 A;  4XS4 A;  3MWH A;  1AW9 A;  3FK8 A;  2AYT A;  2ON5 A;  1ON4 A;  3CRU A;  3NZN A;  4D73 B;  4FYC A;  3TGZ A;  2BMX A;  4K7O A;  2L4C A;  4FYB A;  4MNN A;  1Z7R A;  4JED A;  3M1G A;  5ECP B;  5JWQ B;  5IPG A;  5HR3 A;  3UBL A;  2A2S A;  3TJG A;  2OAC A;  2H71 A;  2A2P A;  2JL4 A;  2YV9 A;  3VWU A;  1GLQ A;  2ZUP A;  5AN1 A;  5H5R A;  3KH7 A;  3TUE A;  1ZMA A;  5EPF A;  3G9B A;  6GSY A;  1W4V A;  3DIE A;  2IPA A;  2P31 A;  2P5Q A;  1RW1 A;  4IHU A;  4MJE A;  1B9X C;  5D73 A;  1ZYN A;  4PQ1 A;  3GHA A;  3H1N A;  4KGI A;  4LL1 B;  3TRP A;  2KLX A;  1ST9 A;  4GQF A;  1HYU A;  3LW9 A;  8GSS A;  3D6I A;  1VRS D;  1OAZ A;  2C0D A;  1HNB A;  4KCA A;  1MDJ A;  3IRA A;  3FZ5 A;  1GP1 A;  2R6K A;  11GS A;  2GSR A;  3CMI A;  3PIN A;  2QA1 A;  2GT6 A;  4ECB A;  1HQO A;  3WYW A;  3EU4 A;  3DVW A;  2IFQ B;  3F8U A;  5KN2 A;  1J9B A;  3D4M A;  3IOS A;  4TR4 A;  3HXS A;  4QL9 A;  2QA2 A;  3DWV A;  1PRX A;  4V2M A;  1QQ2 A;  1LU4 A;  2WUL A;  4MH2 A;  5B8B A;  2H72 A;  5DVB A;  1JZD A;  2ON7 A;  4IKH A;  3VI7 A;  2DJ3 A;  5IQY A;  2F3M A;  3GA4 A;  2NVL A;  3F6F A;  3P8W A;  1PX6 A;  1OC3 A;  5J5N A;  2PMT A;  1V2A A;  3QAG A;  3HJP A;  9GSS A;  5KOX A;  3V1W A;  1DE1 A;  3ZMK A;  3D0Z A;  4JBB A;  12GS A;  4MF5 A;  3KM6 A;  4XS1 A;  3UAR A;  2B7K A;  4X1U A;  4PNG A;  1T7P B;  2OE0 A;  4ISD A;  2VL2 C;  5FHI A;  2B5Y A;  5DAK B;  1G6Y A;  1R5A A;  3CSH A;  2ES7 A;  4ZXG A;  2MBT A;  1PQN A;  3IK7 A;  3CRT A;  4Z7X A;  1V58 A;  5KN3 A;  4USS A;  5KEJ A;  1ILO A;  3A3T A;  3DXB A;  4I2T A;  5F0G A;  1K0D A;  5D8I A;  4WR5 A;  4HUA A;  5G30 A;  4V2L A;  3IV4 A;  2QC7 A;  2YP6 A;  1FOH A;  4KDY A;  3C1R A;  3TKR A;  2CA8 A;  3F63 A;  3EUR A;  3QDN A;  3A2V A;  3VUR A;  3DRN A;  4IJI A;  3TCO A;  1O81 A;  2HSH A;  1KEB A;  2HZE B;  3M3M A;  2C3Q A;  5ECK B;  3C1S A;  1T3B A;  3KIJ A;  4HU9 A;  5HQP A;  2HNL A;  17GS A;  3L4N A;  2O89 A;  5BMU A;  1GSQ A;  3F9U A;  13GS A;  6GSS A;  2H19 A;  3RAZ A;  4AGS A;  4KX4 A;  2VCZ A;  1GWC A;  2DC5 A;  4WEY A;  2HXK A;  4EDZ A;  5DAL B;  4JU5 A;  5D93 A;  3QCP A;  3RBT A;  3ISO A;  4GWR A;  2PGT A;  3RHC A;  4YKG A;  3APQ A;  1TK5 B;  1G7O A;  4G0K A;  1KNG A;  1URM A;  3ERG A;  2DIY A;  2FWF A;  2H30 A;  3WGX A;  4N0V A;  1XW5 A;  3A2W A;  2VL3 A;  1B4P A;  4N10 A;  4F0C A;  4MMM A;  3EWL A;  3CSI A;  2K18 A;  2YJH A;  4J2F A;  3DML A;  1FO5 A;  1AIU A;  3CSJ A;  5FT3 A;  5ECQ B;  2KHP A;  6GST A;  3ZML A;  4KAE A;  3GTU A;  3TKP A;  4E8H A;  1AQW A;  2PWJ A;  4MH3 A;  3W8S A;  2B1K A;  2PER A;  1XXU A;  4ILF A;  4FYU A;  7GSS A;  1PN0 A;  4IJ3 A;  5J41 A;  5GAP D;  3GN3 A;  4ZL9 A;  1Y25 A;  2V32 A;  3KJY A;  4KDU A;  3PGT A;  3FR6 A;  4POM A;  2GS3 A;  2XC2 A;  2XPE A;  2J9H A;  4BVY A;  2CV4 A;  2H1D A;  3GIX A;  3S9F A;  3FZ4 A;  4K6X A;  4GSN A;  1USB A;  1GSU A;  2VM2 A;  5DAK A;  2CAI A;  5JWO B;  1V40 A;  2KP1 A;  1SL1 B;  1X5C A;  4MF7 A;  5LNK e;  2V41 A;  1K3Y A;  3L9S A;  5AIV A;  3WGD A;  4O7H A;  1K0N A;  1XCC A;  1I9D A;  14GS A;  3D5J A;  2B1L A;  4AF2 A;  2OBK A;  2MZC A;  3CTF A;  5GST A;  2E7P A;  4N0Z A;  4QL7 A;  4HJM A;  3SBC A;  1F3A A;  1CQH A;  4DSQ A;  3KMO A;  1EWX A;  4IBP A;  4ULX A;  1NM3 A;  1A8L A;  1F37 A;  1ERW A;  3HJM A;  2HSM A;  4K2D A;  4NXI A;  1RK4 A;  3DGQ A;  4PX1 A;  4E8E A;  2GVP A;  3HY2 A;  3MNG A;  3TOT A;  2F8A A;  3TRQ A;  1V98 A;  2PN8 A;  5DQY A;  5IMC A;  2TRX A;  2QGV A;  2VO4 A;  4TR0 A;  1TK8 B;  2A4V A;  1X5D A;  2K9F A;  5DAL A;  1H4O A;  4IP6 A;  2D2Z A;  4IQ1 A;  1YKC A;  1BG5 A;  1FB6 A;  1XZO A;  3ZIV A;  4IQA A;  2VL2 A;  3I6A A;  3WT1 A;  2NDO A;  1K0B A;  5CAX A;  3E3E A;  1B4Q A;  3FZ9 A;  2XHF A;  3IK9 A;  2FY6 A;  1EEM A;  3WGE A;  4XRA A;  3UEM A;  2OE3 A;  1TW9 A;  1Z3E A;  2CZ2 A;  3TJB A;  1SD8 A;  3MSZ A;  2YNX A;  5IMV A;  2A4H A;  4KDX A;  5G1L A;  4TR1 A;  2HE3 A;  4OO5 A;  4POL A;  4EVM A;  3EPT A;  1SJ6 A;  4F03 A;  2H6Y A;  1ZYQ B;  4HS1 A;  5KN0 A;  4L5O A;  5CRW A;  5ECH B;  2YWM A;  4Q5R A;  4KUN A;  3FZA A;  3C71 A;  1IYI A;  4HU7 A;  1OE7 A;  2MMO A;  2LQQ A;  4YAP A;  5G2Z A;  3IAM 2;  5DQS A;  1JHB A;  3DKS A;  3LOR A;  2V1M A;  2DLX A;  1QUW A;  5E4W A;  4ZIJ A;  4ML1 A;  1O8W A;  1E6B A;  2B3S A;  3Q74 A;  2QSI A;  5L71 A;  4PTS A;  2AJQ B;  1TDI A;  2X8C A;  1C72 A;  1T00 A;  2H75 A;  4TOP A;  3O6T A;  2R5G A;  3UJ1 A;  1GH2 A;  4MPG A;  1YQ1 A;  2IMD A;  5DBQ A;  4ACS A;  1SYX A;  16GS A;  1BQ7 A;  1PA3 A;  3C73 A;  2GGT A;  1VF4 A;  4EIP A;  4YQV A;  2B5E A;  4NMU A;  3HZ4 A;  2CAQ A;  2MMZ A;  4K7N A;  1HNC A;  1O85 A;  2CVD A;  4O5R A;  1XIY A;  3GX0 A;  5F8B A;  4F9Z A;  2FUG 2;  4RQR A;  3GUS A;  3VPT A;  1SJI A;  2IN3 A;  3F3Q A;  1GUH A;  5ECN B;  5IMA A;  3FRC A;  4K7I A;  4TN8 A;  1THO A;  1SKW B;  1XPV A;  1A2J A;  3ME7 A;  1RQM A;  3RHB A;  5D96 A;  1MTC A;  4XS6 A;  2CVK A;  2IL3 A;  2GDR A;  3GFK A;  2AHE A;  4GTU A;  1EOH A;  1GNW A;  4K5R A;  4KB3 A;  3H8Q A;  4BPY A;  5ECR B;  1MEK A;  1M2D A;  4EF0 A;  1Z9H A;  2FWH A;  1YF1 A;  2GSS A;  2HSY A;  2L6C A;  3UMA A;  2OAD A;  2GLR A;  4NV5 A;  4Z2T A;  4EKZ A;  2O87 A;  1X5E A;  5ECI B;  3GKX A;  3KTB A;  2N5A A;  1AC1 A;  1XOB A;  3FMW A;  4WF5 A;  2QKE A;  1U88 A;  1TU7 A;  2O8V B;  2LKU A;  5BRT A;  1JZO A;  3TJK A;  4G2E A;  4YKF A;  4FIW A;  4DSS A;  1A2M A;  4OMV A;  1YDK A;  3FEU A;  1T1V A;  3G7I A;  2C3T A;  3HZ8 A;  1M9B A;  3D4T A;  1SU9 A;  1OE8 A;  3LEF A;  3IBH A;  4ID0 A;  1FB0 A;  1VGL A;  1EP8 A;  3J7Y k;  1GSD A;  3GTU B;  4LLR A;  5CRD A;  1PGT A;  1BX9 A;  2X64 A;  2YOI A;  5F06 A;  5DCG A;  5HFG A;  4ZB8 A;  2LNT A;  4IVF A;  4RI6 A;  4ZIL A;  3F4R A;  1GUM A;  4NV2 A;  2C1Y A;  2H01 A;  1GL8 A;  2J23 A;  4Q5N A;  3LG6 A;  2WB9 A;  3VLN A;  2R0G A;  2F8F A;  1YF0 A;  2PPT A;  3GH6 A;  1CQG A;  2C4J A;  5GZZ B;  3IC4 A;  2JZS A;  4BVY B;  5KOW A;  1UVZ A;  1QMV A;  2JZT A;  1TJD A;  2C8U A;  4OO4 A;  3JCM L;  2H76 A;  1AQX A;  2PU9 C;  1J0F A;  4RQX A;  1T8E B;  2H74 A;  4ZB9 A;  2FHE A;  2LRN A;  3UAP A;  1YKA A;  5ID2 A;  4YQU A;  1J08 A;  1PN9 A;  1O7U A;  3LYP A;  4HZ4 A;  1FAA A;  1R26 A;  4GF0 A;  2GTU A;  1UA5 A;  1WP0 A;  1XWG A;  1JZR A;  4IEL A;  5B8A A;  4L0U A;  1WE0 A;  2H1G A;  1Y6E A;  2VCV A;  5EL8 A;  2ZNM A;  5GAN D;  2V6K A;  4MJA A;  4L5L A;  2LST A;  4WBR D;  5JCG A;  4IS0 A;  5FWG A;  4GQC A;  4WKW A;  2EIQ A;  5G1K A;  4YH2 A;  2LUS A;  4EXJ A;  3R2Q A;  1EGO A;  4NHZ A;  2YJ7 A;  1Q4J A;  2EC4 A;  3QOU A;  2DJJ A;  2R2J A;  1JFU A;  2CQ9 A;  5ELA A;  2R0C A;  1GRX A;  5H5S A;  1K3O A;  5DJL A;  4OWY A;  3IA1 A;  4YAV A;  3E0U A;  4ZL8 A;  2HLS A;  2GQK A;  3H79 A;  2K8S A;  2H0I A;  5IIZ A;  1LJR A;  3UL3 A;  5AIX A;  2DJ1 A;  1EEJ A;  3VWW A;  5J9B A;  3ED3 A;  4EC0 A;  1XWK A;  5ECM B;  3HA9 A;  3Q18 A;  2Z9S A;  3GYK A;  1JLW A;  2V6O A;  4JRR A;  5ELG A;  4LL4 B;  4TR1 B;  1A24 A;  3LSZ A;  2YCD A;  2VM1 A;  4KSM A;  1WIK A;  3GH9 A;  4K1F A;  3GV1 A;  3M0F A;  5J9C A;  3IDV A;  1V57 A;  20GS A;  2IIY A;  1B8X A;  2X8G A;  1EV9 A;  4Z2U A;  5CNW A;  2L57 A;  1H75 A;  1TK0 B;  1WJK A;  4PUR A;  3QAW A;  2VOC A;  4OCE A;  1ZL9 A;  5A5K A;  1F3B A;  2FCH A;  1XW6 A;  2YWO A;  1M7T A;  1XW9 A;  4PXO A;  2NTO A;  4PQI A;  1U87 A;  1R7H A;  5B7C A;  2VD0 A;  4TXV A;  2WCI A;  1SJZ A;  1LBK A;  2GST A;  1A23 A;  2CT6 A;  2VCX A;  3L9U A;  4MJC A;  5B6N A;  1FHE A;  1Q98 A;  2AB6 A;  1UN2 A;  1KBN A;  2B6M A;  4HJ2 A;  2EIO A;  1TRW A;  3KH9 A;  4G10 A;  3L9V A;  5E59 A;  1ZZY A;  5D9V A;  1G7E A;  5CRH A;  3IHG A;  3KP9 A;  3ZZX A;  2IMI A;  6GSX A;  2NBS A;  4HEA 2;  2FLS A;  3TB2 A;  5B6M A;  3GL3 A;  2N5F A;  1B48 A;  5IOW A;  2LV3 A;  2LRC A;  4JR4 A;  4TR3 A;  2A2R A;  3ERF A;  1SK2 A;  1ACV A;  3TDG A;  2YV7 A;  2CX3 A;  1GSS A;  2KOK A;  4KF9 A;  5LCZ A;  1A8Y A;  2K6V A;  1TOF A;  5D9T A;  2JZR A;  1X9W B;  5EY6 A;  1FVJ A;  3VWV A;  4XTS A;  1WMJ A;  1AXD A;  2FD3 A;  5J3R A;  1R4W A;  3GRX A;  1E2Y A;  2VCW A;  2F51 A;  5IOX A;  3F4T A;  4FH8 A;  3ZYW A;  3HDC A;  2HFD A;  1TI1 A;  3IC8 A;  4WXT A;  2RM6 A;  3HVV A;  5CP1 A;  4MAB A;  1PD2 1;  5ABR A;  3ZIJ A;  1S3D A;  4TXO A;  1WOU A;  1YZX A;  2FWE A;  4F2I A;  1YY7 A;  3G7Y A;  3P90 A;  3H4K A;  1AQV A;  2AUV A;  4HOJ A;  2WRT A;  4DSS B;  1BED A;  4IW9 A;  1Z5Y E;  2H8L A;  3US3 A;  3EIN A;  2PVO C;  5A4V A;  4HDE A;  4MZW A;  1ZCP A;  4AJ7 A;  1K0M A;  3BOA A;  4MK3 A;  1XVQ A;  2XPD A;  22GS A;  5ENU A;  3KP8 A;  5HFI A;  5IMD A;  3MDK A;  3RPN A;  2V2G A;  3ZLP A;  4POB A;  2DMM A;  1PMT A;  4A5P A;  5CYY A;  2HRF A;  1PSQ A;  4G0L A;  4WF4 A;  5F05 A;  3QFB C;  2RM5 A;  2VLV A;  1A2L A;  2YPM A;  3L0H A;  3LWA A;  1OC9 A;  2LTK A;  2L5L A;  3C8E A;  5JCW A;  3UVH A;  1TU8 A;  2LS5 A;  1GTU A;  3QR6 A;  3F3R A;  3EE2 A;  2IWT A;  2C80 A;  3LJR A;  4ZBB A;  4Q5F A;  4MLY A;  3HVS A;  4K5S A;  4ZL7 A;  3ZVJ A;  2LEG A;  3EVI A;  4V1A p;  5ECO B;  1SD9 A;  2YWI A;  3DYR A;  4BL7 A;  3HD5 A;  2GZP A;  2H0G A;  1BAY A;  5AIS A;  1O6J A;  4EIQ A;  2I81 A;  5IMF A;  2NPB A;  2GZY A;  3QMX A;  2LQO A;  3HVX A;  1XWB A;  4OFT A;  1SEN A;  3LXT A;  5ID2 B;  19GS A;  4CW9 A;  2H1A A;  4MZC A;  3GKK A;  3TKS C;  1GUK A;  3UBK A;  1GSF A;  2H6X A;  4X4J A;  1SL2 B;  3WT2 A;  3GST A;  1PKZ A;  2CZ3 A;  4BVX A;  4FO5 A;  2I4A A;  4I8B A;  3QD9 A;  4WR4 A;  1WRY A;  1SKS B;  3M9J A;  1WPI A;  3SWL A;  3IXR A;  6GSV A;  4G0I A;  3WD6 A;  3NOF A;  1EGR A;  1EV4 A;  1QK8 A;  3DD3 A;  2GSQ A;  1QGV A;  2P0G A;  4MPF A;  2DML A;  2E0Q A;  3KMN A;  5A4U A;  3KTL A;  4JE1 A;  1OYJ A;  4TRX A;  5C00 A;  3H93 A;  1TP9 A;  4NWY A;  4XHM A;  3UOM A;  3ZRD A;  3FKF A;  1FOV A;  2VL9 A;  2WFC A;  1OKD A;  1HNA A;  1AAZ A;  5G5E A;  1DUG A;  4EUY A;  2AAW A;  1DSB A;  3P2A A;  1SK1 A;  2JAD A;  4K0G A;  2DKH A;  3RDW A;  4I2U A;  4EDY A;  1O8X A;  3KEB A;  2GQM A;  1HD2 A;  3GNJ A;  1SL0 B;  2LJK A;  4POK A;  2TIR A;  1K0O A;  1VF3 A;  3LFL A;  3ZFL A;  4MDC A;  3BBY A;  3BJ5 A;  3KCM A;  5F07 A;  2RUE A;  1EP7 A;  4IN0 A;  3F6D A;  2M46 A;  1QFN A;  1TRS A;  4PNF A;  5JCU A;  4G9H A;  1I5G A;  2YWN A;  1TTZ A;  2R37 A;  1U6T A;  1R5P A;  1DE2 A;  4K0N A;  4LA1 A;  18GS A;  1F9M A;  4JZQ A;  3IAS 2;  4V2N A;  4ECJ A;  2O7K A;  4X0X A;  4H86 A;  2VAF A;  3PPU A;  2OJL A;  2OBI A;  2CX4 A;  1MDI A;  1BJX A;  2H70 A;  1BYE A;  3GUR A;  3GKN A;  4KND A;  3A2X A;  2N5B A;  4TW5 A;  4I97 A;  3N5O A;  5J4U A;  3IE3 A;  4HQZ A;  4FQU A;  2UZ8 A;  4DEJ A;  4LMW A;  1JLV A;  4HQS A;  4XIH A;  2DIZ A;  1YJ6 A;  2HI7 A;  1TRV A;  5D9W A;  2OA7 A;  2I1U A;  2JAC A;  2H0H A;  1M99 A;  3IPZ A;  2ALB A;  3MAK A;  1QXH A;  1VF1 A;  2VUP A;  4CY8 A;  3D21 A;  3FR9 A;  3G7J A;  3VWX A;  5EVO A;  4CHS A;  3CBU A;  2ZCT A;  3J7Y b;  4GCI A;  4NAX A;  1TI3 A;  2F9S A;  3QFA C;  4CDO A;  3HCZ A;  3RPP A;  3L78 A;  3KZQ A;  3C7M A;  2REM A;  2LJR A;  1AUC A;  1ERV A;  5CRE A;  2B7J A;  1GTA A;  4Q5Q A;  2BTO T;  3EMP A;  3UIW A;  2IME A;  4O92 A;  2HZF A;  4GLT A;  4GXZ A;  2XBQ A;  2FA4 A;  2DKI A;  4GST A;  4ECI A;  2OKA A;  5HR2 A;  3M9K A;  1ZYP A;  2YN1 A;  4AJ8 A;  1XWA A;  6GSU A;  4D73 A;  3EMX A;  3M8N A;  1Z6M A;  1K0C A;  4K2X A;  4X43 A;  2HRK A;  4KE3 A;  5DJM A;  3KD0 A;  4CY6 A;  3W8J A;  5CO3 A;  4K9Z A;  4TXO B;  2MYG A;  4ICY A;  2X99 A;  4MP4 A;  4I5Q A;  4KH7 A;  1U3A A;  2P5R A;  4HI7 A;  1K3L A;  4RUV A;  4WET A;  3NIV A;  1THX A;  5HR0 A;  4KW6 A;  4XCS A;  4MF6 A;  5LD0 A;  3E9J B;  4BWS A;  3K8N A;  4N30 A;  3HKR A;  2JSZ A;  4LMV A;  3DVX A;  5DCH A;  1N2A A;  2BJX A;  2H73 A;  4OCF A;  1XVW A;  2O85 A;  1ERT A;  4MZB A;  4PUA A;  4TKY A;  2C0G A;  1G6W A;  2M72 A;  3TKS A;  2IMF A;  1PKW A;  1YEX A;  2DJK A;  3ZFB A;  1GTB A;  4ZBA A;  1IYH A;  5G5F A;  3BD2 A;  4BA7 A;  1U3I A;  4XRD A;  2X8H A;  1OC8 A;  2HT9 A;  1XFL A;  2L5O A;  2MMN A;  3GSS A;  3U6V A;  2IFQ A;  1G0T A;  4K8M A;  4J57 E;  1OC9 B;  1Z7P A;  2GQL A;  2LJA A;  2YZH A;  3CXG A;  3I69 A;  5AGY A;  1EOG A;  1TRU A;  3ME8 A;  1M2A A;  1GSE A;  3CTG A;  4OD7 A;  2FWG A;  3O3T A;  1GLP A;  1Z6N A;  3ZIT A;  4PUF C;  3TJF A;  5COH A;  2GZZ A;  3IR4 A;  4GSS A;  3EU3 A;  4J56 E;  2VIM A;  1GNE A;  4BL7 B;  5GSS A;  4P3Y B;  2JU5 A;  2DJ2 A;  2WGR A;  4NPB A;  3UVT A;  1PL1 A;  3QAV A;  2PVQ A;  2RUF A;  1K0A A;  2H1B A;  3QPM A;  5D9X A;  4HZ2 A;  4BWQ A;  5IO0 A;  5G31 A;  2FA8 A;  3OR5 A;  4YQM A;  3ZTL A;  2H66 A;  1ZGN A;  1JZW A;  2WS2 A;  2HRA A;  2PBJ A;  3IHQ A;  2AV4 A;  4ZBD A;  2CVB A;  1O73 A;  1ABA A;  3MIX A;  4WBJ A;  2VD1 A;  3D22 A;  3TKS E;  4GRF A;  1YEP A;  1A0R P;  3LXZ A;  1X9S B;  3GL5 A;  5IO2 A;  2GT5 A;  4BVX B;  2I3Y A;  2LRT A;  3MYD A;  3LGC A;  3FR3 A;  1PL2 A;  4IP1 A;  1T4Z A;  3PH9 A;  3P7X A;  1S3C A;  1OVN A;  3HYP A;  5IM9 A;  1DBY A;  1OKT A;  3KXO A;  1GUL A;  2LNS A;  2R4V A;  4XS4 B;  3APO A;  4ECC A;  3N9J A;  3A5I A;  4PQH A;  2KP2 A;  6GSW A;  1PX7 A;  4Z2R A;  1NSW A;  2L59 A;  3A5W A;  1T4Y A;  2YZU A;  4EL1 A;  4N11 A;  4TVE A;  2MMA A;  3FYG A;  1N8J A;  2HZE A;  2VCT A;  2R0P A;  5ECL B;  2XBI A;  4DVC A;  5IMZ A;  3HJO A;  1TKD B;  3BCI A;  1SYR A;  5H5Q A;  1GSY A;  3F4S A;  2G2Q A;  3KGK A;  3VFI A;  1GTI A;  1NW2 A;  3AY8 A;  3W6G A;  1FG4 A;  1WWJ A;  2EIR A;  4RI7 A;  1SKR B;  1NHO A;  1V9W A;  4AJ6 A;  2C0F A;  5KN1 A;  2FNO A;  3TRX A;  1MDK A;  1XWC A;  1ML6 A;  1NHY A;  2X49 A;  4MCU A;  3GKM A;  3TKQ A;  4NHW A;  3Q19 A;  4KCE A;  2TRC P;  2WDU A;  1M0U A;  2IJY A;  3FHK A;  1F6M C;  1FW1 A;  2KUC A;  2FGX A;  4JR6 A;  1MD3 A;  1SK0 A;  2OE1 A;  2RLI A;  3GX8 A;  2VCQ A;  2L6D A;  2YAN A;  2WJU A;  3GMF A;  4O32 A;  1ZOF A;  4EO3 A;  2IMK A;  1EZK A;  5HR1 A;  2DBC A;  3APS A;  5HFK A;  4QQ7 A;  2C3N A;  2X4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...