2AJUH

Cyrstal structure of cocaine catalytic antibody 7a1 fab'
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
EVKLSESGPGLVKPSQSLSLTCTVTGYSITTNYAWTWIRQFPGNKLEWMGYIRSSVITRYNPSLKSRISITQDTSKNQFFLQLNSVTTEDTATYYCARYDYYGNTGDYWGQGTSVTVSSAKTTPPSVYPLAPGTAALKSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY 7A1 FAB'
publication title Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajuH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajuH01
3VFRB 4OLUL 2A77H 3RUGA 5JA9A 2X4QA 4UIKL 5F21B 1KPVA 3EBAA 3RNQA 3WDJA 2CUHA 3V4UH 1QSEB 3WUWA 4G6ML 3VGFA 3CCHB 1F90L 2IQ9H 1YEKH 3VFTA 4BZ2L 2ADFH 3QRGH 2OZ4L 4NN7C 2VXQH 3EHBC 5CZVL 3SDAC 1A6WH 5GGSA 4NWTL 3ZTNH 4TVPD 3SE8L 4TNWK 3EYQD 4M6NL 2AVGA 4CMMA 2R4RL 3MZGB 1URLA 2IFGA 4X5WB 3QIBD 4ORGA 3QEHB 1Q0YH 4ODXB 1K5NA 3W9EA 1WFTA 4G8EA 1MLCB 2NYYC 1NJ9A 5CP3H 1LK2B 4X4YB 4MJIB 2H26A 3ALWA 1DSFH 4PRPA 5C09E 2AV1B 2FD6H 5EC2A 5T1KB 3LHPL 1ITCA 4WW2B 2IQAA 4LF3A 1NCBL 15C8L 4JVWA 4WFGD 1MFDL 4KK8C 4XNXH 3T2OA 3WE6A 1U8LB 2CKNA 2FX8L 3BP7B 5F6IC 3V5HB 3MACL 3BI9X 3MCKB 4MJ6B 5TPWH 2XN9B 1FFQA 2EECA 3K2UH 3DYMA 2EO1A 3RWIB 3HG1E 4U3CA 4M43L 4Z8FL 3NZHL 2AV7B 3DX8B 5HGGS 2J6EL 4P2QE 2P8LA 4LCIH 1OP5H 5ETUA 3S5LB 4FNLH 4OLZH 3LS5H 4M5YL 4HK3N 1U58A 3RAJL 3AMLA 3G08A 5HGBA 4PJDE 3CH1A 4IRJA 3FOMA 1ZLSL 4NN5C 4P99A 3ARBD 2HJLB 4HCRH 2ESVD 4G6JL 4EVNB 1QNZH 4I4WB 2R56L 3TNMB 1BBDH 2NXYD 4H20H 4YHZL 3LKPB 1YMMA 1JIBA 1PKQE 3WXVH 4TNVK 4L3EB 3RWCA 4V1DA 4ERSL 3O2DL 1CI5A 1N3NA 1G7QA 2FWOB 2DQTH 5DT1L 1T0NB 1KPUB 2VL4A 2VE6A 3TO4C 1EBAA 4IRZH 1AIFB 2PF6A 3O45B 4HUXA 4WV1A 1I85A 5CILL 3TBSA 5EUOF 4WHYG 5KVFL 3X3GH 1WUNT 3O6ML 2OSLB 1C5DA 3SE3C 3QI9C 1T83C 1XEDA 3D2UD 4YLQT 4OGYL 4Z95H 1S9XA 4XB8A 3VD5A 2C7UB 3HNTL 1CWVA 1QSZA 1NDGB 3K8MA 1KIPB 3MGAA 4P3DA 1MJUL 2XQBH 1KCUL 1HQ4B 2EDOA 2OTUA 5F7HA 2V7HB 2ZPKH 3VRIA 1NEZA 1W72H 4NP4L 4TTGA 4K8RL 4U6YB 5BMFL 1NL0H 5GQBA 1JBJA 4NYLA 3RTQB 1GHFL 5AG8A 3T0AA 3JTTA 3MZTA 4YHLH 3GDBA 3BKCL 1P84K 4YZFE 1JPTH 2AERT 2EDDA 4JFFB 2F9BT 4OJFH 1F58H 3NMEA 3UAJD 3F58H 3D87B 4KROC 3WS3A 4OD3H 3WNLA 1N4XL 3STZA 1YECL 2AABH 4YPGB 1BVKA 1MIEL 1J10A 1I8IA 2P42B 5IIEB 1VPOL 2R2EB 4JZOB 3MUGB 1Q94A 5GS1B 4XP1L 3H3BC 4EIGB 3BIAX 2C1OB 1T7XA 2JK5B 1T2QL 3FB5B 4HXAH 4OLEA 3GSWA 4C4KT 1FV1B 1I1FB 2CDFB 4RNRA 4BM7A 4HLJA 2WINA 2J88L 4R26H 1JMZA 4UI2A 4LAJH 4P5TB 1NFDB 3PWLB 2OJZL 3CFJA 3MUY1 4EI5A 2HAZA 3G5YB 3S9DB 4ZUWA 1CDHA 4PYGA 3GNMH 2HYMA 4HLZG 3WL9B 4GRWH 5HHOE 1UM5L 1UM4L 4J3UA 5L2JB 1KPRB 2E9WA 2HA1A 4NBYB 3CX2A 1HH9A 3U4EB 4WUUA 4YGAB 1RJLB 4GAJL 4ZNEE 3M1BB 4K3EH 1AKJB 3HPLB 3OGCA 1JNNH 1PQZB 2FIKB 3ECBB 2BVPB 2LU3A 4JO1L 1ZVHA 4WFED 2QKIB 1FGNH 4X6BA 5D93B 1M7XA 3WFBL 2D7TH 2YPKB 2VXTL 3MV8E 3TBVA 1S8DA 2B4CC 3F65A 4M5ZH 1EJ6A 4U1NB 4JFXA 3AXLA 3CLFL 1Z0MA 3WFZA 5MEND 5JO5A 1JVKA 4F9PC 5A1AA 1NMCC 3CFCH 5T3ZL 3UTPD 3HI6L 2OLDA 5EUKA 4MXWL 4DN4L 5HSFA 2AQ2A 1EO7A 4PJEE 3UPCA 2M2DA 1UJ3A 4ZDHB 4PJCB 3CD4A 4I3SL 4RDQF 2YN5A 2RFXA 3KPPB 5DZOA 1Z6JT 4KTEL 3TC9A 1N64L 2W9EL 3B5TA 5ICYB 1J18A 2WAHA 2YSSB 5HI3C 3UTTA 5H37G 1BZ9B 2NY2C 4KTDH 1AQDB 1REIA 4JFDB 3TVMB 1F6LL 2IMMA 4NO2A 4P5KB 1Z3GH 4M1CC 5L6YH 5JW5A 2YD1A 4RFEA 2R0LH 2VLJD 2HN7B 4GSDH 2AK4E 5I2IB 1GVIA 3QIWD 5I1EL 2GQHA 1F02I 1T5XB 3UJTL 5EZJB 4Z5RA 4HUUA 4JHBA 3VXRD 2ZCLH 2VKXA 3HZYB 3GMMA 4YBLB 2R2HA 1E6OH 2FB4L 3NTCH 3O6FA 4NQCE 2AEPH 2QQLH 2J8UB 3N1GC 4PG2C 2NY3D 1EFQA 3DHMA 5IVNA 1A7RL 2UWEF 2ZNXA 4JRXD 3EDDA 3UYPA 1TFHA 1P7KA 3A67L 1CFQA 1FL6A 5MENE 1FRGH 5HHME 4CU6A 2WLYA 2HT3C 5GS0D 1SJEB 4OZFG 5FYLH 4JRYA 4DGYH 1G7MB 4MQSB 5D7JD 2OP4H 4L8SA 2CR6A 5D1ZB 1WBYA 1NMAL 1G7PB 3MRQB 1N59A 3FQTB 3L3JB 3MREA 3JWDL 2MCG1 4ZO9A 4NC1E 1OLZA 4UQ2A 3GSNH 4PD4J 1AD0A 4I0PC 4YDIH 1MJJB 5F1SA 1MFEH 3V6ZB 4LASL 4MDJA 4ETQA 1J11A 2UZIH 3KPNA 1OL0A 1HI6B 4BFIB 2NY6C 1SYSB 4MDIA 4YEEA 4P2RA 4XP4L 3ZTJG 1VFBA 1IFHH 2GITB 5MP6L 2P1YA 4JN1H 4WU7B 4DW2L 2VLJE 5AAMA 5JMOC 4I2XA 1EIBA 9CGTA 5B8CC 4HULB 1MY7A 1EMTL 3DMMD 2X9WA 4HH9B 4PJBB 5EIQA 2WWKO 3BE1L 2D0FA 1HILB 2DQEH 3ZHDA 3TF7C 3KS0H 1DBAL 1MI5B 4NQTA 2GTZB 1HHKB 3IDGA 4NM4H 1G0DA 5HYJA 3HUJE 4OD2A 5MEOB 2LE9A 3NACL 3NFSH 4XVUD 2VWEC 3BZFA 4OIAA 3Q6GH 5BXFA 5HBBA 2CKBB 2Z92B 2IGFL 4JZNB 1U6AL 3H6JA 3BOVA 3QG6B 2YKLH 5F7LB 4YXHL 4RRPG 2F8OA 1Z9MA 4PJDB 1UB6B 3ARDC 1UXSA 2MHAB 2NY4C 2YBRB 3KLSA 3EZJB 3L3GB 2EDTA 5DK0A 1CFTA 1RULH 3NA9L 1AO7A 2MNUA 2MSPA 1YEJL 12E8L 4CN6A 4HS8L 2XV6B 5IW1A 1A7OH 1PKQB 1IC5H 1RJZA 2P8MB 3KPMA 4ISVB 2DIAA 1YC8A 2AP2A 4NRXB 2NMSA 3DVGA 1KIQB 1CLOH 5BO1L 2MQCA 4NDMB 3HPJB 1JWMA 5CIPH 4XP6L 5IVOA 2GUOB 4XRCA 3QUMA 4GLRI 1FFOB 3IKCB 1PY9A 3DX9A 4MAYC 1EXUA 4G6FD 4L9LA 4XTRD 1CLCA 4OI7A 3D39E 5DUPL 2ATKA 3REVA 3FQNB 3QXDB 1CZ8H 1RZFH 3K8KA 1HIML 4L8BA 3HS0A 4DZ8A 4RCAA 4K3JH 1K3ZA 4PJ5A 1YJDL 3BYTA 5A2IH 1RUAH 5D1XB 1MREL 2K7PA 1B3JA 5KTEL 3RPIA 4C57C 5D6CB 3CGTA 3BPOC 2CLVB 5IFJB 5ADOL 5LXGL 1WZMA 2PO6C 5IVXA 1LO3L 5C0DA 1K3IA 3T3MF 1K4DA 4PJ7F 1ACYH 5K9OA 3IDYC 5IOPA 1QO3B 2IANE 1R3IL 5SWZA 4YHIB 2BNQA 4ODSL 2DD8H 5E9DD 2FLBT 3QQNA 5FYKD 2BK8A 1J86A 1MHCA 4JM2A 1M6OA 3EDFA 1LO4H 2I07B 1T7ZA 1KF9B 4HIIA 1JWSB 2ARJA 4C59B 2AI0L 4O4YL 1M1SA 3MBEA 4QRPB 5KVDL 3T65A 5MHSE 1JGDB 1IC4L 3KPSA 1INDL 5CP3A 4R4FL 3ESVF 3OBAA 4XHJD 4YXKL 1FFNB 1D9KD 2JJTA 3T4AA 4PJGA 1T4KB 3W0WA 3SCMA 2H3NB 1HEZB 2V5MA 3H3PL 2P24A 4F7PA 1T0PB 2H2SD 5F1KC 3EO1B 1QRKA 2W65B 4UINL 4QCIA 4YGVA 2DDQL 3JV6B 1NBVL 1PD6A 3X12B 5DMKA 5HHOB 1L7TL 3MLUH 5A2FA 5DJ8A 5TH2B 5BCAA 4KI5C 4M6OH 3M45A 2H6PB 4NZRL 1I9RH 4HW6A 5E8OB 5EBMA 5I76A 2I26N 4OAWA 2E3VA 5IJKC 1LQSR 3NABH 2OL3B 3HI1B 3DTXB 5IG7A 4XHQA 3H42L 4H8WL 4WENB 1JHTA 3MJ9L 3V8OA 3QUYC 4GAGH 3T2NL 1J8HB 3HMXH 1X4YA 3IFLH 7FABH 3CU1A 2BVUA 4YHNA 4N9GA 3K7UA 3IRZA 4BZ1L 4URTB 3RA7H 1B0WA 1OARL 4HCRA 4HK3J 1IQDB 3RJDA 4MB5A 3AC0A 2F74B 3DVNB 3AM8C 5JDSB 3CSBA 4NJ9L 3S35H 3DV6A 3MX0A 3A6CL 5DD3L 2YRLA 1RHFA 5GIRA 5LGHH 4K94L 2ED8A 3SCMC 4LNRA 4DVRH 1PGRB 5C71A 3FFCD 1I3GL 2PXYB 4UT7H 5AZEH 3HI5H 5ALBL 4NKDA 1TTFA 1FNSH 1FIEA 1JNLH 3MRCA 3ARGA 1Q9OA 2QADB 2AKRA 4M8VA 4XC3H 3SKMB 2XZCL 3NCBB 2G5RA 4HUWB 3SKJL 4X9HA 3CSYB 3PDGA 4DGIH 3U0PA 3EJZC 1CFSB 4IHOA 4YBHA 3LCYA 5HD8C 1OD9A 4NJAL 3UBXB 4HMDA 4FABL 1KJ3H 3X13B 4IBLT 1W72A 3NN8B 3QZWA 1I9EA 4Z77B 5C07A 4NQCB 4FA8A 5EU6E 1YQ2A 4NQEB 2B7DT 2Q76A 4JR9L 1KN2H 4O2FA 4JO2H 1NCWH 3Q1SL 1I8KB 1RD6A 1OQXA 2WBJA 1MFAH 2F54B 1T20A 2NY0B 5DWUH 3EFFB 5FO9B 2YA1A 4OLVL 3LKSA 4JREB 4ODVH 1O7VA 1A1OB 3B5HA 4HT1H 3VFGH 2OX5A 5D1QB 3MA9L 2CJUH 5I75B 1CYGA 5CZXD 4XWGH 5I66B 2A6DB 3ETBF 5L2KB 4S0TD 4R97C 2VR9A 5E6IB 1K8DA 1OAYH 4Y19D 2EH7L 4ONOA 5ERWA 4HIEB 1OP3H 1FG9C 5F71A 1FPTL 5ID0A 1FGVH 2V17H 4KK5D 5GJTH 4LIQH 4L8CB 3QISA 3WEXB 4F8TA 1ZEAH 1M05A 4GKOA 4GKNB 4KDTC 1R5WA 2Y6SD 4YDJB 1DBMH 4JZJB 1WAAE 5T5NF 1X5ZA 1OF2B 3GMRB 3U4BH 1GAFL 4GBXB 1ZHKA 1ZANL 1FN4B 1NDMB 4HIJB 4UAOC 1IRAY 4JKKA 4BA8A 5SX5H 2ZSVA 2NY7L 2MJWA 3O9WB 4PJFA 4CGTA 4ZQKB 5J06A 2WV3A 1PYWB 1R6VA 3MOBH 3L9RB 1OY3B 4GG6E 2GT9A 4WFHE 1S9VA 4XNZB 2DMCA 4ZOBA 2H9GB 1YY9D 2VL5A 3NAAL 3FQWA 3P11L 5EBWB 2I5YL 1HQRA 1QSED 2RHEA 1A6ZA 2VLKD 4JN2B 3S5LG 1PKOA 3UC0H 4GFTB 1TXKA 3IJHA 4ALAH 2HTLD 3KYMB 5CFHA 4Y8DC 1I1AC 3LPWA 5DYOB 1A6UL 3CC5A 1PY4A 4CKVX 3RY4A 5CCKH 3IDXH 1D5BB 3KPOA 1B4JL 1SY6H 1TZIA 4MD5B 1NLDL 2D03L 5CSZA 2VR5A 2Z0BA 1DUZB 4Y19E 1CDJA 2VXUL 5J8OA 4QRUA 1XH3A 1NKOA 3TH2T 2WMPA 1DN0A 4G8IA 5FAAA 4PJIA 4O2EA 3FO1B 4I18A 4RFNB 4N8VB 1U0QA 4R3SB 2D7QA 1HXMB 2VTFA 1MSPA 1JJUA 3N9GH 1I7UB 4JQVA 3GBLA 2ORBH 4WHDA 4XNQB 4XPHH 1EVTC 4YBQD 4PRNB 2F5BL 2YUWA 3GJEA 3VCLB 1QSFA 3DX6B 4E0RB 5E4EC 5JXEC 5KG9B 3QWQB 2DYPB 4UNUA 4E42A 5F9OH 2XN9D 5IW3A 1B2WH 4M6AA 4LP5A 1ZWIB 2CMRH 5D2NE 5LGKA 3O3AA 4JY4A 4K7PY 4B7LA 5DR5H 4L4TB 2AJUH 2IANB 4ZSOA 4U1IB 2FHCA 2DTSA 2APBA 5LKNA 4FQHA 3KPRB 3RKPA 3ARFB 1WEJL 1BZ7B 2UWEB 4ONGL 3ROLB 5JMRA 4F58L 2MPAH 4UNVA 4C55A 1WTGT 4JB9H 4ZUUA 4Y16C 3R1GL 1XIWC 4WHYH 2OI9C 4TQEL 2WWMC 4P9HC 3CLEH 4LKCA 4X9GA 1KTRL 3Q5YA 4NKOB 2R4SH 5D9SB 5C0JA 4QHNB 4BKLA 3IDIB 2UVEA 4P2YA 1BJ1H 3F7VA 3G04B 3BN9C 4KPHH 2I24N 3QQ9D 1R3JA 1BIIA 3GSOB 3A0OA 5HHQB 3OF6D 2X4PA 4JY5H 4Q9RH 3C6LA 2A6IA 4XVJL 1QLFB 2DKMA 2FCBA 5DMIL 4MCZB 4AQ1B 4PGEA 1VFAB 1MJ7L 3NPSC 5FYJU 1LO0L 1CL7L 2FJHB 4G6AC 3SE4C 5IW6B 4TSAH 4CDHA 2GTWB 3V4PL 2HT4D 3MSPA 3QDJD 4FXKA 1PVHA 3B9KC 5DMJB 5E8NA 1U91A 2PW2B 1HKFA 5HHNA 32C2A 4QOKD 3BRGC 3W11C 2EIZB 1XCQB 4LAQH 3SKNA 2P5EE 5DUMH 2YMXH 3F12B 5A2KH 4ONHA 1IKFH 2I9LB 2V2TA 4M48L 3BDYL 2NR6D 5C0CA 1NGYB 1WCBB 4F3FB 4D0BA 3RTQD 4U1KA 2FATH 5DQJB 1JYWA 3SDYL 1EO8L 4HUMB 4LHUB 1XGYL 1A3LH 4FTVE 1ORSB 1Q9WA 1JPGA 1UM6H 5CUSH 1P84J 3TJEL 4JFFD 4ZXBA 6FABH 3BEVB 3D25A 3GB7A 2WZPD 3FONB 4OCSL 5T1LB 3FTGB 5EFIB 4XX1G 2NZIA 5CIPA 1I3VA 1FJ1A 2DL2A 3IU3B 3H9SA 4LBEB 3RWGB 2LTQC 1JK8B 1OGAB 4FP8L 1GGUA 5D96C 5KSAA 4YHKH 4LKXB 4LSQL 3BIKB 1TJHH 1MCCA 3MMEB 4IDJH 3VWJB 1G7LA 3LVEA 3KYNA 1OTSC 2VR4A 1KEMH 2Z8RA 2P47B 5HTSA 4I8DA 1NANI 1I9JH 4L5FL 1AGBA 2W0LA 3ES6B 4GXVH 5LVEA 2DM2A 3HRZA 1OGTA 2HRPH 2PETA 1N7MH 3JWOL 2HKHL 1RZGB 4KQ3L 4EEEA 3VGEA 5DJAA 1JZ5A 3QWOA 2BOBB 3QDMA 3RL2A 4NNPL 5DI8B 5IMLA 1QACA 4KUCD 5I74B 4YFEA 2YXFA 5INCB 3V6OC 3TZVA 5D8JL 3V5KB 2X2YA 1EHNA 4D3CL 3BAEL 4GKZA 3LD8C 3DRTB 4N9OB 1NC2D 1VESA 3MROB 1CR9H 1KN4L 3CDGB 2NX5A 3RIFF 3ZKMC 3A6OA 4KJWD 3HZKA 1T6VN 4HJGB 4K8RD 5JW4R 3U7YL 4ZOEA 5C08E 3OAZH 5LWYL 1I1CA 4CVXA 1C1EH 4FQ1L 2B5IC 4LVEA 3MA7B 5FYJL 5D72H 4FQIL 4PJ8D 1KB9K 2Z93B 1SEQH 1MCOL 3S97C 4LLUA 1T7YA 4S1QH 3ZE2E 4MA7L 4KJYA 1A7BA 3SJVE 5E08H 4Y5YA 2UVFA 1CDIA 4BFGA 3RZCC 1M7DA 2F19H 2PUQT 3D1MC 4LCWE 5GJSL 4N5UA 4JFDD 4P46A 3RL1B 5ADPH 1JHLH 4JG0L 2GEEA 2EYTA 3CDCA 7CGTA 1LK3L 3QWRD 1RK0B 3O8XC 3LSOA 3RUGB 2EDFA 4UU9A 1YDPA 3PIQA 1KPVB 4MJ2A 4OZGA 3OAYK 2NPLX 3RNQB 2R8SL 3S36L 5IQ7L 1A22B 2VISA 3L3OA 4BQ6A 3WUWB 4AM0A 3U9PH 3GI8H 3RFZC 3VFTB 4RBPH 3P0VH 1A0QH 5GGSB 4JM2F 3HMXA 5EZIL 1RIVH 3T0VA 1XAUA 1BMGA 3L1OL 1ODAA 1B88A 4CMMB 4JRYE 4FZ8L 2X41A 3KHQA 5BRZA 2XZQL 2V5SA 3PHOB 3OKNA 4PJGF 4OFVA 5IWLA 4UT9L 5DRZA 1IQWH 4ORGB 3S4SG 3TEUA 4FQ2H 1K5NB 2JIXA 2VDLH 4G8EB 4F9LC 3ZHLA 1NJ9B 1RVFH 2DLIA 2R0KH 3MLSH 5IMMA 2Y1VA 4FQXC 3ZTJH 2HMID 3UJJL 4XT1C 2H26B 2GJ6A 4OGAD 4WWKA 5FKAA 1DEEA 1OM3L 1EAPB 5EC2B 5T3ZD 4DKFL 1GGIH 4JM4L 1FORL 4B5EA 3C5JA 3HE6C 2IQAB 4IJ3C 4NZUH 1LVEA 1JGLL 1OAQL 3WE6B 1KEGH 2IWGA 5J11C 1UACL 3NH7H 5EOCL 1MRDH 1NBYA 4XMLH 3C60A 5DO2C 2C3VB 2XACC 1FLRH 1C5BL 3VFNA 2B4CL 3F7QA 4U6VL 5HYJE 3OJ2C 4X6DA 2P8LB 2EZ0C 4UILH 4GXUN 4JO3L 4KUZL 5B21A 5ETUB 4AEEA 2HJKB 5ABDE 1F00I 4IEFB 1D5IL 5B38A 3ZE0F 1MI5D 4M1DH 1O5DT 5F72S 4XPBL 5IHUL 1BJMA 5IBTH 3G08B 3O6LH 5HGBB 3CH1B 4IRJB 3FOMB 4PRBA 1HNGA 1G0YR 1DFBL 1QRNA 3C5SA 3RVWD 1YPZF 3VMOA 4LSPH 4A6YL 4MCYA 3WMSA 3REWA 1YMMB 3VFUA 2OTPA 4HPYH 4ENED 3SDCA 5DGQA 3PWNA 1CDBA 3RWCB 1DTUA 4V1DB 5E2TH 1N3NB 4M7KL 1G7QB 4N90D 3RWFA 3QIUC 5AAWA 4UV4L 1JWUA 3GGWA 5F7WC 1SMOA 2A6KA 2VE6B 1K6QH 3LH2H 5GRUH 5E2WH 4HUXB 4WV1B 3TBSB 2V5YA 1AQKH 1CD1A 1ZLVH 1H3UA 3PWPA 1SJVA 1KCSL 1Y0LA 1C5DB 4WDIA 1KLUB 4KMTL 4HGWA 3RDTD 4HF5L 1X5LA 3NFNA 4HC1H 4XBEH 3SGKC 3SHSA 2EE2A 4AEHL 1KT2B 2FH6A 1JTTA 4LLAA 4OCRH 2D4DA 4OZHA 3GK8L 4P3DB 5DTFA 5C0BD 5HHXH 2OTUB 4I0KA 1EJOH 1RUQL 4OCNC 3VXUE 3VRIB 1NEZB 3BDBA 3ULVC 3QDHA 3U36A 4NBZB 3QIBC 4NYLB 1KELL 4KY1H 1L0YA 3U0TB 3JTTB 35C8L 5JR1H 1CBVL 2XY2A 5GZOD 5B4MD 3VFOA 5IVXE 2AJXH 1N6UA 2QLVB 5FUOH 3GBNL 1NUGA 5GZND 5T33H 3QRFM 1UZ6F 2X44D 4QRSA 3VMPA 3MRMB 3QG7H 3INUL 3WS3B 5SWZE 5AZ2L 1U93A 1BLNA 5DUBB 3FT2A 4FTVB 3UPAA 3STZB 1MWAH 1NCAH 2XWJA 4MNQD 5C9KA 4PB9H 3IFOB 3AFLA 1SY6A 4NO5B 1Q94B 3KXFD 3GBMH 2DLFL 1CU4H 3IXTA 1WJ3A 2EYRA 2V7NA 5FOBA 4CN1A 4RNRB 4K71B 2WINB 1EHLH 3CMOL 1IE5A 2F53E 5IB4A 5BS0A 2CUMA 4OV6F 3BEWA 4QRPD 1N5AB 5M94B 4N8CL 4IOFD 4ZUWB 3CFEA 3V0VA 3DXAA 5AUMA 4K55A 4RMRA 5KVEL 4PFEA 5F8RC 2A6JA 1W8OA 4JHWL 5C0BE 3MGTA 3WYRA 4ODUA 1HH9B 4KKAC 3HMWL 4WUUB 3FMGH 4NKIH 3OGCB 4X5XA 4G8GE 3CVHH 2WUCL 4X6BB 3UBXG 1FNAA 1EZVX 2Y23A 2X4SA 1NAKH 4JFZH 1LILA 3TBVB 1S8DB 3KVQA 2EICA 4ZPTA 4GAFB 5F1NA 3AXLB 5T5FH 1S7WB 5JO5B 1A1NA 3G6JA 2AJVL 5L8KB 5FM5O 5ILTL 3LV3A 3AU1A 4XC1H 3PXJA 4KKCD 4TVSa 4U49A 5HYQA 1J8HD 5JQHC 4BH8A 3MRJA 1UJ3B 1J0KA 4PJHE 1WIUA 1N6QL 4PJIF 5E1AA 2RFXB 3VE0A 4FS0A 2CXGA 4F7CA 3HNSH 3K8LA 4QRRA 2D4FA 1KCKA 1IEBA 1F4WH 5EO9A 5MEQA 3O4OC 1RUPL 1OOAA 5GS3A 3WJJC 1OAXH 4Q9BA 3H7LA 5IGXL 4LQFH 3DBXB 4JDTL 1S9WA 2X1PA 4X80H 3UCRA 5B3NA 3SJVB 4X4MA 4QT5A 3VXMA 4WHCA 3NCYS 5GRVK 3C5ZB 2BNUB 2LABA 3EOTH 3VWKA 5GGTH 2R69H 4JJ5A 1BVLA 3BSZH 4Z5RB 4FFYL 2QADD 4HH8A 4HUUB 3UAJC 1W0VB 4MZ2A 1RZ7H 2DLGA 1PZ5A 4YFLI 3GKZA 1KJ2B 4NUGH 3UZVB 4F80A 3GMMB 2R2HB 4L1HA 5EA0H 1NCDL 4Y0GA 3H9YA 3S34L 3O6FB 4R6UA 1PZUB 2BSRA 4C56A 4G7YL 1E28A 3FO2A 1EAJA 3SGDH 1XGQA 3S88H 4HS6A 4YC2C 1P7KB 3QHZL 1CFQB 1FL6B 1SBBA 4MXVE 3RX8A 1U41A 2Z8SA 4JRYB 1IGML 4QO1A 2O26U 1ZT1B 4L8SB 1E4KA 1WBYB 1N59B 4FFZH 2APFA 1P4BL 3MREB 3L7EA 4YQXL 5D7SL 1Z0NA 3UDWA 4Y1AA 4RGNE 4I9WD 4UQ2B 2F54D 5CEZE 3EYFA 4MZ3A 2F8XC 2NY0D 5E8DL 1FZOA 3IVKA 1QBAA 3DWTA 2R29L 2YWYA 5MI0B 4CJ1A 4MDJB 4ETQB 3TNNA 1G9NH 3P3YA 4L4VA 1OT2A 3BZEA 2Q1EA 3BMVA 3KPNB 4P57A 5ICXA 5I8KH 3UYOD 5K9JH 5D1QD 2ERJB 5KJRL 4MDIB 4N0CC 2A77L 4P2RB 1VFBB 4XBPA 3WN5C 5A16A 5L2KD 1ORQB 3CZFA 1ONQA 4Z78A 4G8FA 4F2MA 4I2XB 1P7HL 4RDQG 4LU5H 4D0DA 5CEXB 5F3HA 3JTSA 1YEKL 4O58H 3QRGL 2ICWJ 5GHWL 1A6WL 4N8VG 3ZTNL 4XNUH 5HY9A 2DM4A 5IROA 3TYFA 5HYJB 5IK3A 1KLGA 2BVYA 3BZFB 3MRPA 3JZ7A 3QP3A 3N1MC 4NIKB 2YUXA 1VEPA 3OKYA 1U8HA 1GC1C 5I6XC 4OLWL 4Z0BH 1UXSB 4KDWA 3LRGA 4OT1H 1SVZA 1JRHH 3I85A 5CGMA 5DK0B 2DN7A 4P2OA 1CFTB 4OQTH 1AO7B 4EDXA 5J7CC 1RZ8A 3HKFA 2BRRH 4HUNB 1DSFL 2C9AA 5IW1B 3BPCA 2FYYA 1RJZB 3KPMB 1T22A 1IM3A 2FD6L 5HPMA 4Q2ZA 3BP6A 3QIWC 3DVGB 4X9BA 3QCTH 4XRCB 1L9NA 3QUMB 4XNXL 4JANA 5HDLA 3DX9B 5D7LA 1MUJA 3UMTA 1EXUB 4KVNH 4L9LB 1KTKE 5TPWL 4D2NA 2ATKB 3REVB 1NGQH 3K2UL 3E3QE 1NCTA 3BZ4A 4L8BB 3HS0B 1JYNA 1PFCA 4HIHA 4DZ8B 2NY5H 2V9TA 2PKDA 4OIIH 4ZFZB 1X9QA 2YZ1A 3QUXB 3D0VA 4R90H 2DKSA 4HZAA 3ZKXC 2YD3A 5SWSE 2BDNL 5CJOL 3C09C 4HCRL 5GGRY 3SDXA 2D7NA 1V7MH 1BBDL 2QR0B 4H20L 5GRVL 3BH9A 5IVXB 5C0DB 1QLRB 5GISH 2UUDK 3WXVL 1ADQH 3I02A 2VXVH 4K3HA 3G6DH 1K4DB 2VDKH 5K9OB 5IOPB 3B2UD 4PRHA 5SWZB 3BX7C 5J1TC 2DYPD 3OB0K 3U1SH 2DQTL 2EDYA 1PDKA 4EI6A 3RWJA 1MHCB 1TCRA 4IRZL 1M6OB 1MFBH 4HIIB 4L4TD 2VZ3A 4LHUG 4APQD 4YDLB 2ARJB 3SDDD 3X3GL 3MBEB 2DQIH 4K2UL 3T65B 3KPRD 3T77A 3ARFD 3ULUH 3KPSB 3VA6A 4Z95L 2CDGA 3MYJB 3VXNA 3T4AB 3RY5A 3W0WB 4FN0A 4MNGE 1FL5A 4G3YL 2ZPKL 4QCIB 2XRAL 1W72L 4OZGF 3F7PC 4XVUC 3ROOA 3NIDE 3DO7A 4YGVB 2IH3B 2FSEB 2CIKA 5DMKB 4PJXE 3KNBA 5DJ8B 1G7HA 4FG6C 3P9LA 3DECA 5JIKA 4YHLL 3N1QC 5DLML 4WTZG 4H0GA 2DQCL 1MFCL 1GGYA 4OAWB 4GUPA 3DO3A 5JDJA 1UA6H 3F58L 3ME0A 2XQYK 5IG7B 4G8GB 4KRPB 1FYTA 1CICA 1S7UA 2VZ1A 3HC3H 4Z7WA 4LLQA 2AJSL 2AABL 4JKPH 1KB5H 1FNHA 3SBWC 3DV4B 2ARJQ 2OXGA 3FCTA 4YHNB 2ILLA 1HSBB 2PYFA 4G7VH 1DL7L 4M6ML 1E4WL 4HXAL 4WU5A 5I1HH 4GMSH 1H8SA 3ZKSD 4PJHB 2FL5B 4O5LL 4XPAH 3BD3A 1YUHA 4L8DA 4ZS7H 2AK1H 3O3UN 5C0AA 4CADB 4R26L 3MJ7A 3SOBH 3RQ3A 3LQZB 1INEH 4NBXB 3DV6B 1J1PH 1U3HA 4J3OC 4X6EA 5F9AC 4P23B 3K81A 4EKXA 5GIRB 4X99A 4LHUD 4LNRB 4WFFE 1KXTB 3GNML 4G43A 4RGMB 1SVCP 3U2SA 2WBWB 1G9EA 4NKDB 2R23A 1J05A 3MRCB 3NCYP 5I1JH 4KHTH 3ARGB 1Q9OB 3BISA 2AKRB 4JQXC 2Y7QA 4G9FA 5T1LD 3WO4C 2A1WH 4WEBH 1GOHA 3PP4H 5EOCJ 4HKJA 3V0WL 3U0PB 1JUFA 4X6DF 4E41A 4IHOB 4HC1A 1FGNL 1OGAD 4FFWD 3LDBC 4AIZB 3ULVF 2G75A 1QFWM 1IT9H 3ESUF 3LQAC 2Y5EA 1C08A 1EHAA 4N1EA 4F37K 3TLRA 5I30H 1W72B 1MNUH 3MV11 4QRTA 1OAKH 2XA8H 4N0UA 5C07B 2IAMD 3CFCL 2E9BA 1TVDA 3MV7E 3I6GA 3EDEA 2Q76B 3HLAA 3KLAA 4O2FB 1P6AB 3T0EC 1E27A 4HAFA 3QHFH 1JZ6A 4K9EH 4YDVA 4R7DA 3WUWG 2OR9H 3UYRH 1AXTH 2WBJB 3Q3GA 1T20B 1U9KA 4XHJC 1R3HA 1FVDA 4NO3A 1AXIB 4JFOA 2MCPH 4YXLL 3LKSB 5B39A 1MWAA 1FYHB 2H2SC 2LQRA 4WUKH 5T3XL 3RU8H 4KTDL 3U30B 1CFVL 1DQJA 1NGXA 4P9HL 3EYSH 1DZBA 3GHEH 2QSQA 3SDAD 5L6YL 2AJZB 3QDAA 3B9EA 4XP9L 2R0LL 1K8DB 4GSDL 1RZKH 4OKDA 3DRQA 5ERWB 5EDXA 5ID0B 2ZNWA 1HZHH 2BJMH 3BWAA 5BOPA 2MQ3A 1XF4A 5DVOA 5IT2H 1K2DA 2ZCLL 4LCCA 3DUUA 2DJ4A 3BJLA 1M05B 4LSSH 1R5WB 5C3TA 1HKLH 5E2UH 4D9QD 4NM8H 4L3CB 2QQLL 4GRWB 1DVFA 1ZVYA 4P4KA 1ZHKB 1KB9J 1NSNH 3T0WA 4DUVA 3I75B 3DVFA 3FQUB 2HJFA 4XVSH 2C3HA 3KJ6H 4YEFA 2ZSVB 1ZV5A 1FRGL 5FXCH 5DJDA 2QTEA 4GQPH 2O93L 1UQSA 4PJFB 4X83A 5FYLL 1RK1A 3PQYE 3CVHA 1F4YH 2WW8A 5ENWA 5KBNC 2ADIA 1HYSD 1FHGA 2CKBH 5F3BA 3GSUB 1RY7B 1S9VB 5EU4A 5EH1A 3LEXA 2OR8A 2VL5B 4UT6L 2IMNA 3FQWB 1HQRB 3QXUA 2P43B 3GSNL 3RJQB 1A6ZB 4NKMA 3Q6FA 3IJHB 4YDIL 1KCRH 1MFEL 3MO1A 3CC5B 2DI8A 3SGJC 5CKAA 1FNEA 3MLVH 5CLTA 2UZIL 4RZCA 1DQDH 3QULA 4Z7QE 5IVZB 5DS8A 3KPOB 1TZIB 4U1MA 2P48B 1NC4A 2W91A 4JHZA 5CSZB 5TQ0H 2B1HL 2DAVA 2HRLA 4LOUD 4OCXL 3DHJA 3QDGE 1YEIL 2FHBA 4QRUB 1XH3B 3IJYA 2YUVA 3ARRA 3PGDA 1DN0B 4G8IB 2DQEL 4PJIB 4O2EB 4PJ7E 3W81A 4J23A 4DAGH 2PN5A 3EUUA 5F7NC 1RURH 5JOPD 4NM4L 4Y5XC 3VXTB 3RBGA 1DBBH 5DA4A 5GGTA 3NFSL 1EUTA 1RQ5A 2FEDD 4PRPD 4PUBH 4BUGA 4KXZI 3Q6GL 3VG0H 5JHLH 1XGRA 2YKLL 4XXDA 5C1MB 3EO9L 2WUBH 4XMKH 3G6JF 1I7TB 3GJEB 4W6XB 1QSFB 2IH1A 4N1HB 5KZCB 3MXWL 3D3VA 4LL9A 4PGDA 5TE6H 1A7OL 3QNXB 1IC5L 2VLRE 3O3AB 4JY4B 3VG9C 2NY1C 4EBQH 3FFDA 2FZ3A 4ZSOB 4DGVL 1CLOL 5I16A 4FQHB 4P4RB 5GSVA 4OD1H 3PGCA 4KK5C 4ELKA 2C1PA 4K23H 1S5HA 1I7RA 2DQUH 1CZ8L 3QEHA 4ODXA 4XAKE 3F7RA 2FX9H 1QUNA 3K46A 4ZUUB 1B6DA 1YMMD 4LKCB 1C12A 4PJAA 3S7GA 4K3JL 5C0JB 4Z76A 3KYOA 4V1DD 4BKLB 3F7VB 3R06A 1RUAL 5T1KA 1R3JB 3P9MB 1DN2A 1BIIB 2Z35A 2RBLA 2X4PB 4K7PH 2YPLE 5D7KE 4PJXB 1CTOA 2PYED 4PGEB 3ZE1E 1YY9C 4KKLD 2EKSA 2E8YA 3L3HA 1RV6X 3MLRL 5IQ9A 1TETH 3DI3B 4HMEA 3FN3A 4FXKB 2OL3H 5FYJE 4OF0A 2HTKC 5E8NB 4NCC2 3F62A 1TNNA 5HHNB 3DX8A 32C2B 5D6DA 5DJ6B 4HFUH 2UZXB 1ZHNA 4L4JA 1R5VA 2DD8L 3RY6A 3SKNB 2V5RA 1DEDA 4ONHB 4HDIA 2V2TB 4BSWB 2I9TA 1LO4L 4QNPF 5TFSH 2ZG1A 3BXNB 4D0BB 3D48R 4U1KB 1FZKA 1F4HA 1Q9WB 1JPGB 4OQTA 5C0FA 2IF7A 5SX5K 4ZXBB 3PL6A 4TUKH 5C8JB 3D25B 1FE8H 3L5XL 1Q1JH 5EO1A 2H41A 4LGRB 5LJYH 2EXYC 1AGEB 4L3EA 4NRZA 1TCMA 3L5HA 5E70A 1A7NH 1L4IA 5CIPB 1JZ8A 1FJ1B 4HQQH 4OB5H 4WVRA 1T0NA 2XZAH 3H9SB 1KPUA 5F7DA 4TUOA 4WW2C 5K93A 3V9FA 3BKJH 4YBQC 2GFBB 1INQA 1AIFA 4NT6A 5KSAB 1I9RL 5J6HA 4XXCA 1IGFH 1EPFA 2N7BA 1KTLA 4MB4A 4NHUA 4LFHG 1C16B 4H88L 1WWBX 4YPJA 1CL7I 5D7IA 1G7LB 2IBZX 2ICWI 4IIQA 5BW7C 1KIPA 1ROWA 4GAGL 4HWUA 1IVLA 4EI5D 3MV01 1CLYH 4N68A 3HMXL 3IFLL 2O5ZH 7FABL 1EFXA 1CE1L 5IM7A 4AMKL 1EGJH 5EORL 2DF3A 1ACZA 4GRLA 4U6YA 3HRZB 4M1CD 3IDUA 1OGTB 5C7XH 1OTTC 1U8QB 5HYFA 2YR3A 2W07A 3MFFA 5DJAB 1M71A 4N0YH 3QWOB 3QDMB 5H94A 3RL2B 5DD0H 3OZ9H 2BNRE 2B20A 1ADQA 3TZVB 3BKYH 5LGHL 4GKZB 4DVRL 3CSPA 1QBMH 4JFYA 1ZHLA 4UT7L 2L7UA 5AZEL 3HI5L 1KG0A 2NX5B 4UNTA 2VLLA 1FNSL 5IIEA 3WHXA 1JNLL 3HZKB 1QYGL 5JHDE 4XC3L 4CAGA 3MUJA 4G6KH 4WWID 5GS1A 3VFVA 4CJ0A 5J13B 3HN3A 4DGIL 4CVXB 3BQUA 2AEIT 2R2CA 4XPGL 5D2LF 1VFUA 3WSQH 3LOWA 3FT4A 2MKWA 1I1FA 1GPOL 4PTTB 5EPMA 5JW4Q 4LLUB 2HT4C 3LMJH 1A4JA 2APTA 4P5TA 4WO4A 3PWLA 4OLXH 1HWHB 4Q0XH 4U31A 5E99H 3KYKH 4Y5YB 3VXME 2VDRH 3RBSA 3UTTD 2P5WA 1M7DB 5DQDH 3SDXF 4I0PD 3TN0B 4P46B 4XNMA 3ULVL 3DIFA 3L5WA 2APVA 1IGIL 1NCWL 4JO2L 2EYTB 2NR6C 1BD2A 4L9DA 3LSOB 3RTQC 1YDPB 5JOEA 3PIQB 4OZGB 1F8TH 3AS3A 1RJLA 2VISB 3DOSA 1MOEA 4AM0B 4O51A 3QEGH 3G5ZB 2IPTH 5DWUL 3ECBA 3MV9E 3FB8A 2O5YH 3IT8D 3X3FH 1P69B 2Q6WB 4BZYA 4RWHA 4HT1L 3VFGL 1KB5A 5FUCC 1CFBA 2CJUL 3O6FD 3PABA 4XWGL 1AR1D 5F7MC 2QHRL 2E7CA 4KRMB 1OAYL 3WS6C 4NQDE 4M03A 2EC9T 1ND0A 2EDLA 3OKNB 4ZDHA 1OCWH 3O4LE 5DRZB 2GJJA 3ULUC 2FEEL 4AL8H 2V17L 4JQIH 5GJTL 2JIXB 3B9DA 3AY4A 1ZEAL 3K0WA 1RU9H 5HXMA 5IMMB 2AAVA 1JZ7A 5CLWA 1KIUA 2NY4D 3CK0L 1BZ9A 2GJ6B 3U4BL 4WWKB 5FKAB 1DEEB 1GJIA 4LSRL 1TNMA 4LPVA 3L3DA 4HBCH 3BFOA 3WFCH 1WGOA 3W39A 1ZXQA 5M7QA 3IXAA 4Z7WF 3MOBL 3VW3L 2J8HA 1NBYB 4P2RD 1FH5L 3C60B 3BESR 4TSCH 5D93C 5HYIA 1HDMB 1ZK9A 4ODWB 4RMUA 3VFNB 5ESVA 5KS9E 2HFGL 3UC0L 1CGSH 1V3JA 1WFUA 3KG5A 4KJPC 4ALAL 4F57H 5FA3A 1OSPH 1EK3A 3LKQA 4KJWC 2UV3A 4K8RC 5B38B 5CCKL 2ZJSH 3NA4A 4GKSA 3IDXL 2CUIA 1PEWA 4P3CH 1SY6L 1RIUL 4KTYA 4PRBB 1TMCB 1QRNB 5CGYC 3VD3A 1GRWA 3C5SB 5AYUL 5IB5A 1LDSA 1OSZA 3MRQA 3G5VB 3REWB 4H1LG 4RX4A 3D9AH 2VWEE 2CLZA 3PP3H 4PY8J 3SDCB 3PWNB 1UFUA 2PO6D 3MNZA 3TVMC 3MOAH 1AO7D 2Z31A 4UQ3A 1JWUB 3GGWB 4J7RA 1JZ2A 4ONFH 1MHPH 5HVHB 4XCFH 1CD1B 4BFIA 1QG3A 5C09A 3PWPB 1Y0LB 4YFDB 2DQHH 4WDIB 4JCMA 4HGWB 1TZHA 5KSVA 3O0RL 4JG1L 1JFQH 2HKFH 3L7FA 3LPFA 1A3QA 2B1AL 4RSVA 2A9MH 5DTFB 3P4OA 4OZHB 1B2WL 2NW2B 3OAZK 2CMRL 3HG1A 2GTZA 5DR5L 1XGTB 3U36B 2DL9A 1CQKA 5E5MA 4AY0A 1KULA 4NHCH 4P2QA 5CSGA 5MEOA 2GSGB 3LEYH 4PJ5D 3WIHH 3I50H 1A6AA 2CKBA 5HGHB 3VFOB 4RMQA 3GI9H 4WI3A 3U83A 5TF1L 4FOMA 5D1ZC 2W1NA 2VH5H 5T1DH 4XNYH 5BQ7A 4PJDA 1UB6A 2BSTA 4ZAKA 4JB9L 1U93B 3HE7A 3ZYZA 5F7YC 5FHAH 3FT2B 3S4SA 4PP2A 3CLEL 3UPRA 4LVOB 4YR6A 2WP3T 4R8WH 3E0GA 1PKQA 4ISVA 1RZKC 1FZMA 2HH0H 3IXTB 1OPGH 2BNQD 4RBPK 2EYRB 5FOBB 4JY5L 4Q9RL 1A6VL 2ZUSA 2PCPA 4WI8A 1QSVA 1Q9KA 4Z7UE 4JM2D 1IGTA 1TITA 4MNHA 2ZOKA 5IB4B 5BS0B 3MBED 3BEWB 4R4ND 4TSAL 2ED9A 3CFEB 1IBGL 3V0VB 5JPMB 3IGAA 2NXZD 4KFZC 3U0WH 5AUMB 2A6JB 4WI5A 3W0WD 3HC0A 4IMKA 3SCMD 4LAQL 3MGTB 1WFOA 5DUML 1A6TA 4ODUB 2YMXL 3WFHA 2BRQA 3RVWC 3K2MC 5FGSA 3R0MA 4HKBA 4I13B 2FATL 4E9LA 4W4NA 4JPKL 5ITBH 1A3LL 2X4SB 4ENEC 5CJ8A 2F8VA 2W0PA 4OGXH 2CLVA 2DQFB 1UM6L 5CUSL 4DKEH 4ZPTB 1BHGA 5F1NB 6FABL 4OKVA 4KI5E 1A1NB 3G6JB 3ARBA 4NOFA 1QO3A 3LV3B 4R7NA 2E27H 4X4ZA 5HYQB 4BH8B 3MRJB 2YD7A 1JHKH 1R0AH 5C0AE 1A3RH 5E1AB 3VE0B 1NUDA 4X98A 1X6NA 1QFPA 4OTXL 4F7CB 1QR1A 4QRRB 4G80A 3JWDC 3QUZA 4OV5A 1IEBB 1CGVA 4IDJL 4PLKC 5MEQB 1CE6A 1JGDA 4R0LA 5CJXC 5L0QB 4Y89A 1TJIH 1KEML 3WFEH 3QCUL 2G9HA 1T4KA 2H3NA 1MQKH 4HWNA 1I9JL 3CX5K 5F7UA 4QT5B 3GRWH 3VXMB 4GXVL 3D2UA 3BP4B 3JVGC 4OBSA 3VWKB 3ZSSA 2HRPL 5GZOC 4JJ5B 5B4MC 1BVLB 4XPFH 1N7ML 2D3VA 2HFTA 5D1XC 3ARGD 1E4XH 4IRSA 5DFVC 1PZ5B 2BFVH 4W6WB 4M7LH 3ORJA 1WICA 5E8OA 1S7TA 2OM5A 3H0TA 2XTJB 4ZNEA 3V0AC 2OL3A 3HI1A 4YHYB 4C56B 2Z8VC 2VDQH 1E28B 3FO2B 1VSCA 3GMNA 1XGQB 5CHNA 4S1SH 1CR9L 3MV8A 4HS6B 3FZUD 1D6VH 1LEKA 4OFPA 1P7QD 3V6BR 1FC1A 5C07D 1MRCH 4YAQB 2WSKA 2PR4H 1T04B 5EB9A 5JW3H 3MLYH 4HHAA 4ZUVA 1C1EL 2RCSL 4PJEA 4J3WA 1AGFA 5D72L 3DX7B 1GSMA 3DVNA 3L7EB 4OF3A 4PJAF 4RGOL 3ZDXF 2W92A 4PRIE 1SEQL 1QKZH 4NWUH 4S1QL 2WBJD 4IOFC 4YX2H 3EYFB 1TJGL 4Z7VE 1FZOB 3IVKB 5E08L 1ZLUH 3DUSA 4OM1H 3TNNB 4L4VB 3BZEB 2F19L 3LS4H 5HDBE 4P57B 3WV0A 5ICXB 2DRUA 1I1AD 1OD7A 3V7AE 4PRDB 2MQ0A 4PGJA 3HFMH 5DQ9A 5A16B 1FVCA 4Y4FA 3CZFB 1ONQB 5DJZA 5TDNA 4G8FB 4F2MB 4AEIH 4DKAA 2PW1A 5F7FA 2AK4A 1CGWA 2XPGA 1MAMH 5H2BA 4MQTB 3U9PL 1S7RA 4O9HH 3MJGX 2Z4QA 5KAQF 3LKNA 5J3HD 2XXMB 1A0QL 3FOLA 3UBXA 3N06B 5E03A 5HY9B 2AQ1A 1RIVL 2XT1B 1EGJA 1YJDC 4PB0L 1F13A 3CU7A 2X4UA 1KLGB 4FQCH 3MRPB 5DRXA 1T80A 1B6UA 4TSBH 2WP3O 1Y6NR 1FCGA 5MENA 1IQWL 1U8HB 4NN6B 3RWDA 2J5LB 1E6JL 2H1PH 3GEWB 4ZO8A 2DBLL 2VDLL 3E8UH 4P2OB 1ED3B 1RVFL 2R0KL 2VKWA 3MLSL 3MNWA 5TDOA 3OMZA 4EDXB 1RZ8B 5DA0B 3LY6A 3ARXA 3ET9F 5HDQH 1D6EB 2QEJA 2FYYB 3BPCB 1T22B 1IM3B 3LKOA 2PXYC 4CDGC 5HPMB 4Q2ZB 2VAAB 5F89A 4E5XA 25C8H 3BP6B 5I66A 2EIBA 2A6DA 4GRMA 1T1XA 4HJ0D 4LRIA 1P4IH 1X5YA 2QADC 4FQJL 2N4IA 4JANB 4LSUH 1KEGL 5D7LB 1MUJB 2VRAA 3AMKA 1MRDL 2AGJH 3LN4A 4XMLL 4WI6A 3IDJA 1DBKH 2BSED 2ZOLA 5C0EB 1H8OA 1FLRL 2VLJA 5EOTA 4NUJB 3NGBB 3VGGA 3ZDYE 4HIHB 4OUOA 5L9DH 5TE7L 4UILL 1OF2A 4Y16D 1XIWD 1LE5B 4QTIH 2HLFD 1FN4A 3D0VB 4M1DL 3AUVA 3TPUB 4HIJA 1OTUC 2NNAA 5IBTL 1QQDA 1I4FA 3O6LL 4UBDD 3K4AA 1HSAA 2EH8H 3HUJA 1YZZA 4LMQE 4QXGH 2HVJA 5EG6C 5IEKB 2ID5A 3LQMA 3FT3B 4JRXA 4LSPL 5I15H 4GMTL 1MCHA 2NY0C 4HPYL 4CN4A 1ZLWK 3T4YA 1UWEH 4J4PA 2VAJA 3I02B 3O2VH 4JREC 1QSFD 5E2TL 2APWA 2XNAA 4NC1C 4PRHB 5D7JA 1OW0A 1S7XA 3MPCA 3ULUF 3WNPA 5D1QC 5I75C 3KPLA 5FGCE 3RWJB 4LLDA 4UIKH 1LO2H 2BSSA 1K6QL 1TCRB 3LH2L 3W82A 1A14H 5E6IC 1D5BA 1AQKL 5FYLD 3M8OL 4FHBD 4EOWL 3NIGF 4BZ2H 3WIIL 1SJHA 3T77B 1ZMYA 2CDGB 4Z7UB 4HC1L 4XBEL 3VXNB 2VN7A 5A2LH 5LQBH 5FFLA 4O02L 5J12B 4OCRL 1TLKA 1FL5B 3D39A 4JZJC 3QPXL 5HHXL 3FO1A 3C08H 3SEPA 3DO7B 4GBXC 3UTSD 2CIKB 5T3XE 4OZIE 2DQGH 4WW1A 3DMMA 1HXMA 3KNBB 4KY1L 2CK0H 3F8UB 1IAKA 5C86A 1G7HB 3T1FA 3P9LB 5F9JA 5JR1L 1QTYT 4AIXA 3O9WC 2FRGP 3VDAA 4Q58C 1DE4A 1UZ8B 2AJXL 4GUPB 5FUOL 3WBDA 3V7MA 1RMFH 3C6LD 5T33L 1WZKA 1HN1A 4S2SA 3QG7L 1FYTB 1CICB 1CGTA 1S7UB 4XNZC 5AG9A 4E0RA 1BOGA 4Z7WB 4LLQB 1MWAL 1NCAL 4DFIA 4PJCF 2X4OA 4HKZA 4X0KA 3T3PF 3FCTB 3MLTA 1JPST 2PYFB 2R1WA 5KN5B 2DLTA 1CU4L 3WJLC 4U6HA 1BAFH 4WU5B 1UGNA 3OJMB 2C4FT 1Y18A 1YUHB 5TF0A 3P2TA 4M43H 5C0AB 3FRPA 3MJ7B 3QJHA 4Z8FH 3QFJE 5C0CD 5J1AB 1U3HB 1MCPH 2J6EH 1E0OB 5I0ZA 4X99B 1J7VR 4C58B 3BRDA 4M5YH 4G43B 1UWXH 5FDWA 2CK2A 3U2SB 2E7LA 4ZXBD 1JYXA 2R23B 1J05B 4RFNC 4NKOA 3BWUC 1NBQA 5JZ7C 1YN6A 2Y7QB 4WI7A 4Q6IA 1ZLSH 3OHXA 4B50A 1TVBB 4G9FB 3QQ3A 3G04A 3UTSE 3FMGL 4IMLA 1WBZA 4HKJB 2WIMA 5EIIA 1YEFH 3VDBA 1JUFB 3CVHL 4E41B 3AAZA 3GJFK 1XR9A 2G75B 5ISZE 1JGVL 4JFZL 4ERSH 1C08B 1KJ2H 5KW9H 3B2UC 4CRPA 5T5FL 1Z5LB 5DT1H 4QRTB 4N0UB 2X9YA 4DK6A 3I6GB 1G9MH 2R2BA 3HLAB 4XC1L 2EIZA 5KVFH 1E27B 3WIHA 4ZFOL 4APQC 2LVEA 2BHZA 1YYLH 4YDVB 4R7DB 4MA8H 4OGYH 3ARFC 3Q3GB 3HNSL 3HNTH 1HWGB 1WCBA 1FVDB 2EYSB 4N0FA 4NO3B 4XP5H 1F4WL 1CXFA 4JFOB 5E9DA 4ZUSA 1MJUH 5SX4H 5B39B 1MWAB 3QDMD 2VQ1A 2R0ZH 3H2WA 4PY8I 2YN3A 4PRIB 5HHPA 1WZLA 1DQJB 5E4IA 5BMFH 1NGXB 4IM8A 4X80L 3TZVD 4Z7VB 4WCYL 3V6FA 1KJMA 1CS6A 3FONA 1A1MA 3V6OE 1D5XA 3DRQB 5F7EH 2NX5D 1D9KA 5HGDA 3KPQA 3BSZL 3BWAB 1HOCA 1RZ7L 1XF4B 3MRFA 1K2DB 2E6JA 4LCCB 4NUGL 3SY0A 3DUUB 5DJCA 1AGDA 4NNXB 3BIKA 3AREA 5EU3A 2ITDB 1N4XH 2WQRA 5EA0L 4WTZA 3QEQE 3HAEB 1RUKH 3R8BB 5C92A 1Q72L 1DVFB 1S9YB 1VPOH 4P4KB 5JNYA 1TQCC 4LLMA 3S88L 1U8MA 3ZT5A 2PTVA 2HJFB 1T2QH 4N0RA 3DI2B 5DJDB 3I3BA 4JFEE 1FIGL 3ES6A 4EJ1C 1UQSB 4PJDF 4MVBD 5ANMA 4LARH 1RK1B 4JKMA 2J88H 5EU6A 3CVHB 4P46D 5ENWB 1I1YB 2ADIB 4YHML 4FFZL 5F3BB 5EU4B 3QPQD 5A2JH 4UOW1 3ZO0A 1AJ7H 1MAJA 4U4BA 4GAYB 2Q8AH 2OK0H 1GGTA 1UM5H 4NKMB 5IHZA 1RIHH 3Q6FB 3LN9A 3GZKA 1XR8A 3IAGC 3MO1B 4N1CA 4YUEL 1G9NL 1F3DJ 1X5HA 1R5IB 1IKNA 4RZCB 3CPLB 3QULB 1Q0XL 5I8KL 5DS8B 1HE7A 4U1MB 3ILQD 1NC4B 2EDXA 2Q7YA 2BMKA 1WWCA 4MA3B 2JCCE 2AXHA 5FGBC 5BRZD 2ZUVA 2HLAA 2X4RA 3EOYG 3IJYB 4AYFA 3CLFH 4O58L 2Z93A 5CBAA 4JY6B 3VWJC 3MRRA 4DN4H 3GRWA 1I75A 3OR7A 4UDUB 3T0XA 1WAAA 4YO0A 1XZ0A 1N64H 4YZFF 2W9EH 1XGRB 2ZUYA 1RK0A 1EERB 4XXDB 4Z0BL 2IH1B 3IFPA 4OT1L 1FO0H 1JRHL 2H8PA 4P59L 3BPLC 1MCSA 4X8JA 5I74C 5DEGB 1KV3A 2EC9U 2P8PA 5E56A 3D3VB 4PGDB 4GG6A 3C60D 1BPVA 5F1IA 2BRRL 4KK9D 4H1LH 3FFDB 5ALCL 2FZ3B 3QCTL 5I16B 5DXWA 3ULVD 5GSVB 3PGCB 4ELKB 4TRPL 3PHOA 2C1PB 1KOAA 2IEPA 4GQ9L 1OAUH 1S5HB 1I7RB 1NGQL 1T89C 1CIDA 2C4XA 2DJUA 4MMZC 4Y19A 5FM8A 1JF6A 1TVHA 1U3ZA 2ZUTA 1KXVC 1C12B 4PJAB 4U3HA 1JMXA 1Z2KA 3ARUA 3SDCD 4EN3A 4Z76B 3KYOB 4KZDH 5K9QI 1I7ZA 1AXSB 3R06B 3U7WL 1EAPA 1A7QL 4HK0A 2Z35B 3EFDH 4F8QA 1HYSC 4PP1C 4OZIB 2HVKA 3MLPA 2FLRT 2EKSB 3IS0X 4UZGA 3PWPD 4XCNB 4QTHA 3L3HB 4HV8A 3X14A 5IQ9B 2FH8A 5I1IH 3RGVA 5JW4M 5D5ME 2C3VA 1ADQL 2VXVL 2GKIA 3G6DL 3KHOA 2KKQA 2EO9A 2VDKL 3ZSTA 2Y06L 5L88H 5JIPA 1DCLA 1ZHNB 3U1SL 4PJEF 3QYCA 1R5VB 2HJKA 4LOUC 2VQTA 5JORA 4DW2H 2JLLA 4TVPE 4HDIB 5D2NA 1I8MB 1MFBL 2OQJA 5A3IC 5BOZG 3JWOC 2I9TB 5E8EA 2VLKA 1U42A 1NCCH 2DQIL 4KKAD 1FZKB 3BE1H 3ULVE 3ULUL 4NNYB 4OZ4A 4M7JL 3QHTC 1MQ8A 4U6TA 5C0FB 2IBBA 2RIKA 3PL6B 4QRQB 1H5BA 3L3KA 5EO1B 1P4LA 1F45A 1CTNA 4NRZB 1UENA 2A83B 2KQNA 3NACH 3PV6A 2IADA 5HYSA 2VIRA 4XGZA 2FEDC 5GGUB 1ZHBA 4X7CC 2OS7A 5F7DB 3MLXH 4M62L 3ELAT 4TUOB 4QXWA 1INQB 4NT6B 3NCJH 5GGQH 3W2DH 5J6HB 3TESA 1KTLB 4NHUB 1KLUA 5HI4C 4WFGE 12E8H 1BQLL 5D7IB 2G5BA 3HC3L 2EDRA 4IIQB 5KVGH 1KT2A 4U1HA 5BS0D 1KB5L 5I71B 3FHAA 1WTLA 1BM3L 1EFXB 5IM7B 4Z0XA 3NOIA 3DXAD 4KGJA 2I60L 4G7VL 1L6XA 3I2CH 4GRLB 4Y7MA 5ITFB 2D2OA 3MFFB 4GMSL 1H3PH 4JE4B 3U0TA 5DUPH 1M71B 2P5EA 5H94B 4XPAL 5B3JE 1J1XH 2DBJA 2WWKT 3OXRB 1DQLH 4IRJC 2AK1L 1HIMH 5F70A 4GW5B 3SOBL 5IV2A 5KSBE 4MSWA 1INEL 5FM5M 5LG1A 3QNYB 3WUZA 3U7AA 2E7HA 3MRMA 2ESVE 4JFYB 1ZHLB 5DUBA 4FTVA 3BD5A 5GGVL 1KG0B 2VLLB 1MREH 3IFOA 3WHXB 3ULSA 5I1JL 4KHTL 4QHMA 5KTEH 5CEZH 4NO5A 4HJJH 2EDWA 2YPVH 5IBLC 2ICEA 2A1WL 4WEBL 3P4NA 3VFVB 3PP4L 4KKLC 1GGBL 4WV1C 3BQUB 1Z9SA 1I85C 2OZ4A 3FT4B 4HSQA 2DWEA 4HWBH 4ELME 1G7JA 5EPMB 2K9UA 5GGRA 2Y4SA 1IT9L 4S1DD 1A4JB 4TUJA 4WO4B 5I30L 1N5AA 4RMSA 1MNUL 3MRNA 4BH7B 1OAKL 2XA8L 2P5WB 1DJSA 1XGUA 3HUJF 4PJ9A 3ZYJA 3UZQA 4XNMB 1ES0A 2D9CA 3DIFB 3L5WB 3P0YL 3QHFL 1BD2B 2AI0H 4PIRF 4U7KA 1CGXA 2OCFD 4K9EL 3CX5J 5ACMA 2EDEA 5EO0A 3QDJA 2OR9L 3UYRL 4R4FH 4N0CD 3VWKD 1J9CT 1FFPA 1TTGA 1CT8B 4O51B 1YNLH 1MF2H 2B39A 5TDPA 1QLEL 3FB8B 1WVZA 1O7SA 1X5AA 3RU8L 4WUKL 2NQCA 1F97A 2VSCA 1KB5B 3FO0H 1LP9A 3GIZH 3UTZA 2IALA 4ZG1A 2DDQH 3V95A 1S7WA 3PABB 3EYSL 4C56D 3BZDA 4J3XA 1VA9A 1RZKL 1ND0B 1PX3A 2EDNA 1RFDL 5DJYA 3U9UA 1L6ZA 2BJML 5DZNA 4YH6A 2BVEA 3H42H 5FHBL 5IT2L 4H8WH 3MJ9H 2J6EA 4K71C 1T0MA 5C08A 3WHE1 4LSSL 4PRAA 1HKLL 2QQNL 5GS2H 3IAQA 4NM8L 3WNNA 1AC6A 4EI5C 4Y1AD 1G6VK 1NSNL 2BERA 2ZKHH 1G6RH 3DBXA 1YMHA 3L3DB 1YEEH 4XVSL 3SJVA 3KJ6L 1MHHA 4Y4KB 4MXQD 4NCDA 4PLNC 4L4VD 3BH8A 3W39B 3C5ZA 2BNUA 4LCWA 3IXAB 4NJ9H 3M17A 1F4YL 3C2AH 3A6CH 2DQJL 2CKBL 5DD3H 1W0VA 4X7FC 2W9DH 1KJ2A 3TH3T 3STLA 5ESVB 4JO4H 5ALBH 4MD4B 3TBYB 3H7BA 1WCQA 5FA3B 1KCRL 4WFEE 3LKQB 4KKNA 3WO3B 1DQDL 4GKSB 1UVQA 4ZTOH 3BO8A 3SE9H 2F15A 5TQ0L 5FV2A 1WT5A 2DTMH 3UTPE 1UJ3C 1DLHB 1ZT1A 2FEEI 1NC2A 5IB5B 4NJAH 1OSZB 1FL3B 1LGVA 2NZ9C 5DMGC 4MLSA 5BV7H 1LO5A 2CLZB 2VOTA 4RFOL 4UMGA 4M8QA 3QXTA 3B6SA 4DAGL 5BJTB 2FO4A 4P2OD 3MNZB 1RURL 2Z31B 4UQ3B 1DLFL 1DBBL 2XTLA 1KTDA 2D7MA 1BECA 3D85A 2FJFA 4RQQA 4PUBL 1ITBB 4QNPE 3VG0L 5C09B 4D0CA 5E2JA 5JHLL 1PSKH 3GSQA 3O3EA 1NCNA 2WBKA 1ORQA 5DHVH 3X11A 4HIXH 1TZHB 2WUBL 2AXGA 4XMKL 5KSVB 3CZJA 5D7LD 1UH2A 5CEXA 3L7FB 3VXSD 4POUB 5EULV 3O2WH 3K3QA 2EXWC 4D8PA 3P4OB 3ZLQC 3O6FC 4LEXH 3VXRE 2DMKA 1AR1C 1G1CA 2K1MA 4WRLA 5TE6L 4GS7B 5D5MB 3HG1B 2EH7H 1OLLA 4MAUL 4AIOA 5E5MB 3DGGA 4ZS6D 4P2QB 3ARYA 4HX1A 4BQ9A 4OD1L 4JRXE 4TOYL 3RKDD 1A6AB 1IJ9A 3M07A 4L8SC 3WD5H 4FG6D 1AE6L 1GGCH 4UOW0 5BQ7B 2BSTB 4ZAKB 1AI1H 3DSFH 3HE7B 1ZANH 3S4SB 4RISL 4PP2B 4HUVA 3QIBB 3UPRB 1N6VA 2CLRB 1RHHA 4YR6B 4KU1A 4LGPB 5DC9B 1FQ9C 5T1MB 2HWZH 5MI0C 3T2QA 1NLBH 1FZMB 2I27N 4NQVA 1U92B 2EDKA 1YEGH 5K59E 3C8HA 2ERJC 4I48A 2DLHA 4J6RH 2PCPB 1Q9KB 1AD9A 1IGTB 2CSPA 1A02N 4MNHB 1MEXH 4JGJA 4DOHE 3DARA 2ZOKB 3MC0A 4JEGB 2W0FB 4WJ5A 1I9IL 3MBXL 4YDKH 2FR4A 3ZYOA 5ESAB 2OL3L 1F5WA 3IGAB 1F4XH 2ICES 2NLJA 5J0BA 2QJDA 3VXSE 1B4JH 4S1RH 1NLDH 3HC0B 2ZG3A 1KLFA 4ZFZA 2KBGA 4RAUA 1A6TB 4U1SA 3QUXA 3WFHB 5C6PB 1QFOA 3VXUA 2VXUH 3EKCA 5FCUH 5D2LE 4HKBB 1FO0A 3CXHK 3VXPA 3TA3A 1N5YH 2QR0A 4WTXA 1I8LA 1EEZA 4TUKL 1VENA 5KSBB 4OKVB 5I0DA 1FE8L 1QLRA 1Q1JL 5I1DA 1VERA 4MS8D 1FLTX 4H1LA 3EDJA 4H0HB 1FYTD 1CICD 3ARBB 3L6FA 4R7NB 2J7LA 4FQLL 2NXYB 3MGOB 4LPXA 1HCFX 3BW9B 4OB5L 3G6AA 4Y2DA 3DURA 2PTTA 4X98B 1TPXB 3T0ED 3IS1X 1QR1B 5B39G 4G80B 4HWEH 2JELH 3QUZB 4OV5B 2P44B 3LB6D 4L9LC 1CE6B 4R0LB 4NZTL 3VI3F 3FQXA 1WZ1H 1CVSC 3MYJA 2G9HB 2XA3A 1U3HD 5CP7A 5K9KA 1Q38A 1CLYL 2F53A 3LPGA 1MPAH 3RUGF 43CAA 4HUKB 1WEJH 4RMTA 1EGJL 3D2UB 5FUZL 2IH3A 2FSEA 3P77A 5C7XL 3FN0H 5JXAL 3HA0A 1KNOA 5C0BA 4N0YL 4GG6F 4IRSB 5CSBA 5DD0L 1QEWB 3MLWL 3R1GH 1S7TB 3HAEG 3H0TB 2SEBA 4G8GA 4E41D 5EOQH 2C4FU 4LLYA 2O5XL 3GMNB 3VRLE 5CHNB 3MV8B 3RIAF 1WITA 1LEKB 5MEPA 3DV4A 1CCZA 5GRJL 1HSBA 3GKWH 4G6KL 3VJ6A 2YD2A 4HHAB 4ZUVB 4JRWA 4JM2C 1MJ7H 4PJEB 5E9DE 3UROR 1AGFB 5FYKE 1CL7H 1H8NA 1A6PA 4HZLB 4YDLC 3WSQL 4PJHA 3VD9A 2FL5A 4LK4A 3MBEC 4R4NC 4CADA 2AW2A 3LQZA 3ARTA 3LRHA 2NXZC 1TDQA 5E99L 4Q0XL 3NFPA 4P23A 2JJTC 2VN4A 4AZ8A 2DQDH 3DUSB 1VGKA 3QR2A 2VDRL 4N5ED 1FDLL 1EHXA 4OFYA 5DQDL 1RJCA 4I77L 1QFWL 4LPWA 2DMBA 3BGAA 1BF2A 5DQ9B 2C3XA 3AB0B 1FVCB 1ZSDB 4Y4FB 5DJZB 5TDNB 1JPFA 1T1YB 1XGYH 2PW1B 3B3IA 2AK4B 2XPGB 5H2BB 3OR6A 1AHWA 1S7RB 2ARWA 2IPTL 4BK5A 5B22A 1FNLA 3TFKC 1N2RA 2O5YL 2Z4QB 4AIZA 3LKNB 1X5IA 5BVJA 3FOLB 4KRPC 4K7FA 1I3UA 4P5MA 5FB8B 4CU8A 4UTBH 3EO0A 4LQ1A 5ANME 1DVFD 2X4UB 4P4KD 3T8XA 4IOIA 4FP8H 3JUYA 5DRXB 1XF2A 3BHBB 1BP3B 1OCWL 4JFPB 5MENB 3OGOE 4AEFA 5HHMB 3RWDB 4AL8L 4JQIL 3UX9B 1RU9L 3MNWB 2ENSA 2AS5M 1J8KA 5TDOB 3QCVL 4L5FH 4P23C 1XF5A 3ARVA 3B4NA 3LKOB 4RGMC 5F89B 4E5XB 2F5AH 1BFTA 3WLWC 5D71H 4GRMB 3TCLB 3ZDZE 1T1XB 4XH2A 2AJZA 5I6XB 1OAZL 3FFCE 2NY1D 3ARGC 1Z9OA 3QUKA 4HWBA 5C0ND 1CFNA 1JPSL 2ITCA 1NC4D 3LN4B 1HHIA 5D8JH 3CMGA 3IDJB 4PS4L 3IFNL 1GXEA 2ZOLB 4TSCL 2VLJB 5EOTB 1LWRA 4QHLA 1UADC 3TV3L 4R9HA 3S35X 1U3JA 1YEDA 1CGSL 2IG2L 5LBSH 3FZUC 4F57L 4L3CA 1OSPL 2CH8A 3GMOA 5CBEB 2ZG2A 2KQMA 2LVCA 2ZJSL 3B8SA 3FQUA 3I75A 5LWYH 1CD8A 1HH6A 1N8ZA 4P3CL 2D31A 2NNAB 4WTWA 1QQDB 1I4FB 3RX7A 5FYJH 4XPTH 1HSAB 3HUJB 4NCC1 1MCOH 2NY3B 2HVJB 5I8OH 4JRXB 5EUOA 1S7SB 2WBJC 4MA7H 4ZTPH 3IB4A 1U8JA 2BP3A 4YK4C 3GSUA 4AG4H 5ID1A 3T4YB 4KKBC 4F7EB 1XCTA 3F6IA 2F58H 5DRNB 3E6FA 4LDEB 2XNAB 1NEUA 3OKKA 5KAQG 2H32H 5D7JB 3U30C 1UCTA 1S7XB 3HNVH 4JG0H 3MOAL 1JYVA 5JTWA 3D3VD 1LK3H 2YD8A 2HTKD 3KPLB 2HP4A 3BRFA 4LLDB 2BSSB 1BZQK 3LZFH 4XCFL 5IVZA 2R8SH 5F93C 3OG6B 2VNCA 3MJ9A 3RVXD 1SJHB 5ICZA 1SEBB 3TWCH 1JFQL 3WHE0 5J3HC 4Y4HA 1IAIH 2B0SL 3EGSA 2BVTA 2ZZUT 1JF1A 2A9ML 3L1OH 3PDOA 3D39B 1G6RA 4XCCL 3TPKA 4DN3H 4YWGL 3NCCB 2XZQH 2X42A 3RIAK 4W68A 5TQ2L 2EXYD 3VXTA 4KC3B 3DUHA 3DMMB 4WW1B 4MJID 4NHCL 4UT9H 2EKJA 3MRDB 1IAKB 3LEYL 3T1FB 5F9JB 4MA1B 1PBYA 3I50L 3WIHL 1BOYA 1F3JA 3GO1H 1T6WA 5T1KD 1DE4B 2VUOA 4LSVL 5SWSA 5T1DL 5EIVA 3JV5A 4S2SB 3UJJH 1I7TA 4QY8B 3ARQA 1BOGB 5FHAL 3I6LD 2OMNA 2AEQH 2PTUA 1MELA 1OM3H 4LP4A 4DKFH 4JM4H 1JCKA 2W59A 1KYOK 2X4OB 4HKZB 4X0KB 4R8WL 4HJ0C 3QNXA 3MLTB 5CAYB 1UH4A 1NAMH 1OAQH 1QSEE 2R1WB 2VLKE 1JGUH 1OPGL 4N8PA 4U6HB 4I0CC 4P4RA 1Y18B 2YHGA 2LFGA 4QXUH 2R1YA 3F6LA 1OTTD 2FECI 3QJHB 4LVNB 1C5BH 4F15B 2XG4A 2B4CH 3ZE2F 4JO3H 1C8PA 2IC2A 4KV5E 3U0WL 2L0DA 2HLFC 4Q74A 5FDWB 4XPBH 5AWNL 4I18C 3PL6D 4G6FB 5SWQB 4XI5C 3VFWB 1YN6B 3BVNA 4MNGA 4L3ED 4RMVA 4Q6IB 4UBDC 2FGWL 3OHXB 3IU4H 3QQ3B 4U0QB 1T66D 3H9HA 3WFDH 3P9MA 5DHVA 4IMLB 1WBZB 4A6YH 5EIIB 2YZ8A 5DEFB 2ZUQB 4MJIE 1PW3A 4JQVC 4PJXA 3AAZB 4BFEA 1W0YT 3WIFA 5HVGB 1XR9B 5ITBL 5FECB 4MQXD 1YYMH 4JPIA 1YEHL 5I8CA 2G60L 5ACLA 4UV4H 1FAKT 1VB9A 2R2BB 1KCVH 5DJ6A 2E27L 1BVZA 1HINL 2XN9E 1CD0A 4S0SD 4KHXL 4PREA 3KJ4C 1S5IH 3LDBB 1JHKL 4X9FA 1R0AL 1A3RL 1XGPA 4GRLD 4BSWA 4HF5H 2HT2D 3BXNA 3WKNA 4W4OA 3NCEB 4AEHH 4N0FB 5JLZB 1RSFA 2E6QA 2X5PA 4OLYH 5E9DB 4ZUSB 1DBJL 3BGFC 4U1GB 2VQ1B 1FP5A 4WY7H 1RUQH 1TJIL 3PHSA 5HHPB 5C8JA 2YD5A 3VGBA 1KELH 1AGEA 3V6FB 1KJMB 3GRWL 35C8H 1A1MB 3E6HA 3CAFA 1D5XB 3VH8A 4HGKC 4MJ4A 5DD1H 3FL7A 4M7ZB 5CD5D 1D9KB 2VDNH 4L3AA 5HGDB 3KPQB 4XPFL 4JFHD 5K33A 1E4XL 1HOCB 2HG5A 4B41A 2GFBA 3C6LC 3MRFB 5KVMC 2BFVL 2RB8A 3LN5A 1MCNA 3SY0B 3MODH 5DJCB 1AGDB 5F97E 5AZ2H 5TJWK 3AREB 5EU3B 3BQUD 3OAYH 4LSTH 3ULUD 1C16A 4RWYL 4BJLA 5JNYB 1FBIH 2X89D 4LLMB 5D70H 4Q6YA 1U8MB 2R0WH 4S1SL 1UT9A 4P5TD 4WO4D 1D6VL 3BT2H 1DP0A 3QDJE 1MRCL 3CVIH 5CINH 2P5WD 2PR4L 5ANMB 5JW3L 5ACZA 4B7IA 5EU6B 3MV7A 4HPOH 4QOKE 2LAGB 1OVZA 3CMOH 1U8QA 5ELIA 4YHOH 1BD2D 5DK2B 5F96L 4JFQA 4GOSA 3GMLA 2X7LA 1C7SA 1MH5A 4N8CH 1BREA 1LP9E 1QKZL 3CDFA 4NWUL 4Z18A 4DVBA 2J3SA 3WDHA 4CW1A 1U8KA 3IDNA 1AKJD 5IHZB 3WCYA 1WV7T 1XR8B 4ZXBC 3ILPB 4OM1L 4XMPH 2P4AB 3EDKA 5C2BH 1S3KH 3LS4L 4KJPD 4WEMB 3HMWH 1BIHA 1MCQA 4JFFE 4GJTB 4UOJA 1AY1L 1IAOA 5I1GH 1MVFA 1ULVA 2Q7YB 3HFML 1MLBB 2BMKB 5FUCE 2JB5H 2GJZB 3QO0A 4AEIL 2D7PA 2HLAB 5F44A 4LVHC 2X4RB 5FEBA 1MAML 5KSAC 4DK3A 2W0KA 4O9HL 5CGYD 5CBAB 4PTTA 3THML 2AJVH 3MRRB 4OFIA 3FRUB 3OR7B 3T09A 3FAWA 5CGTA 5CMAA 4YO0B 4FQCL 4XCEA 3TN0A 2VLMD 4HBQA 3TVMD 4D9RD 4I3GA 1XZ0B 4EQ2A 1NFDE 4TSBL 4W81A 5IVXF 5HYEA 4TNVF 5HHVL 4QF1A 2IAMA 3PWUA 3QT2A 4OGZA 1KENH 1YA5A 3IFPB 2H8PB 3PQYA 4X8JB 3G5ZA 1S9KC 4A2MA 2P8PB 1A8JH 2JJVA 4UDTA 4OCYH 3TZVC 3O11B 4GG6B 5F1IB 3TCXA 2Q6WA 2YD6A 3FJTA 4FQQA 4OCMC 5HDQL 2DOCA 3HB3D 3W9DA 1YNKH 5IESH 3SPVB 1A9EB 1AC0A 1VEOA 3T08A 1UEYA 1ZT7A 3LRSA 1WBXA 1R3KB 3P9WB 4JDVA 4FFYH 1P4IL 4XAWH 1R3LA 3RHWF 4LSUL 1CDYA 1NCDH 5J13C 2AGJL 3SDAA 1BFVL 3QBTB 2CO7B 3QDGA 4Y19B 5TE4H 2CO6B 5D1ZD 4LRNH 1TVHB 4JCLA 4MQ7A 4RX4D 5L9DL 4PJCE 1J5OL 3T3PE 4Y5YC 4Z7OE 4QTIL 1HK6A 4EN3B 2W38A 2Q86A 2WIIB 1I7ZB 4PJ7A 4MVBC 1IC7L 1TQBC 5IKCA 1IGYB 4HK0B 4H25B 4P46C 2Z31D 5EZOL 3OSKA 4ZD3L 4PG9B 2NW3A 1JZ3A 2EH8L 2HVKB 3QPQC 4QXGL 4JFDE 1T7WA 3Q48A 1CXIA 2ADJA 4M93B 5C09D 5I15L 4QTHB 1JRHI 2E8ZA 4HV8B 3X14B 1HNFA 2X70A 3RGVB 2VXSL 1V5JA 3I84A 3O2VL 1HDMA 4ODWA 3MNVA 3L3IA 2DI9A 2YXMA 5GRXG 2V2XA 1KIRB 1BWWA 4M1GL 5E2VH 3ILQC 5CS7A 4MJ5A 4PJHF 2J4WH 1LO2L 5JORB 3HG1D 5D2NB 1A14L 3QO1B 2OQJB 2VLRA 1P5UA 3EYVA 1B0GA 5E8EB 2VLKB 5FK9A 2J8UE 3MRKB 4P2QD 4KDVA 5IWLC 4OZ4B 5GHWH 1CQYA 3D18A 3G5VA 3GUTA 5LQBL 2VJXA 1H5BB 3L3KB 1P4LB 3PHQA 1ZTXL 4ZAKD 3PV6B 3C08L 3ZKQD 2IADB 3HE7D 5HYSB 2VIRB 4WWKC 5DC0A 4XGZB 4H26B 3WXWL 5FO8A 1ZHBB 2XKNA 2DQGL 3KLDA 2CK0L 2A38A 4G42B 4OCWL 4OLWH 3OG4B 2B2XL 5T3ZE 5C3LD 1NBZA 1WIPA 3AROA 1RMFL 1ZVSA 2E7MA 4J8RB 2YPLA 2G5BB 3C60C 5F9WB 4KK9C 5JQ6L 4PLKD 4U1HB 5JPNA 1DUYA 1HXYB 3TO4A 2NW2A 5DC4B 1LEIB 4MXVF 4UB0H 4Z0XB 1SQ2N 3CFDA 2VDPH 1XGTA 3EYUL 2DI7A 3KPTA 1BAFL 4PJBE 3SE3A 3QI9A 1T83A 4PV9A 3RIFK 4GW4A 2GSGA 2AJYH 3GMPA 2P5EB 5E8PB 1MI5E 3CFKA 5HGHA 5IV2B 1VDGA 4IS6B 4MSWB 5D1XD 5I8EA 1MCPL 3DSNA 3WLBA 2GHWB 5DFVD 3E2HB 2H32A 4RA3A 3CXHJ 2X05A 1X5GA 1MCIA 3BPNB 3SDCC 1EZVY 2CRYA 4NO0A 1IC1A 1KBGH 2BDNH 3ULSB 5CJOH 4QHMB 4JPWL 2GK2A 2ICEB 1YN7A 5HVHC 3P4NB 1GZQA 4N90E 4R2GB 4O2CA 3QEUA 1YEFL 1NGPL 3P30L 2DWEB 3GJFB 4GRWF 1G7JB 3VGAB 5GGRB 4PR5A 3TT3L 4Q9QL 3OV6A 1T03L 3JV4B 1MHEA 5JUEH 4TUJB 2A74B 4I3RH 1KJ2L 2N1KA 5KW9L 3QUZD 1C5CH 3OJVC 3MRNB 1JE6A 5JPMA 4PJFF 1XGUB 4U1JA 2PYEA 4PJ9B 3HAEH 1JL8A 1G9ML 2CDEB 1ES0B 1T1WB 1MRFH 1XT5A 4X6CE 1YYLL 4K2UH 2DM7A 4ZUTA 5EO0B 4ZMAT 2Y07H 3QDJB 4MA8L 4D9LL 4UTAL 3RHWK 1ZAGA 4OM0H 1W8NA 1AP2A 1FFPB 3EJJX 5HHOD 5CD3A 4KH2A 4QOKB 4XP5L 5TDPB 4G3YH 4IRSD 1IL1A 2R0ZL 4FXLA 2XRAH 2DQFA 1LP9B 3UTZB 2BNRA 1GOGA 2IALB 1CK0H 1WC7A 2FIRT 1NAMA 5IMOA 4LVOC 3EJYD 5DLMH 5C2UB 3MV8D 2DQCH 1MFCH 4MNQE 5F7EL 5DJYB 3U9UB 1LMKA 2CIIB 1ZA3B 5JHDA 1QPXA 3KXFE 2FHFA 1T0MB 5C08B 2AJSH 4O00A 4PRAB 1OP5K 4K3DL 4F9PA 1FSKB 4GG8A 1RUKL 2HFFA 4HWZA 1J88A 4X6FA 1DL7H 2GCYA 1V8HA 3SQOL 1YMHB 5I1KH 3JSSA 3LEVL 4M6MH 1E4WH 4QRPE 1XF1A 2Q87A 1CXLA 1MHHB 4NGHL 4A6YA 3SKUD 2PXYD 3BH8B 4O5LH 3BP4A 4LARL 4LCWB 3ZT6A 4OUUA 2QSTA 3M17B 5IB3A 5CWSB 1BGXH 3T04D 1NFIB 4Y4FD 2BOCA 1AJ7L 3STLB 2Q8AL 2OK0L 2AK4D 4NQSA 1OP9A 1RIHL 4R4BA 3SGEH 3C6SB 3H7BB 4B53A 1BBJA 3IKKA 4EDWL 3MV9A 4Z7NF 5I1LA 4P9ML 4YE4L 4BQBA 4J3SA 1UKQA 3L95A 1CXHA 1UVQB 3BO8B 4JHAH 3V0WH 4K07A 5DJ2B 5MERA 4KAQH 4YAQA 4NQCD 1T04A 3MRBA 4NQED 4FMFA 1OTUD 1NC2B 3RVVC 4NQDA 1J8HE 4S1DC 1V05A 3QUML 3IRPX 1JF5A 1JZ4A 3DX7A 1LO5B 3F5WB 1A9BA 4PG2A 3O4LA 5HHMD 1RUMH 3UTOA 3BKMH 2XWTB 4M8QB 5C70A 5L0QC 5I19L 3B6SB 2FO4B 3NIDF 3HRPA 4PJXF 4PJ8B 1KTDB 1WFNA 3D85B 5IF0A 2FJFB 4RQQB 1J1OH 3CUPA 4D0CB 5I1CH 4PRDA 1E4JA 3QXVA 3VWKC 3MYZA 3GSQB 3O3EB 1EEYA 5E6ID 3X11B 4YXLH 2AXGB 4KRNA 2L4OA 5T3XH 1CG9A 3V4UL 1FO0L 4I0PA 5HDOA 4PGCA 3KWWA 1CFVH 3FB7A 3QQ4A 2D9QB 2IQ9L 2XTJC 2ADFL 4D8PB 4P9HH 3D0LA 2DWDA 1NH6A 4YHYC 2VXQL 1JNHA 4XP9H 2UUDH 2BX5A 4C54A 2WQ8A 3TM6A 5KS9A 3N85H 1LNUA 3DGGB 1X6LA 3OB0H 3R0NA 4HX1B 5LGJA 1QP1A 2WM0A 4GBXD 3RRQA 5B8CA 5EUOE 3STBA 4HS3A 1PLGH 2ATPB 2KZ1B 1E4KC 3GSXA 2N56A 1OWRM 1OAUL 3O9WD 5EU5A 1ZS8A 1Q0YL 4NQEE 3FAXA 3UDWC 1HYRC 3IAPA 1ED3A 4HUVB 2IPUK 1N0XH 5L8JB 4DZBA 5AD0B 1RHHB 4J4PD 4P3WA 4I9WE 1D6EA 3RPKA 4KZDL 4MXQC 2F54E 1V3MA 4NQVB 4PLJD 2VAAA 4MB3A 2VYRE 3FRPG 3EFDL 1X7QA 3ARDA 4I48B 3RVUD 2HFEA 4B0MM 4UT6H 3HTLX 1AD9B 5DHXB 1NMBH 1QZ1A 1T2XA 2DS4A 1UXWA 5L2KE 5I1IL 3G9AB 4WJ5B 3R8QA 1HHHA 1VFOA 2FR4B 5C0EA 1FVEA 4KWUA 3FB6B 1SHMA 4NUJA 2NLJB 5L88L 2R39A 4NKQB 4LCIL 2J1KA 5IROC 3D39D 2B1HH 4RAUB 1LE5A 3MRLA 4U1SB 1DDHB 4FNLL 3LS5L 4OLZL 4OCXH 4MAYA 3TPUA 3VXUB 1YEIH 5FGRA 5JZ7D 1X5FA 1NCCL 5FIEA 3RWHA 1FO0B 3VXPB 3TA3B 5J1SC 4LCUB 1CXEA 1QNZL 4NN6C 5HVWA 5IEKA 2J5LC 3WNOA 3FT3A 1J0IA 1EEZB 5DRWA 4P2OC 3RI5F 5I1DB 1P53A 3VXQA 3C2SA 3I3DA 5HVFB 4H1LB 1P2CA 4POYA 3L6FB 2LAAA 4HD9A 3G6AB 3MLXL 4WGVB 3DURB 4Y2DB 2PTTB 4TPRH 1KYOJ 3EO9H 3GIVA 4C4KO 3NCJL 5GGQL 4WIQA 3W2DL 2PO6A 2IAND 4BSJA</