2AJUH

Cyrstal structure of cocaine catalytic antibody 7a1 fab'
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
EVKLSESGPGLVKPSQSLSLTCTVTGYSITTNYAWTWIRQFPGNKLEWMGYIRSSVITRYNPSLKSRISITQDTSKNQFFLQLNSVTTEDTATYYCARYDYYGNTGDYWGQGTSVTVSSAKTTPPSVYPLAPGTAALKSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTIBODY 7A1 FAB'
publication title Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
pubmed doi rcsb
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajuH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajuH01
4BZYA 3VXNB 3U2SA 5JORB 4R26L 3JWDC 5HYFA 3ULUD 2EDQA 4LF3B 3T09A 2FX7L 4M7JL 15C8H 4IEFB 4JZOA 1MIMH 4LCCA 4HKZA 1J05A 1DUYB 3EYFA 4KKNA 1LILA 3TN0D 2XWTA 4GRLC 1FL3A 1A7OH 3P4NB 1OAUL 2QKIB 5C0BD 2H45A 4L4JA 1DDHB 4WI6A 5SX4I 3HPJB 5B39G 4LEOA 1JPGB 3V2AR 4I0PC 4OLXH 1QBLL 1C5DA 3OXSB 3LH2L 5F1KC 5CP3H 5JXEA 1TJIH 4LNRA 4TVPD 1OTUD 3DOSA 4GMSL 3LS5H 3PJSB 2D7MA 4JFXA 3HC3L 3BT2L 1QA9A 3BDYL 3K74B 2DM7A 1ZLWH 2PYEE 3U83A 3QEUB 1NGZB 1J5OH 4ONFL 5C70A 4XRCB 1WF5A 4LEXH 4TULH 1DQJA 1QFWM 3G6JA 5I73B 3BESR 2R0WL 3D48R 4G8GB 3LKOA 3ZE2E 3RWGB 2BXZA 4P2QA 1HXMA 5I17A 3DMMD 1R24A 3B2UC 5I1EL 1QRNB 3NCFB 1TQCC 2G5BB 3CLEL 5J6GA 4HBCH 3LQZB 3O45B 2E27H 2R1YA 2H41A 1TCRB 1JZ6A 1LEGB 1G6RH 3KDMA 5GXBB 4DUVA 3D5OF 3DI2B 4PRPA 2ZJSL 1BZ7B 3PHQB 5IVXA 2XFXA 4JM4L 5EUOB 1U8MA 4KJYA 3KNBB 2R4SH 3TCXA 5JXED 3MV8B 5H35A 2D2OA 3BP6A 3W5MA 3BDXA 4NBXB 4W4NA 2BRQA 3X11B 2W0FB 2VDQL 4LLMB 3MJ7A 4LSQH 5BOZG 4Y5YB 1OY3B 2V7HA 4XCFL 4HUVA 3RUGA 2A1WH 3FFCB 3NPZB 3QDGE 5IB1B 3N1MC 4FNLL 5F89A 4HG4K 3QUZC 5D7IB 4P2QD 4DUXA 4Y1AB 4NRXA 1MCCA 2HMIC 3VA2C 3MYJB 2V9RA 4NJ9L 4KTEH 1MJUH 2VDKL 1CFNA 3C8KB 4S1DC 5DXWA 4ETYA 4CMHB 1J9CT 1WIPA 3GSXA 3WFHA 1SJHA 2VQ1A 3SQBA 5FOJA 1RJLB 6FABH 4LVHB 5F21B 2VR9A 4WJ5B 4YC2C 4KZDH 2VZVA 4HUUB 4QRQA 5EZLB 4FQJH 2VXSL 4GQ9L 4HGWA 5GPRA 1MCOH 2ZP0T 4CUCA 2YKLH 4B41A 3D6GA 5SWZA 3MYZA 4XC1L 5KJRL 4AK1A 2Q20A 4MD0B 4HZLB 2CJUH 5J1SC 2D7QA 2HJKB 2AGJH 1RUMH 4LRIC 1MCQA 5GS1A 2BMKA 3IKCA 2FB4L 2I60H 2EYSA 2CDEB 5EBLA 4OCYH 5DK3A 4ZUSA 4Y88A 3RGHA 1U8OA 2QR0B 3P30L 5ITFA 3H9SE 3MCLH 1T2QL 5TF0A 2NY4D 1IKFH 3U6RB 2YD1A 2RHEA 4KHTH 3NGBC 3WO4B 3QR2A 4BH8B 1D9KA 4UNUA 3H42H 4UDTA 4O4YL 1JNNH 1SJXA 5ERWB 5DDHB 5IG7A 1K5NA 5EC2A 1Q9KA 3EDEA 1GC1C 1SEBA 4U6HA 4DVRH 2B2XL 1ZSDA 3BKYL 4NN5C 2R0LL 4KV5F 1KCLA 1CDYA 1S9YB 4HMDA 4NN7C 2HVKB 2LE9A 4WHYH 1D5XB 2XWBA 4ZS7L 1CTNA 2R1WA 4P23D 5DWUL 3SKNB 5JTWA 4LSRL 4N5EC 3S37H 2WWKT 3JV4B 3TNNA 2J8UB 3MRMA 5AD0B 1RD6A 3C5JB 4JRXA 2BCKB 2V2XB 5D7KE 3VRLE 4YBQD 3FB5B 2EKJA 5D7JB 3VMOA 4XTRD 3R8BB 3TZVC 4N1HB 4OLYH 3FT2A 4F2MA 3MJ6A 5HDQL 4LSPH 3CFCL 5FAAA 1IEBA 5DMIH 1D9KD 1IAOA 1M7IA 3RY6C 4GRLB 4Y5XA 2ADJB 2G9HA 1IM9D 3ARYA 3MLWL 5F9JA 1L9MA 5IHZB 3BPNC 4FN0A 4PS4L 5DJ8A 4TRPH 2C26A 5BZWA 3O6LL 3IJSB 3QUYA 2BSTA 3RNQA 4I0PB 2ICWI 1B3JA 4PRDB 3WS3A 3M1BB 5KSVA 2HJLA 4N0FB 3E6FB 3RPKA 4Y7MA 3QEQE 1CGUA 5CHNA 4AIOA 4JRXD 1K4CA 5TDNB 5EU3B 3HMXH 1Q1JL 5E8NB 3OR7A 4K71C 3WL9A 4OD3H 4GXVL 4DKDC 4NKDB 3GM0A 1OTSD 1NFIB 1D5IH 4YXKH 4J4PA 2PYEB 4X6CF 5IMLB 3M17A 4W6XB 1TQCB 3QPXL 4X5WB 4QY8A 4F7MB 4JAMA 2EIEA 1T0PB 3HE7A 3V5KA 3GKZA 1U3HA 4YDVB 4MAUH 4XH2B 3WUWA 1P5UA 1A3RL 1JTPA 5D7SL 3G5ZB 1NCBH 3MFGB 1IKNC 1P4BL 3RBSA 3NCJL 2OJEB 1G0YR 3EO1A 2AJSH 4MSWA 4TNWF 4BSWA 1KLGB 3FQXA 4M48H 1CDBA 4ZSOA 3ZE1F 4QRTB 4R26H 5HVHC 5C0GA 4OZIA 1T2XA 1U58B 2F5AH 2OI9C 4M7JH 4F7TA 5HYJA 3RKDD 4RAVA 4DAGL 1CLZH 1E4WL 4JFFA 3RU8L 3QNZB 3VFMB 4IS6B 4Z7QF 4ZUTA 5ELIA 2EZ0D 4CW1B 2IANE 3GZKA 2QJDA 1B2WL 3QUZB 1FVDB 1A3LL 1OAUH 5EUKA 3BFOA 5F6IB 1QFPA 3QDGB 4XMKH 1IEAB 4HCRL 1FNGA 4A6YH 1T1WB 1A7NL 3VFGL 1QBLH 3PWLA 3IDYC 2HTKD 3CFEB 4JQIH 1HHJA 2IBZX 2I9TA 3HE7D 1FFNA 1T1ZB 3OPZL 3FTGA 2VIRB 1UM6H 1B4JH 1TJGL 4QTHB 4NT6B 4YPJA 4W81A 1JMZA 3TBVB 4TOYH 4DTGH 3HC3H 1U8KA 3BT2H 4UU9B 3BDYH 4G9DA 3WN5A 4KKCD 2QBWA 4YC2B 1BVLB 1AQDA 4YHIA 1NDGA 5IHUH 4OZFH 4ONFH 3JWDL 1EJOL 2W60B 4JPVH 2VXTH 2VLLA 2RCSL 5GIRB 2R0WH 3GKWL 3B4NA 4PPTA 5HYJD 1UXSB 3ES6B 1A3QA 4NO5A 5DJYA 5I1EH 2H8PB 2NW3B 2QTEA 1A1OA 1V7NH 3VGGA 1ZLUH 3L7FA 2ZSVA 3WFEL 5F6HI 4L8BA 3MV11 3QHZL 1KNOA 2EYTA 4L4VA 3V5DB 1T66D 1I7TB 1MAML 2H32A 3ULUE 4KJQD 2Q7YA 4J6RL 1BEYL 5KVGH 1WWCA 1EAJA 4JM4H 4LOUD 4LP5A 1F11A 4BFBD 1SVZA 2Z31C 2C3VA 3ZYOA 3D1MC 3FHQA 3GEWB 3P9WB 1AQKL 3B6SA 5C0BE 1RZIA 1CQYA 1YMMD 3ZDXF 3NGBB 1T5WA 4XHJD 5FYJE 1LP9A 4XCFH 5IEKB 5DMGD 3H9SB 1DEEA 4KKBD 3A6BL 1SYSA 3C2SA 4OAWB 2GHWB 1UB5B 2F58H 1YA5A 2BNRD 4OFYD 4TVPE 1MF2H 2NY0C 4F8QA 4Q2ZB 5IBLC 3T0EA 1FFPA 3VFVB 4WUKL 3UTQA 3BH9A 3F62A 4NN7B 1DEDA 5E70A 3OSKA 3EUUA 5A2KH 3QJHA 5IB3A 3JUZA 4OCMC 1WAAA 2F5BH 4NJ9H 1NAMB 5DRXA 4LIQE 5ID0A 4GBXA 4OUUB 4IRJA 2K3TA 3KR3H 3QIUD 4GW4B 2VZ3A 4Q7DA 3FO1B 1JF1A 3W11D 2WSKA 3TZVB 4NHUB 1C1EL 4FZ8L 4GQ9H 2CDGB 4UILL 5EZIL 4JG0L 3VXOA 2XYCA 3QXAB 3REVA 3DMMC 4N9GA 3BI9X 4Y4KB 1XGTB 5KJRH 4CGTA 3DUHA 4HKJA 3V4VH 1K8DB 4KTDL 1T6VN 2EDXA 3CIQA 4PTTB 5CEXB 3BPNB 4F9PC 1AI1H 3WJJC 3IDXH 4XBEH 4XCNB 1KTDB 5FDWA 1TVBA 3ZZ1A 1OPGL 2PF6A 5SV4A 3HA0A 2FJHA 4NDMA 1DFBH 1F4WL 2MCPL 1R5VB 3GMRB 3V6ZB 3OXRB 1T2QH 2W9EH 4HT1L 1WUNT 4IRJD 3RZWA 4HG4J 3RY5A 1B0RB 3KPOA 1BJMA 4OZFG 2XWJA 1VDGA 4M61B 1EAPA 5DUML 4IMLA 4XBGA 3S88L 1EVUA 3PQYD 3HAEA 2BC4B 5EZOL 5DVKA 3QEQB 1XIWD 1N0LA 3V6OA 2EIBA 3QCTH 4BKLA 5E4IA 1S78C 2B2XH 4OSUL 1MFNA 3O0RL 2R0LH 5F9OH 4JFYB 1AO7D 3THML 4AIZA 1HH6A 4U6XB 4ZOEA 4ZUVA 3QUXC 1YUHA 1I4FB 4OUOA 1N26A 4Y8DC 2P1YA 2IH3A 3GSOB 2Q7NA 2QQKL 1VGKB 3C5SB 4ODHL 3CMGA 4YHKL 1UA6L 3PWJB 4BJLA 4WWKD 5MERA 1Z9MA 4FFVC 5CZXD 4P2CG 3T2NL 1A22B 5HVHB 3WKML 2ZG1A 1BZ9B 2OI9B 2NLJB 4EI6A 4XVUD 5HDQH 4EN3B 3RDTD 3LSOB 4KAQL 4OIIH 5DC9B 5EIQA 3T77B 3VJ6A 1H5BC 5L2KA 2R4RH 1KUMA 1U95B 4PS4H 4G8FB 1OM3L 3VGFA 3SKOA 3DVGA 3NN8B 1ZHBB 3MOBL 2QSCL 3QIWD 3DV6A 3HN3A 4M6NL 2Y36L 4X6CE 1IC4H 3SE9H 3FO0L 3DBXA 1MH5A 1WQVT 4MQSB 4JHAH 4DZ8A 3IDYB 4QT5B 2NXZD 4K8RC 4KUZH 4IOIB 5E5UB 1M71B 5IBTL 4LMQE 1NCTA 3MLTB 2C1OB 2RJMA 4JDZA 2BJML 2OMNA 1Q0XH 5GZOC 4PJIF 3MUZ1 4V1DD 2GTZB 1FH5H 1Q1JH 1NANI 1NCNA 5HHXL 4R2GC 3T1FB 2AERT 5EC1A 4W4OC 2DQHL 1KB5L 1A6TA 3GMPB 2Y72A 3EJZC 1A21A 4IRZL 3ZE1E 3N9GH 4IDJH 4UQ2B 3AC0A 3OKNA 5I9QC 2AJVL 1GXEA 4OKVB 1CD0A 3KPPB 5FK9A 4M6AA 2YBRA 3QPXH 5F7FA 3I3EA 2DS4A 3V79C 4RSVA 3MUGA 1FVCB 1VADA 1Q72L 1WT5A 2UWEA 4JFZL 3ZSSA 1UKQA 4R90H 2NZ9C 3IDGB 4TSAL 5EU5B 2DQEL 2QADD 2W65B 1HH9B 3UP1A 4JHWH 4WUUA 3EYQD 4Z78A 5HGDB 5EOQH 5BXFA 4O02H 5BOPA 1KG0B 5BJTA 4GS7C 3FQRB 3AMKA 5DEFA 4HJJH 4JKMA 5GSVA 1E4WH 3RU8H 3VFOA 1MFEL 5T3XH 5ICXA 1FNHA 3ZTNH 3FMGH 3LKQB 5HHPB 1UYWH 1HNGA 1OGAD 2OTWB 3H9ZA 3L3GA 3P4MB 4G6JL 1A1NB 4NOFA 1XAUA 4PB9L 1FSKC 2NY0B 3QI9A 5C7XH 5IJKA 4QXGL 1XCTA 1F13A 3QJFA 5I16A 4WTZG 2OK0H 2F53D 3HR5A 1P2CA 4HCRH 2B1HL 1V3MA 1L9NA 3UZVB 1W8OA 1ADQL 4XB7A 4RQQA 5DJCA 2OXHA 4K3EH 2AXFA 5CUSH 5D1XD 4LBEB 1CFSA 3H9HA 3LVEA 2P8MB 1P7QA 1MOEA 1Q8MA 4MNGB 2HKHH 3MZGB 5I74C 3TIDB 4D9LL 5MEOA 4CVWA 5FHAL 4Q9QH 1DBAH 1ZAGA 3HE6C 3QUMA 2OBGA 3BQUC 2JJWA 4HW6A 5DFVC 3JWDH 1OTSC 2IG2L 5DJ0A 3TT3H 4HC1H 4D94A 1MCNA 3PWVB 2KQMA 2JJSA 1XMWA 1Z3GL 3GKWH 3DMMB 2EE9A 4XNXL 1QHPA 2YD3A 1I75A 5AZEL 3I75B 5IW3A 3ZDXE 2IEPA 2P5ED 4JZNB 5IHLB 5FHBL 3ULVL 1ZE3C 4TSCL 2MQ3A 3Q5OA 4X6FA 2O5ZH 4M5YL 4MXWH 5JUEH 1PSKL 2OYPA 1DQTA 3QHZH 1K4DB 4YHML 1F42A 4J6RH 1BEYH 1MSPA 2E6PA 3MLUH 4HV8A 4LCWD 3VE0B 1X5KA 3FO9B 2OL3B 3FRPA 3KYKL 4MYWB 2GK2A 2BVUA 2NY2D 3D3VD 4C83A 3SKUD 1U8IB 1NC2A 5E2WL 4HHAA 4P46A 3RKDC 3BO8B 2ZUQC 3ILPB 1IE5A 3RPIB 4GW1B 4KQ3L 4HFWB 2FO4A 5CZVH 3WLBA 5I8EA 3VWJC 2GTWA 5K9KA 2E8YA 3RVWD 4GXUN 1U8NB 2Q87A 3UCRA 3QG6A 4ODBD 4HWBL 1RIVL 3CPLA 2J4WH 4HJ0D 4Z7UF 1E27B 2HTKC 1P1ZA 4GSDL 2J6EA 2Z92A 1MPAH 1TTUA 2VZSA 3KXFB 1MREL 3I84A 4I5BA 4Q6IA 3W9DA 4GG6A 2ZZUT 3KPQA 4IOFD 1AGCA 1FE8L 3VU2A 4D0DA 5C0JA 3C09B 3K4DA 1U6AL 2XXCB 3ROOB 3OKKA 3HS0A 2ZOLA 2YPKA 4U1JB 4RRPA 3WNLA 3T0WA 2EC9T 5ECJE 1MHCA 1JGLH 2GSGB 2PR4L 5EZIH 5C0ND 2WAHA 5FOBB 2GY5A 4IIQC 2EH7H 4XPAL 4Y4HA 4P57B 5FO9A 3VG9C 1NGXB 4L8CB 1SMOA 1QR1B 5T1MB 4KTDH 5DI8A 1J12A 2P5WE 4FQQB 1FRGH 5FO8A 1FLTX 2N1KA 4UNTA 3VFWB 4FG6C 1O7VA 4FABL 3T0VA 3IFOA 4PJ7F 3TO2A 3G5YB 2EIZB 4CL7A 2VABA 1AGFB 1YMME 3S96A 4CVXA 4Y2DD 5L88L 4JANA 1KCKA 4ZFOB 2CKBB 2NY4B 3TPUA 3UBXI 4LDEB 2MCPH 1I8LA 4TUKH 4HT1H 2BNRE 4X6CB 25C8L 4XHJC 4UDUB 1UACL 2E7BA 4UBDD 1JL8A 4Y16A 5DA0B 3TEUA 5ICYB 4XXCC 4R2GB 5DF0A 5IJVA 2XQYK 1ONQB 3AS1A 2MCG1 4F7PA 1E6JH 3HI6L 5DURB 2ZG3A 5KG9A 1HE7A 2BY0A 2CK2A 3GBLA 1QO3A 1FNFA 5I9QB 1PY4A 3IU4L 3THMH 4YE4H 3KPNB 3TBWB 4QXTB 3O9WA 1FAIH 4RBPH 5FO7B 4JB9L 4MD4B 4P2YA 1BIIA 3EOYG 5KVMC 4OZGA 4ODHH 5DC0A 1F6FB 1UA6H 4UQ3B 5E8EA 4D8PB 1NGYA 1GZPA 3W11C 4P5KA 1NANH 5HYQA 3T2NH 1CFQB 3S5LB 1XGUB 4GS7B 3VRJB 3AFLA 3CZJA 4G8IA 4I2XE 3W9EA 2GW5A 1CGVA 2DYPB 4NIKB 1RZ8A 4MVBC 5E9DE 4PTUB 1F6AB 3AS3A 4KAQH 5A2IH 4D9QD 4OQTH 4TN9A 4PJIE 4YHYB 1OSZB 2UZIH 1IM9B 4L8DB 1GC1H 5HGBB 3JV5A 1XGQA 3C60C 1FSKB 3K81A 5C0FB 2YPLA 4HPYH 1OM3H 4PJCE 5D71L 2PNDA 2D31B 3KVQA 2IPTL 4YWGH 4M6NH 1CCZA 1WCBA 4YR6B 1QP1A 1P7KB 3FO0H 1U93A 2YWYA 1QSEA 2R29L 4N1EA 3PQYE 4UTAL 1NAMH 2AEPH 1N8ZB 2VITA 3FHAA 3DECA 1U8LB 5CEZL 2VLJB 2X4RA 3ILQD 5HHOA 5I74B 4RGOH 4XB8A 1KCRL 4FFWD 4KK9D 3MQIA 2VDNL 1ZT4B 4KROC 3BQUB 3LN4A 1AO7E 5IF0A 4XGZA 3GBML 1YY8B 1BVKB 3GNML 5EOTB 4CBPA 1LO5A 3VD7A 4KGLA 3CVIL 2QEJA 4IRZH 4KGJA 3BEWA 3OKDA 1FGVL 2L4OA 1NBZB 5CINH 4HAGA 1DQQA 5I1DA 1OHQA 2R0KL 2KL6A 3PV6B 5I1IH 5E2UH 5D1ZD 2AJVH 1CG9A 4OCWL 1AFVL 5C08D 5E1AA 4NQUA 4OT1L 1FZMA 4MQ7B 4PJDF 3L3OB 1CZ8L 1KELL 1RHHA 3U46A 4OLVL 1P7HL 1HI6A 1UJTA 3G6DL 1N7ML 4EUPA 1YEJL 3AM8C 2AXGA 1WITA 5KTEL 1NUGA 3TWCL 1DBJH 3RTQA 3O4LE 5DHVB 1QSED 3BXNA 1H3GA 5CZKA 3E8UH 1EDQA 2Z0BA 4U4BA 4PRBB 4ZTPL 2ENSA 4Z7VF 5TGBA 5DMYA 3S9DB 4XVUC 2W9DL 3OKOB 2ZUQB 1I1YA 2QQQA 5IMOB 4JFOB 4PGDB 1MFEH 2FX9L 3VDAA 5JOEA 3DVIA 3BUTA 1S9VB 3VWJB 3T0BA 3MODL 1JCKA 2BSRB 4K7FA 2VXQL 2IQAA 4G6JH 2Z35A 1BOYA 2DBJA 1IBGL 3X3GH 5C0CB 3MNWA 3QIWC 2BFVL 4PRHA 1PEZA 3UPCA 1FCCA 4V1DE 3ARDD 2VZTA 5GRJL 5KS9A 3BW9B 2EEAA 1HKLL 4PRID 3GMOA 4KJPC 4KK5D 1HHIB 1IFHL 3RTQD 2FWOA 2ATPB 1NUNB 2VQUA 4D9LH 2VZOA 1EMTH 1VFAB 3RVTD 1KIQA 4UTBH 2IG2H 3LEVH 1QFHA 3O6FA 4JKPH 3I6GB 3KYOB 1QLRB 4FXGB 4XWGH 4XNXH 3AXLA 4WI3A 2D0GA 2DWDA 4IIQB 3VG9B 5GQBA 1EO5A 5HY9B 4QHKI 2AJ3B 5FM4A 4HUXA 5FHBH 1HINL 1EHAA 4EKXA 4R8WL 1CL7H 2DL2A 2ED7A 4WHTB 3D9AH 1T1XA 4M5YH 3HUJF 3L5XH 3RIAF 1PSKH 4UZGA 3DX9B 1XZ0B 3V6FA 3FCTA 1B90A 4YHMH 2V9TA 4G42B 3BKJL 3LMJL 1HCFX 5GGTA 5H94B 2RB8A 3R8QA 4F9LC 2WP3T 4JPKL 3CZFB 2PO6D 5ISZB 2P5WB 3EYQC 2ZOKB 2DB8A 2GAZB 5T3ZD 2OSLA 5DD3L 1VENA 4Z7UE 5K9OB 2LVCA 2EDFA 3QQ3A 1OGAE 4HIJA 5DR5L 1EEZA 5A1AA 1G7QB 1YMMB 5F9DC 2MWCA 3P0YL 4HJGA 3B8YA 2FLRT 3VFNB 2GJ6E 2YD9A 3IU3A 3ARRA 2LABA 2F53E 4GG8A 4QRPD 1A02N 1Q0YH 4KQ3H 2AKRB 4PJFE 3VXQA 1CU4H 3DJ9A 4FQ1L 3L5WB 5BS0D 3U9UA 2BNRB 1GGBL 1OD9A 1KFAL 2JJUA 5ICZA 2P7TB 4X98A 3LHPL 2X4QB 3CFBB 3B3IB 3U0TA 3WFCH 4HWBH 3P2TA 2H9GB 3GSQA 3NCCB 2BX5A 1EPFA 1C5CL 5LGJA 2JIXA 5IFJB 2H3NA 1TZIB 4U3HA 5D1XC 4R3SB 2ZKHL 5HD8D 5J11C 4P4KA 2FX8L 2VQTA 1MREH 4H0HB 3QIUB 3RWJB 1UZ8A 2J1KA 4LFHD 1BQUA 1JN6B 1FE8H 4PJ7E 1ZA3B 4WW1A 3KLSA 5F44A 2P5EE 3OGCA 1A6PA 3MRBA 4I77L 4LCYA 5F9AC 4PJ8C 1CS6A 3O3BA 1Q9WA 3TBSA 2FGWL 3PGCA 3MRLB 3L5HA 4LCWE 4G6FD 4B5EA 4ORGB 3BGMA 1RZFH 5F7HA 1BFOA 3C60B 4I2XB 4P2RA 5FYJH 3D3VE 5E9DB 4FABH 3LD8C 4C55A 2E3VA 4PJIB 1QQDA 4YFLF 4WGVB 1PW3A 4PGZA 4P4KD 4XVJL 2EO1A 4K7PX 3MR9A 4XNZC 4GW5B 5DO2C 1U9KA 3BEVA 1UACH 2PW2B 3LS4L 1OAYL 3PQYB 4KROB 1QHOA 3BZDA 1FC1A 4RMTA 4PJ9D 3OV6A 1OP9A 2ITDA 1S7VA 5F1SA 1XIWB 1RK0A 5DK2A 4X4ZA 2IGFL 3ZKQD 2X89A 1KIUA 5B3NA 2EO9A 1A2YB 3NIDF 3VWKA 1FJ1B 4YHNB 4JRYA 3SGEI 2P44B 3MJ9L 2AJZB 1J87A 5D5MA 3IXAB 4POYA 1AO7B 2YEZB 4MB4A 4RDQF 2DMCA 1D6EB 4ZAKA 4P2RD 1YEKH 2XKSA 4I48B 1JPST 2R1XB 3L3HA 4M4PA 4GAYA 1M7DA 3GSNL 1ZS8B 4KJWD 1YEDA 2YD6A 2N7AA 4X6EB 5E8OA 3KYNA 2RBLA 3VXTA 5IK3A 2OTUA 2OL3H 4HS6B 4NYLB 3BP7B 2ZPKL 2AJUL 4E5XB 3QZWG 4G43B 4LVNC 3O4LB 3WIHA 4P5TA 3MRHB 2XXMB 4URTB 1GRWA 4N8VG 3REWA 2R39A 2B4CC 1EHLL 3ARED 3VWKD 5AWNH 3NMEA 3VFTB 3CFJB 1CBVL 3QIWB 5D71H 2EC8A 2L7UA 3IDIB 3EGSB 2IPTH 3BZ4B 1NAKH 4ZAKD 1RI8A 3DX8A 3B2VH 1MCSA 4ORZC 3UBXG 3X14A 3MRDA 4PJDE 1J1PL 1JHKH 3EOTH 4UBDC 4X6BB 3MPCA 4V1DB 4OI8A 1RQ5A 3LPFA 4ZO9A 5EBWA 3WXVL 1HQ4B 1KCRH 5FCUL 4NWTL 2VDNH 1T03L 4OGXH 4W6WB 4J8RB 3CVIH 1HHKB 3GBNL 1ZOXA 1CR9H 4P5TD 1VCAA 3O2DA 3HMWL 5FB8B 3WS6C 1H15A 2PETA 4J12A 4NQSA 4Y2OA 1AFVH 4OT1H 4Q9RL 2GT9A 1CZ8H 1KELH 3HNSH 5DJXA 2X4SB 4ISVB 1BFSA 3STZB 4BZ1H 2QADB 4K07A 3BHBB 2M2DA 3O8XD 4D9QE 5JPNA 4K8RH 2X41A 3JWNC 4MJIA 2IPKA 2CKBH 2RAMA 2ARWA 3PIQA 5E03A 5LG1A 1SYVB 4JPIB 4S2SB 4C4KT 4Z77A 4X99B 3SY0A 2CLRB 4ALAL 4U7SA 1O5DT 1PQZB 5ESQA 1MHPH 3HZVB 4LASL 1K9TA 1A4KB 3VXUA 5IOPA 4Z7UB 5C6WH 5LGHH 2APWA 1OGAB 3F7PC 1RZGB 4HS8H 4M7ZC 1C08B 1IGIL 2YS4A 2VXQH 1JBJA 4UOJA 4OB5L 5FYKL 2GJ6B 1IBGH 2YXMA 3KPLB 5F8QC 5GGRA 2F53B 3RWFB 3V95A 2HRPH 3HG1E 3VXSD 4LLVA 2ATKA 3BZFB 4RZCA 1NMBL 5D1XB 1X4XA 2Q3ZA 1CVSC 4RIRA 4NUJB 1HKLH 1FV1B 2JKXA 2YMXL 2OR9H 1MJ8L 2YUWA 5GGQL 3BKCL 4PGBB 3ZT6A 2PYFB 4NRZB 3V7MA 3HCVB 12E8L 2A74B 3E2HC 1MCDA 5SX5H 4MJID 2Y5TA 2P45B 5HVGB 1MI5D 1AGBB 3BH8A 5C08E 2R69H 4PJ8B 5DRWA 3NCBB 4PJ7B 5TH2A 2I07A 1N64L 2GCYA 3MLXH 3R4DA 3CUPB 3KS0H 4BUHA 4Z9KB 5SV3A 5TDOB 3BVNA 3RUGF 5TE6L 5IKCB 3SDXA 1VEMA 4R8WH 4X80L 3D0VA 5F1NA 3WLWD 3KPRD 2X4PA 1QUNA 3PNWA 1EH9A 4BH7B 3HZKB 3LD8B 4ONHB 1S9WB 4LCWB 4DGVH 4UT7L 4NZRL 3BKJH 3LMJH 3MNVB 3GJEA 4PJBF 3ABZA 4FQ2L 5C9JB 1QACA 3C2AL 3OAZH 4LPXA 5EA0L 3D3VB 3EDJA 2A77H 2Y07L 3RNKB 1J1OL 2PUQT 2VB5A 4OIAA 4XNZB 1U8JB 4KVNL 5J1AB 3LN5B 1ACZA 4AY0A 4QOKA 4PP2A 4HQQL 4LHUG 2NXYD 3IB4A 4UOW1 3IAQA 1KFAH 1CK0H 2D03L 4PRIE 5GJSL 1REIA 4O2EB 1XR9B 1JJUA 1JPSL 3DROA 3LHPH 4PJAE 4XBPA 3ARDC 3WNKA 1L7TL 1OT1A 1KXVC 3U48A 4RGND 1C5CH 3TCLB 3EOBA 3GSUA 4NOBA 2ZKHH 3O2VH 1KTLB 3RWHB 4U1NB 3SCMC 4ZPTB 3RVTC 5DHVH 1H3UA 3CK0H 4LSVH 4RA0C 4Z7WF 3C5ZC 2PCPA 4YBLC 1QLFA 1EBAA 5J6HB 1EUTA 5EG6C 3TNMB 1B0GB 2HFGH 4D3CL 4G80B 4P48A 1ORSB 1WBXB 3OHXA 1PKOA 4JGUA 2NY3C 3SGEH 4K7PH 5KSAA 4F37K 3VDBA 1QBML 5C92A 4GUPB 3FT4A 4BSVA 4G8EA 4ELKA 5CJQH 4YGVA 4HMEA 3EZ8A 1MCKA 3NIDE 3MUJA 5J12C 3WEXA 2PO6C 1DBKH 5KN5A 1NSNH 5TQ0H 3I6LE 1EEYA 1WFNA 4QRPE 4DZBA 3O81A 1CWVA 1NH6A 3UYRH 5GS0L 1EBPA 4XVJH 1FP5A 5BS0E 3H7BB 5J9PB 4OBSA 5B4MD 3EYVA 3MRCA 1W72L 3LS4H 1OAYH 5C3TA 2JJVA 1LE5B 2DQFA 5HGAA 3KWWB 3FB7A 3HNTH 5TDPA 4PJDB 1AJ7L 3INUL 5GS2D 5BW7A 3NFSH 2ZSWA 2YA1A 1FLRH 3NZ8B 1I8KA 1F58H 3QFDA 4LCUB 4ZPVA 3KPMB 3FRUA 1X7QB 3B9KC 1HXYB 3C08H 5GRUL 4NQEE 4O00A 3IAGC 2PTVA 2Q86A 5IMKA 5MHSD 1UWGH 2JK5B 4KVCL 5C09A 2VAAB 4JFPA 4F58L 2YSSB 3MJ8B 4LPWA 1BPVA 2AQ2A 2Q3AA 3KJ4B 1IAIH 1WEJL 3OJVC 3OAYK 3HTLX 2ZPKH 3U7WH 3C8DA 5FGSA 3FQWB 5GGUA 4D0BB 4KFZC 3LPGA 2HT2C 4Y4FC 2FCBA 3DARA 4NQXB 1U3YA 1MWAB 4OCXL 3PWUA 5MEND 1A9BA 4OV5B 1N2RA 2RQ8A 4M7ZB 1NC4D 2FR4B 3TO4C 3ULSA 1S7TB 4PJXF 3HNVL 3ZKMD 3VH8A 5HTSA 1XF4B 1CBVH 2DDQL 2IJ0C 1AGEB 4QEGA 4MA8L 4ODSL 2APBA 1PG7W 1KXQE 1DE4B 3TM6A 3E6HA 1V05A 4C57C 2X9WA 5IVZA 4PGCA 1AP2A 3HG1B 1NKRA 4RWYL 3WXVH 1HILA 3E2HB 2P24B 1F2XK 5FCUH 3NA9L 5BO1L 3EBAA 3RL1B 1T03H 1NLBL 3FOLA 2NW2A 3FFDB 3I3BA 4NQVB 2E6JA 3SKJL 2ESVA 5I71C 1AC0A 4YLQT 3OJ2C 5D1ZB 4DGIH 5LJYH 5IQ9A 5GGVH 4LSDA 3HRZA 2LV4A 1EGJH 4HBQA 4LARL 4OM1L 5C08B 4ZYKB 1CI5A 5C0EB 4ELMA 4Q9RH 1RZKC 3BISA 1KPVB 4U1KA 2JJTA 2ADGA 5FA3A 4L1DA 5EB9A 2A9ML 3OR6A 3RI5F 3MBED 5EWIL 1R5IB 2DQUL 2F19H 4U1HA 1IGTB 3ELAT 3RL2B 4ALAH 2IADA 4FMFA 4LASH 2JB6B 5HYSA 3MREA 2Z8SA 4JHZA 3QNXA 3G5XB 2ESVD 1IGIH 4JRWA 3BD3A 1T0NA 2AV7A 2APXA 3L6FB 5FYKH 2AS5M 1RZ7H 3JV0A 1BGXH 5AEAA 3ARDB 3W5NA 1I9RL 3OKMB 2LQRA 4KMTL 1BWWA 3BUYB 3EFFA 1CLYH 3QDJA 3P11H 2V2TB 1YJDL 4PJAB 3S4SA 1LNUA 3SCMB 4X9GA 4NQCE 1G7HB 4ODWA 2H6PA 4GO6B 4V2BA 5E00A 5CP3A 2XPGA 4YBLB 4PJBE 4BQ6A 4DW2H 2I26N 2ITCA 3L95A 1JNHB 1I8MA 2DLGA 4IMKA 5JHDA 3H7LA 1N64H 4APQD 3KPSA 3T3MF 1LP9F 2VLME 3PABB 2VXUL 4AH2A 1LK2A 1WICA 1LMKA 4PV9B 1F3JA 4EQ3A 1OWWA 4MNHA 1TVHB 2IAMD 4X80H 4KI5F 3NCMA 2VMFA 3MV9A 2Z91B 3FJTA 1K8IA 3FQTB 4I18A 3QISA 2BVPB 5J12B 4I1NB 4M5ZH 2PO6B 3DETC 3SKMA 2PTTB 4FQ2H 4C56D 2DQTL 3LRSB 4X9BA 1T1YB 2VKWA 3SE3A 1ZHLA 1G6RA 1W0WA 5D2NA 2LU3A 4Q6YA 1G7PB 1J1OH 5TE7H 1UXWB 1RULL 3FN0L 4NFCA 1K3IA 1I3UA 5EBMB 4FQXA 4QRPB 4WFED 3L3DA 3EDKA 4QGTA 3QQ4B 3TFKD 1JGVL 4RFOH 4M7KH 1KLUA 4HQQH 5BS0B 1BP3B 3VXSE 5L8KB 4Z7WE 1YEIH 2AK4B 4UV7L 1UM5L 1S9XA 1I7ZA 4CVZA 5FA4B 1R3HB 5F1IA 3PHOA 5CEYB 3QO1A 2FGZA 2GSIB 1S5HB 2NTSP 3FN9A 3AAZA 4WO4D 4PYGA 4PJEA 2XQBL 4R96A 4QRSB 5T5FH 3TYFB 4NKIH 5DVOA 2P49B 3MGAA 5C07D 3X3FL 1AD0B 3MRKB 3VRIA 4KKLD 3L3IA 1KIPB 1MI5E 4U1IB 1A7PL 3F7RA 4Y5VA 2X1XR 4HLJA 5KAQG 4XT1C 4NJAL 5E8DH 4EJ1C 3ZL4H 4N0RA 1T20B 4U6TA 2OMBA 4NQEB 4NSKB 4ZD3H 3KPRE 3GMNA 1FDLH 3MOQA 4M7LT 3EFDH 4LLUA 3G04B 1LHZA 3VXRA 3WCYA 1IGCL 4OBRA 3IJYA 4QWWC 3D85D 3IS1X 5FDYA 4D3CH 4ZXBA 3VGBA 1GZQB 4J3VA 4NQDD 4Y4FB 1LD9B 4PB0L 1Q94B 1MJ7L 1VB9A 1S7RB 4K3GA 4LLYB 5E7FA 1GPOL 1KJVB 1QBMH 1KJ2B 3X13A 3D39E 4XXDB 4I13B 1T3FB 4N0YH 4IBLT 1KACB 3QH3A 2FL5B 4AENA 1WIUA 4PJHF 5BVPH 4HZAA 3IDJB 4PJ5A 2GYSA 3MRJB 4ZFZA 5D7LA 4NNPH 1Z9OA 1DL7L 1MQKL 5FGBC 1ZHKA 4MAYD 2F8OA 1NCAH 4ONGL 4QXUL 4Z7OF 2F54A 1SY6H 1WWAX 5FEBA 2LAGB 2VLRE 3MCKB 4NZUL 3WHE1 4LPUA 1HSAA 1RURH 1G7IA 2NXYC 4W70A 3C9NA 1S3KL 4HWNA 5I71B 3NABH 2E9IA 3GMQB 5HHQB 4ZXBD 1C12A 3QUYC 5MP6L 3LEXA 1ZANL 4NNYA 1IQWH 5GISL 1CF8L 4P2OA 3QO0A 1OP5K 3VXMA 5EPMA 3DO7A 5GRUH 4OCSH 1LK3L 3S6CA 5LXGL 1FFOB 4PJXE 4AT6B 4TYUA 1QA9B 1IAKB 4WFFD 4F58H 4HULB 4IHOB 5D7LD 1AXSA 1KJ3L 1JF6A 5SWSD 1X44A 2HT3C 4K9EC 1HSBB 1WEJH 1H3VA 3N0PB 5DD0L 1KPUA 3LKOB 3NIGF 4J4PC 3IJHA 1X5FA 5I17B 4G5ZL 1EFXD 4WHDA 1FL6B 2WBJA 2Y25A 4M6OL 3SDYH 4OCXH 2HFEA 4YFLI 5CBAA 1I85A 3MRRB 5FECA 4OFPA 2H26A 2ARJA 2DDQH 2XFXB 4U6YA 1I9IL 1ZGLB 4E41A 5HPOA 1U8MB 3CFDB 3L3JA 5DUPL 2E7CA 5ENWB 3T65B 5I76B 4P2OD 4MA8H 4ODSH 2OZ4H 1FZKB 5ANME 3TYGL 4ZDHA 4Q9BA 3MO1B 1DVFA 2FBOJ 3IVKA 4HUVB 3RUGB 1IZJA 2UVEA 3WHXB 2OP4H 3MRFA 3NA9H 4EIZC 5BO1H 1D3CA 3LQAL 4J1UB 1A6VL 5DFWH 1BQHG 3GI8L 4NQCB 2O93L 3H2WA 4LPTA 1EO8H 3HMXA 5MHSE 5CSBA 3OZ9L 1LO3L 1EXUA 1WTGT 1FZJB 4PJBB 1ZLSL 5D1QD 2B4CH 4XAWH 5HI5D 2XZAL 1QEWA 1YECL 4OFVA 4BM7A 3EYSH 3GGWA 4NCC1 3UZEA 1KJ2L 2VRAA 4O51A 3TT1H 3EJJX 5DMKA 4UUJA 5E5MA 2BHUA 5IMMB 1ACYL 1ETZA 2AABH 1W0YT 3FOMA 3WFHB 1SJHB 4E41D 1JTTA 3MXVH 3P9MA 3O8XB 1KB9K 2NZIA 3G08A 1AKJD 1F45A 5LCVH 3Q5YA 4XCYA 1T83A 3QNYA 3QXDA 1GJIA 3IFPB 5EWIH 5MENE 2ZUSA 3LKPA 1WTLA 5EZJB 4PV8B 3VD4A 4OCRL 3QEGL 1AGDA 5DJ2B 3LKSA 1I7UA 3PV7A 5I8OL 3QXWA 3LKNB 1T5XB 5JNYB 3M8OH 1ZT7B 3B5HA 2EYSB 3K2UH 4MQXC 3VXSB 1NFDA 3TBTB 4Z7WB 5GRVK 4FZEH 3TIEA 1I9RH 3T3ME 1OAQL 5INCB 4XZUA 1U8OB 4XWOC 1MFAH 5I1AA 1A7QL 1RZKL 1JGDB 4E0RB 4S11A 1FIGL 3QWRD 1AY1L 4BQBA 3FAWA 5A16A 3SE4C 2R2HB 4A6YA 4JY5L 4M7LL 3PWPA 4WEBL 1JGUH 2YR3A 1MI5B 4NPYA 4O2CB 4AEEA 3KGRA 2A73A 1MELA 1Q9KB 1I3GL 1NEUA 4KI5C 5T1LD 3OJDA 4G7YL 3T0EC 3QXTA 3EHBD 4RGMB 1U92A 5B38A 3SQOH 2C4XA 3SDCA 2VXUH 3D2UD 2ZUVA 5D8JH 4ENEC 3KPRB 4IRSD 1JPTH 2VUOA 3MLRH 4DFHA 1XGPB 3OKEB 3FO2A 1L6XA 2X6MA 4PFEA 4GAFB 4C54A 3U7YL 2BNQA 3UTSA 4GKOA 2H2PD 2DQTH 5D2LA 1GOGA 3D39B 1O7SA 2V7NA 3GSWB 2FIKA 3GRWA 1RULH 4GG6F 4L9DA 4F15B 4UB0L 3CAFA 3ARBA 1JGVH 2NXYB 2CSPA 2G9HB 4HUKB 4F3FB 1CICD 1RK1B 4MZ3A 4WGWB 1RMFL 2O61B 4K3JL 1WBZB 1PGRB 2VLRB 1CDUA 4PJGA 3WKNA 4P9HC 3QUYB 2BSTB 3RNQB 2D7TL 2XQBH 4YHLH 2YUXA 1NJ9B 4TNVF 1RJYA 4WU5B 3X3FH 4JFED 1JHLL 1II4E 4GKZB 1M6OA 1LO2L 3QDHA 4N1CA 1GIGH 4NZTL 2Y6SC 1JGEB 5E08L 2NYYC 3WYRA 4O5LL 1FNEB 5IW1B 5E94A 4NJAH 3WXWH 2WIIB 4OGAC 5F7EH 4PJHE 1EV2E 1HOCB 1OARL 3CXDH 4PJXB 4NKMA 5EFIB 4LLQA 5DD6B 5JLZA 3ARZA 2X05A 4Z7OE 4MJ6A 1I1AC 5JW4N 4X7TB 1NCUA 1KLFA 3W81A 3VXNA 5JORA 5CD5C 5JO5B 4C56E 2IAMC 1MJ7H 2NTFB 4LF3A 4X4ME 3OMZA 4K3HA 3WUWB 3HFML 1DUYA 2DD8L 4L29A 3EO0B 2K9UA 1F3DJ 3N1PC 2LU4A 3P4NA 4WFEE 2QKIA 2YUZA 4WW2A 1KC5H 3ECBA 3JUYA 1DDHA 4KRPD 5C0GB 3HPJA 4ONGH 5SWQA 5I1GH 1JPGA 3HB3D 5J4MA 4JFFB 3RX7A 2F9BT 2P47B 2R9HD 5ANMB 1GHFL 1NBQA 2RFXB 3TJEL 5C07E 1MAKA 2IH1B 3PJSA 1BAFL 4Z0XB 1QVOB 1TJHL 2FJGB 1N6QH 1BZQK 3SBWA 4HUMB 5E95B 1RUQL 4WO4C 2DLIA 1NGZA 3QEUA 1RIUL 4XRCA 4ZFFB 5MP6H 1ZANH 4JKLA 1KGCD 4YX2L 4PGJA 1CF8H 3PWLB 2DJ4A 4G8GA 2I9TB 1S5IH 3RWGA 1B4RA 4QLRA 1KBGH 2ZCKL 1QRNA 4N0UE 1LK3H 2G5BA 5LXGH 3BSZL 3LQZA 1TCRA 4NQDE 1X5AA 1LEGA 4PUBH 4CNIB 4WIQA 2I9LB 1A6AA 5E6ID 1ZV5A 5HSFA 1BZ7A 3PHQA 5EUOA 2FECL 1KEGL 3V4PH 1JWUB 2ZG2A 3RGVD 3BZEB 3KNBA 3QT2A 5DJYB 3D0LB 2GITB 3IT8D 1EEQA 1JRHL 3L7FB 3DYPA 2ZSVB 1NC4B 3X11A 1NGPH 2W0FA 4Y8AA 4ZFGL 4YEEA 1F8TL 2AJYL 4LLMA 2WUBL 2UUDH 1MCBA 4GQPH 5KVFL 4Y5YA 1WT5C 2KPNA 3FFCA 1XF2B 4KXZI 1FORL 5IB1A 4J3TA 1NCDL 1I9IH 5IESH 2QHRH 4G8GD 3PXHA 4Y1AA 4UINH 2VDRL 1VEPA 1RZIB 3MYJA 2A0LC 1FG2B 5B39B 5EU6D 1KEML 1Y0LB 4GKNB 4K9EL 2I5YL 3C8KA 3GHEH 1KENL 2FECI 3GJFB 1TZHA 3QI9C 3GI8H 3ZKND 3R06B 1RJLA 3FKUS 3T0EB 1JRHI 1DBML 3DVNB 4WJ5A 3V8OA 3MV8D 4R6UA 2HFFB 3WDJA 4G9FA 4HUUA 4WFFE 5EZLA 2W91A 8FABB 3X17A 3DX7B 5SWSE 1KJ2H 4R7NB 3FFCD 1ACYH 4MDJB 4OLZL 5EO9B 1NGQH 4MD0A 4HZLA 1TCMA 5L7XH 4JN1L 1JHTB 4XAKD 5DA4A 4JFDD 4UT9L 4MB5A 2CDEA 4EZMA 3CSBA 4NO0B 3AU1B 4W68A 4N9GB 2X42A 5C0DB 1NFKA 2QR0A 5EN2B 3VCLB 3U6RA 2VDLL 1PKQE 5JR1H 4UOW0 3CLFL 4FS0A 2BOBB 4BH8A 3BP5B 4V2CB 3T2QA 5ERWA 4X0KB 1CE6B 1CXHA 3DYOA 1NCWH 1RZKH 5JW3L 1AY1H 1S9YA 3QEHB 4P46C 2EDRA 2HVKA 3KPOB 4OGYL 3I85A 4JY5H 1D5XA 3TJHD 4CJ0A 1I7RA 4WEBH 3LB6D 1B9ZA 5BRZD 3LV3B 3SKNA 1I3GH 5C0AD 2J8UA 3NACL 5AD0A 3C5JA 5EIVA 2V2XA 4PG9B 3PWNB 1RFDH 1J86A 4YDLC 4APQB 5I1JH 3HR6A 1I1AB 1ORQA 5GRXG 3FB5A 4PJHB 5D7JA 4P49A 5HI5C 4PLJD 4M8VA 2IAMB 4HC1A 1KB9J 4KKAD 4M03A 4MA3B 2YN3A 4UIKH 5T3XD 1IAIM 3BAEL 1MHHB 3F6IA 3NTCH 5EO0B 1ZVHA 4XMLL 4C56B 4OTXL 3RKPA 3U7YH 1B88A 3H8NA 5IHZA 1SEQH 4EI6B 1XFPA 3IJSA 1P4IH 3SPVB 2NX5D 4I0PA 3SEPA 3E0GA 4UB0H 5IWLC 4ZTOL 4Y4HC 3Q1SL 3M1BA 4N0FA 1NMCC 3UO1L 2B39A 2AVGA 5E2TH 4PRAA 4PY7B 5AZ2L 5TDNA 5EU3A 1N0XL 2Z8VC 3P77B 5E8NA 5TFSH 3U1SL 4WO4B 3DVGB 1R6VA 5DS8B 4X4XB 2FZ3A 5IT2L 4NKDA 5C07B 3QWOB 2AXHA 1MH5B 4S1QL 4H1LG 4G6KL 3HKFA 1NFIA 4Y89A 4X7CC 1U0QA 1JHLH 1KT2B 1LEIB 2PYEA 4I9WD 5IMLA 1TTFA 1I8LC 5E08H 3AS2A 4JDZB 4O5LH 2CPCA 4GRLD 2VLKD 2F8VA 4U33A 4X5WA 1A6WL 4F7MA 3DV4A 1OB1A 1MIEL 4JO1L 3NIFF 2EC9U 1DBBL 4YDVA 3S35L 4XH2A 1OARH 4N0UB 4LRNH 3G5ZA 1R3JA 3D85B 4I0PD 2OJEA 2R2CA 1BM3L 3EHBC 4WI2A 4NQDB 4GAGL 3EKCA 5D6DC 3KAAA 1E4KC 4QRTA 5FK9B 5JZ7C 3B9AA 4IRSC 4CJ1A 1U58A 4AL8H 4DQOL 3O9WC 3MUGB 3BE1H 4BFEA 3SJVD 3HRPA 3HFMH 3VFMA 4IS6A 5D5MF 4CW1A 2DD8H 4JVUA 3O11B 2H2PC 2V17L 4MWFA 1FVDA 5GJTL 3MC0A 3ZE0E 1FPTL 1MNUL 4MAYB 4BQ8A 1FO0B 3N85L 3BIBX 4RWHA 3QDGA 1WZKA 1T1WA 2NY5L 5DEFB 3CFEA 3LKRB 2DMBA 5E6ZA 1T1ZA 2X1PA 3MLYL 1GHFH 2GJZB 2VIRA 1CICC 1R3LB 2F74B 4NT6A 4B7IA 4JFEE 2ICEB 3W2DL 2GKIA 1TJHH 1DCLA 3CVHB 3MRNB 4D0CB 5DJAB 1BVLA 4YEFA 2O5YL 5KOVC 1RIUH 4POZD 2W60A 1A1MB 3SDDC 4RQQB 3QRGL 4KXZH 5DJCB 3BMVA 5GIRA 1NBYB 4L3ED 2RIKA 2ZCKH 2H8PA 3H9HB 2I25N 1P7QB 2FDBP 3BSZH 2P43B 4AMKL 1WVZA 4DKEL 1U36A 5FKAB 1K6QH 4MCZB 3QUZD 1VFMA 4JG1H 5SWSB 4YHOL 3V5DA 1I7TA 1Z5LA 3DO3A 4JZJC 4HFUH 4JCLA 4HIHB 3QDGD 4S1SH 1EFXB 4MX7B 3I9GL 1S7UB 2X09A 1JRHH 3ZDZE 4A2LA 1PDKA 1F8TH 2AJYH 3FT3B 2WUBH 3EJYD 4JO3H 4L4TD 4OQTA 4BFGA 3H9SA 5IV2B 1NCDH 3T4YA 4OAWA 1DP0A 5IFHL 3TV3H 1UB5A 1PKQB 4UV4L 4Q2ZA 3VFVA 4HK3N 4P3CL 3VMNA 2VDRH 3VGDA 2XV6B 1MFCH 4LSTL 5TPWL 1KEMH 4K94L 3QDME 2GUOB 3DSFL 5FUCE 1NAMA 4NC2B 1OCWL 1H8NA 4K9EH 2JF1A 1KGCE 4OUUA 1A47A 1KENH 1RZJC 4HUWB 4YDLB 4ODXB 5C3LD 1N6VA 4NFBA 4GW4A 3FO1A 4BK4A 2MKLC 2OM5A 5I19L 1VEOA 1L0YA 1RU9L 4NHUA 2CDGA 1A7BA 3QXAA 5CP7A 3VDCA 5J7CC 4Y4KA 1XGTA 4GG6B 2EDHA 1K8DA 4OLZH 4PTTA 1Y6MR 2YPKB 5FM5O 3P4OB 5E6IC 2ED8A 1J0JA 3O6FC 4UT9H 4XCNA 1KTDA 3RGVC 2E6QA 2XICA 4BQ9A 1ZLWK 1XGYL 2VZUA 4Y4HB 4JLRA 2K1MA 1FHGA 2DIBA 3P73B 3WBDA 1NMCB 5DRZB 1UC6A 1R5VA 3GMRA 3MLSH 4N5ED 3V6ZA 1RUPL 3EO9L 4RMVA 5GS2H 3M45A 5BZDB 3K46A 5T1DL 1B0RA 2VDLH 2EDWA 3CLFH 3IFOB 2ZUUA 4M61A 4R4FL 5DT1H 3RAJH 35C8L 2YK1L 1INDH 5EU6E 4U2ZA 5J1TC 2DM4A 5IW6B 2BC4A 4QHUB 3QEQA 5E7BA 3TZVD 3MBXH 3SDXF 4NP4L 1OSPL 3UTOA 4AEIL 3BOVA 4YAQB 4F80A 2UY7A 2EE6A 4JFYA 2D7NA 1FNSL 4U6XA 4OGYH 4RCAA 1I4FA 3IAPA 3QUML 3MV8E 5KSUA 1U3ZA 1TNNA 5I18H 3MUHL 3GSOA 5D72L 4F57L 1NQBA 2BDNH 3GIVB 5LQBH 5T1LB 2IFFH 1ZT1B 5IB5A 1IKNA 5EOCJ 3NACH 1HIMH 5A2JH 3PWJA 1ZEAL 4XPTL 1LGVA 5DJDA 2WZPD 4IRSB 5D7IE 1BZ9A 2X4UB 5E6YA 3O9WB 4OF0A 5BMFL 4EN3A 3KYMB 2R8SL 4GRWF 2H32H 2NNAB 3LSOA 3QYCA 3QXUA 4JFDE 3T77A 1IRAY 4XC3L 3QEQD 4XMLH 4MA7L 4OTXH 3UJIH 4WV1A 5JXAL 4JPWL 1U95A 4G8FA 5ALBH 1T22B 3F58L 1ZHBA 2ED9A 1G0XA 5L2JB 2IANA 2BVOB 5I2IB 1RZ8B 2V5TA 4QT5A 4ZTOH 1SHMA 4PP1C 3WHE0 1JI1A 2EYRB 1CICB 1LO0H 1M71A 3CDFA 3KLHC 2CK0L 4XVSH 3NFNB 5L9DH 3MLTA 2C1OA 4CADB 2FD6L 1R5WB 5D70L 5INDA 1CGXA 1VERA 3T0DA 2OR8A 1I1FB 1ZTXL 1ZVSA 3T1FA 3VGAC 3RJQB 1MEXH 1WCBB 1CLOH 3SDDB 3GMPA 4JFEB 3TBYB 3WUWG 2J6EL 3K8KA 5BRZE 3B9DA 3GK8H 4UQ2A 5GSRB 1BECA 1MLCB 5C0AE 4OFKA 4WCYH 1QYGH 3KPPA 3TJHC 5F88B 2EICA 3ULVD 3N1QC 3LB6C 4AG4L 4JO1H 1MIEH 5DUBB 2DQGH 3WFZA 1FVCA 3G9AB 4RFEB 1FL5A 3P40A 4JZJB 3IDGA 5EU5A 3BEWB 2UVFA 4XPBL 5DYOA 4FXKB 2W65A 1NKOA 4RFNB 2QLVB 1HH9A 5HGDA 3UEZA 1KG0A 2L0DA 5HPMB 4QRUB 3FQRA 4DQOH 4JM2F 1YZZA 3U46B 2GFBB 2YWZA 4P9HH 4PLOB 2XNAB 2AXGB 2NX5E 1IEHA 4FQLH 3LKQA 5HHPA 2V17H 5C0BA 2OTWA 3P4MA 3MA9L 1A1NA 5ALCH 5GJTH 3ZHDA 4KRPB 4HLZG 1I3RA 4NCC2 4JN2B 2OJZL 3N85H 4JHBA 4HXBH 4GRMA 3LZFL 3DRQB 2BVYA 1T7XA 2H1PL 2CLVB 3MNZB 4NRYB 2D7OA 3MLYH 4LBEA 2A83B 3W2DH 5CJBA 2P8MA 4X6DF 3O3DB 3TIDA 3QDMB 4U0QB 3MNWB 2Z31D 2E7HA 2O5YH 2VLKE 4ZUWB 4AM0B 3F65A 4H0IA 2PN5A 1XR8B 3PWVA 3QRGH 1TZGH 1AXIB 3BWUC 4EDXA 3DMMA 1QFWL 1WC7B 3I75A 2DQDH 3MX0A 4JZNA 3B43A 2VWEE 4AMKH 2P8PB 4DKEH 3IDMB 4Z6AT 2NY0D 4F9PA 5E6IB 5FYJD 1MFBH 5IBLD 1K4DA 2HN7A 3WJJA 1GOFA 2VWEC 4M43L 4ZOBA 3RGVB 1PZ5B 3SJVE 3VE0A 3ULVF 2HRLA 3IFNL 3MRQB 4KQ4H 4F33B 3I9GH 2WUCL 4NHCL 3FO9A 2OL3A 2Y5EA 4HUXB 1H0DB 1U8IA 4JY6B 5HI4D 5IGXL 5CIPB 3BO8A 5DK0B 2ERJC 3ILPA 5D96C 2CO7B 2W07A 4GW1A 2ADFL 5ESAB 4HFWA 3WE6A 2DTSA 1OLZA 3S34H 3U4EB 1QFWI 1U8NA 4QF1B 4UV4H 1UENA 5DQDH 4P3CH 1IJ9A 5TE4H 5EU6B 4KWUA 4LSTH 1FN4A 5TPWH 4Z8FL 3GO1L 2D0HA 1D5ZB 4JO4L 2ICWB 4GG8B 2DIJA 3DSFH 5ADPL 2ZCHL 5I1LB 2HVJB 3ISWA 2VDOL 3J8F7 2AI0H 1A6UH 1S8DB 4L3EE 5CJXC 3OB8A 5ICZB 3ROOA 3RBGA 4POZC 1TNMA 1YY9C 3QHFL 4U1JA 4BZ2L 1HQRA 4HS3B 4OLWL 1RU9H 1N4XL 2GSGA 2JIXB 4XPGH 5FOBA 5JW5B 4M1GL 5CSZA 1ZXQA 2BHZA 2VKXA 1GL4B 4P57A 4GKSB 3PL6D 1UZ8B 4YHZL 1CE1H 1QR1A 1D5BB 5I15L 5T1MA 4XNQA 1D6VL 4FQQA 4YBHA 3VFWA 5DMJB 2Y4SA 3LN9A 3HZMB 1S78D 2FATL 4LCYB 4JFDB 2ZUTA 1FO0H 3G5YA 2EIZA 5L8JB 2VH5L 1AGFA 1MCRA 1KCVH 5I1HL 1WCQA 3QUXD 1XGRB 4L4TE 4ZFOA 2CKBA 1M1SA 3PGDB 1PG7L 3KXFD 3QIBD 4YHPA 5DGRA 5H37G 3RIFK 3BGMB 1RZJL 3EO9H 1X5IA 3U9PL 1YEEL 2DMKA 1YNLL 4X6CA 5CEZD 3CVHH 3EJYC 4UDUA 4KRMB 5ICYA 4LQFL 4XVTH 4FFVD 3VGAB 2YK1H 3D25B 4QHMB 4W4OA 1ONQA 4LHUD 5EORH 4YQXL 5T3ZL 4NP4H 1OSPH 4XP4L 2V2WB 4JJ5A 3VA6A 4JGJA 1OOAA 5CSGA 2CGRH 1BWMA 1FNSH 1A0QH 3O6ML 3LEYH 32C2A 2Z93B 4QXTA 4P23A 3RVXC 5BRZB 5D72H 5FO7A 1FNAA 4U1SB 4MD4A 4F57H 3ALWA 5C0AB 3SDAC 2BSED 2DWEB 1LE9B 3VW3L 2HYMA 3H3PL 1WV7T 1K85A 4UQ3A 5D5MB 4IDLA 4K8RD 4D8PA 3TH2T 5GGSB 1ZEAH 5DLMH 1ZK9A 1JYXA 4OM0H 3R1GL 3RWCB 3S5LA 1XGUA 4RX4D 3VRJA 3GFUA 2Q1EA 2FHBA 2QQLL 5GZOD 4CU7A 2DYPA 2R8SH 1IVLA 1YMHB 3EDDA 4PTUA 1F6AA 5DVNA 4R2GD 3B8SA 3PGFH 5GGTL 5GRVL 1OSZA 2CO6B 2YD4A 1EZVX 1IM9A 3EJZD 4KK6C 4L8DA 5AG9A 1AHWA 1J1XL 1JVKA 2IMMA 1T80A 4HGMA 4JPWH 4OJFH 5CMAB 5DURD 5C0FA 1XF5B 4TPRL 1A6ZB 3F58H 2D31A 2NX5B 1F4YH 3UX9B 4YR6A 1P7KA 3IXTA 4KY1L 5KVDL 1NEZB 1N8ZA 3RWEB 5KSAC 1DTUA 2WBKA 1U8LA 3RWDB 2CK0H 2NZ9D 4RMSA 4LKXA 3U0WL 3U4BL 4DK3A 4OLUL 3DWTA 3JTTB 2FD6H 5D70H 1EHXA 3WMSA 1KXTB 5JIIA 3BQUA 4NM8L 1YY8A 1IQDB 1BVKA 1RJZB 4XCEB 5ILTL 2C7UA 2KZ1B 5EOTA 3MZTA 3I6KB 4PBXA 1F4XL 2DYPD 4Z0BL 1NBZA 3PV6A 2VLKB 1G7LB 4WDIA 1HKFA 3GUTB 5IM7B 4HXAL 4YXLH 3GIZL 3QCVL 3L3OA 3A67H 5DRNB 4TQEH 3CMOL 2DLHA 3V6BR 2JCCF 5DQ9B 3UDWA 5FUOL 2MNUA 4JM2C 4WNQB 3QFJD 2FEEL 3LIZL 4XPBH 3JWOC 3RHWK 3MLZL 4HF5L 2FIRT 4KHXL 4JGMA 4LPYA 3ZTJH 2ORBH 4DKFH 4G6MH 4PRBA 2VLJD 3OKOA 1VGEL 2ERJB 2FYYB 2CRMA 4L9LC 4Y19D 3SJVB 3ARGC 4XP5H 5EO1A 3HE6D 5IMOA 3NCYS 4JFOA 3BQUD 4PGDA 4X6DE 5DFVD 2HKFL 4Q0XL 2EXYD 3UJJH 1QBAA 2FSEB 1S9VA 3VWJA 2BSRA 4XNMB 1EX0A 1PY9A 5HJ3B 3UAJC 4UI2A 3RVVD 1BHGA 1RHFA 5GHWL 1OD7A 5SX4H 3LZFH 1BFVL 2G2RA 2H1PH 4GMTL 1RVFH 3BW9A 3QCUL 1JPFB 1MCIA 3SGJA 4X5LA 2AEQH 3FQNB 5HHME 1JZ2A 5E8PB 5JDSB 2ATPA 1DSFL 5F7MC 1ZGLP 1DQML 1VFAA 5GGRB 5KW9L 1LVEA 3ULVE 5EULV 4MCYB 1CT8B 2FX7H 2P4AB 2NY6D 3I6GA 5JHLL 3KYOA 4L3EB 4FXGA 3IFLL 4IIQA 1QFWH 1T7ZA 3NCEB 3TH3T 2PXYD 3ULVC 5HY9A 2AJ3A 3VWJD 5C2BL 4ODTL 3FRPG 4WHTA 3ZYIA 2YD2A 4LLDA 4ZG1A 3EZJB 2E7LC 5D9SB 2FLBT 1XZ0A 2EIDA 3FZUC 5C0CD 4U7MA 4G42A 1NGWB 3WIHL 5H94A 3BP4B 3CZFA 3LH2H 3IFNH 2P5WA 3QRFM 2ZOKA 2GAZA 1BFTA 4GMSH 5K9OA 4ACPA 2HTLD 1G7QA 1YMMA 3V7AG 4H20L 2QQNL 4EBQL 1JV5B 3VFNA 2DLFL 5IFAL 4L4TB 4XXCA 1ULVA 2AKRA 3NFPB 3GJEB 5DZNA 3L5WA 2BNRA 4OFYA 5IB2B 2Y23A 1UEMA 2P7TA 1OVZA 1VPOL 4P5MB 3CLEH 4XP1L 2X4QA 3PF2A 3CFBA 4F7CA 1BX2B 2H9GA 3KLAB 4RRPG 4XPHL 3PE9A 3ARFC 3GO1H 5HI3C 5IFJA 2DLEA 1TZIA 4JO4H 4QOKB 4FG6D 4R3SA 5ADPH 2ZCHH 5DC4B 3BPCA 1YNTB 2VDOH 3SDAB 5F96L 2ZJSH 2R15A 3QIUA 3RWJA 4GRWB 2AP2A 3T0XA 1JN6A 3R0MA 3O2DL 5F7WC 5ISZD 4H26B 2P5WD 3ZTJG 1G7JB 5I1KL 3HC4L 4XBPB 3KHOA 4H25B 1IM3B 4OLWH 5T5NF 2VDQH 1UVQB 4AEHL 4UT6L 4CN6A 2CH8A 4MHHI 2BK8A 4PYHA 4EUPH 3MRLA 4ZNEE 5CWSB 2X5PA 4FNLH 1RY7B 4YHZH 1EGJA 1NDMB 4ORGA 3PXJA 4TSBL 1BQLL 2XKNB 1XCQA 1NFDF 4I2XA 1H9VA 4NN5B 5E9DA 5KSBF 4J7RA 4RNRB 5MI0C 4PJIA 3I02B 4MNGE 4IMKC 4UIMB 5C6TL 5I1HH 2EECA 1JWMA 2VDKH 3P9LB 4MQTB 4PJCA 4XI5D 5HI4C 2YN5A 1RZJH 3ZKXC 1EVTC 4GW5A 2A6DB 3MOAL 3U9PH 4H8WL 2PW2A 1VKXB 5C8JB 3PQYA 4YGVB 4LQFH 1L7IL 1KB5B 5DZLA 1XIWA 2VXSH 3OX8B 1OQXA 3MACL 4JVWA 2ILLA 3CDGA 1A2YA 5IIEB 1F6LL 1FJ1A 4MVBD 4YHNA 1G7MB 5CJ8A 4XC1H 2VJXA 1KCSL 4XP9L 3IXAA 3KJ6L 5HBBA 1AO7A 4KK8C 2VC2L 4POUB 2YEZA 4FQXC 3C60D 1MLBB 2W0KA 2HP4A 1J8KA 3EYOB 4I48A 5E9DD 2R1XA 2FB4H 4D9RD 2A9NL 5D2LF 5MEQA 1SBSL 4JM2B 1UFUA 3UTPD 3VW3H 4KV5E 4X6EA 4FFYL 5HXMA 4WWKA 2Z8RA 3P30H 1CXEA 2YC1B 4OF8A 5IHBA 4HS6A 4NYLA 1OF2A 3MRPB 1I8KB 5FYJU 3R1GH 4XNUL 4R4NC 4E5XA 5CIPH 3RDTA 3FRUB 4K71B 2QQLH 4L9LB 2COQA 3O4LA 3ARGB 4Y5VC 5ITBL 5IMKB 3MRHA 4KROD 4O4YH 3PL6C 5C09B 5GGTH 4HIEB 2D4FA 2ENYA 1V3JA 2C5DC 4R4BB 3QG7L 4M02A 1L0QA 4P3DB 3KXFE 5ESVB 1INQB 3BKYH 1AIFB 5FYKD 3VFTA 1TMCB 3CFJA 3QIWA 4X6DB 5CEZE 1YQVL 3EGSA 4HKXB 1OGTA 3BZ4A 4YDKL 5CILL 4ZS7H 3V4UL 4KY1H 5DWUH 1SBBA 1WFOA 3QIBC 2C3GA 4LSRH 1N5YL 4YO0B 3QHTC 1FIEA 1CXFA 1N2RB 3QUKB 1MRCL 3U4BH 2J88L 2JCCE 4OLUH 4V1DA 4X6BA 5TF1L 1HQ4A 4MZ2A 1SJVA 1BJ1H 2IF7A 5ILTH 5I8KL 4TUOA 3VG0L 5HHMB 4UAOC 3CFCH 4J8RA 1T7WA 1HHKA 4EUPG 3O4LD 1TPXC 2Q6WA 5KVEL 2WNGA 5FB8A 5IVZB 4PGCB 3AS0A 2UZXB 3MLWH 2P46B 4HXAH 1JNJA 4WW2F 1U8HB 3O6LH 2WWKO 2X4SA 4KDVA 4KRNA 4F9LA 3STZA 4M1DL 3BHBA 2VN4A 1DN2A 4KJPD 1C16B 5JPMB 1SYVA 5I6XC 4X99A 2CLRA 5KAQF 3QZWB 1JWSB 1CD9B 5I0DA 1PZUB 3HZVA 4GXVH 5IUSA 1A4KA 3GMLA 4KMLB 4Z7UA 2HKFH 4X7SL 4N8VB 1OAKL 1ZHNB 4JCMA 1OGAA 2LFGA 2YHGA 3H3KA 5I30L 5JIHA 4BQCA 1C08A 3G5VB 4RBPK 2GJ6A 3C6SB 1V8HA 3KPLA 3RWFA 2F53A 2VOTA 3HC0B 1N3NB 4PJFA 1TQBC 4Z7QE 1AH1A 2FHCA 5LKNA 3ARFB 4WENB 1BFVH 3BZFA 3ETBF 5D1XA 4JDTL 3UTZA 3QCUH 4G3YL 1A3RH 4NUJA 2IBZY 1FV1A 5D7SH 5FYLL 4OKDA 3UBXB 1P4BH 1DN0B 1SY6A 1NCCL 1UJ3C 3NCJH 1I85C 4OCNC 5E2VL 3JWOL 2D7PA 4OFDA 4DFIA 4PGBA 1U2CA 2PYFA 4NRZA 2Z31B 3D69B 2A74A 1GGYA 2APTA 4KMQA 3KYAA 1AGBA 3IF1B 4PJ8A 3EIFA 4DAGH 2EXWC 4PJ7A 5JHLH 2Z4QB 3CUPA 2EH8L 2P5EA 3GM8A 4FQCL 5TDOA 5C6PB 3CD4A 3QFJE 5IKCA 1B2WH 4NO2A 2X7LB 4WTWA 2H6PB 4ODTH 1A3LH 1SJEB 2GK0B 3S97C 2D9QB 2GJ6D 3HZKA 4ONHA 1T0MA 2FH8A 2BNUB 2VLJE 4LCWA 1PLGL 5MI0B 3WFBL 3MNVA 2EDEA 1A7NH 4Y19E 3VFGH 3CFKB 5T33L 5J57B 3GSVB 4L8SC 3KPSB 1CGSL 3OPZH 3D3VA 1TJGH 3AGVA 1RSFA 2DQCL 3ZLQC 3RNKA 1FVEA 4JFHD 3ZKXB 1U8JA 5DJZB 3NAAL 4LPVA 3LN5A 1K8IB 1EJOH 2EXYC 4HX1B 43C9B 2DTML 5JIKA 2XZZA 3GI9L 2RCSH 4PJ8D 1QTYT 2EDTA 4OD1L 4U3XA 3RVVC 2DOCA 5LAXA 4O2EA 1XR9A 4ZO6A 2B0SL 1KN4L 5JW4R 3WFEH 1Q9LB 2N7BA 4FQXB 2WMPA 4G7VL 3TCLA 3O2WL 2CIIB 5F8RC 1MAMH 2OZ4A 5ACMA 1ZA6B 4U1NA 2B20A 2FBJL 1S9XB 4KZEL 1R0AL 4DN4L 3BMWA 4CVZB 5EH1A 5KSBE 5EU4B 4ZPTA 4I0KA 4AEFA 3FN3A 3F7YB 5HYIA 4JQVA 1QLEL 1AQKH 3UJTL 4ERSL 5C0IA 5J6HA 2NY6C 3VRIB 3TNMA 3L3IB 2C3XA 5DO2D 4UT6H 4WY7L 5C0CE 5FXCH 4FFZL 1ORSA 2PXYC 3PL6B 4JREC 3BIKB 3A6BH 4FTVE 4M6ML 3C6LC 1EO7A 2SEBA 5F7NC 4TSBH 4U1LB 4GUPA 1J8HE 5IVNA 4ZUUB 4WUKH 2WW8A 1BJ8A 2J8HA 4LLUB 3QUXB 4Y2DA 3VXRB 1X9QA 4BFIB 4HWZB 4YIQB 4NN6C 1FG9C 3QIBB 4OZHF 3SDCC 4PGEB 2CRIA 4Z76B 2HTLC 3H7BA 5J9PA 15C8L 2BVQA 1MIML 4PLNC 1QSZA 3QH3B 2VL5B 4JQXC 4OGZA 1AD9A 1LE5A 3CSYB 3KWWA 1A7OL 1C1EH 4FZ8H 4LHUB 4UILH 3MACH 4PJDA 4UAOB 4JG0H 1WIOA 2JCCB 3TLRA 1TPXB 3ARPA 5I75C 4I3RL 1E4XL 1H5BB 4XP9H 3OAUL 3WS6A 1T04B 1YEGL 2VC2H 3D18B 3NZ8A 5ISZE 4U0RC 1Z9LA 2APVA 1TJIL 1HSAB 3BN3B 1Y18A 3ARBC 4LCUA 5CD3A 1X7QA 3KPMA 1HXYA 3C9NB 5J8OA 2JK5A 3UTTD 1NEZG 2VAAA 2BSSB 1P4LB 1OPGH 5A40E 3MJ8A 1XF3B 1F4WH 4LHJB 4LEXL 4TULL 4NNYB 2BZDA 4R97C 4I0CC 3JSSA 4XNUH 5I6XB 1ND0A 1FFRA 4MHHG 2VL4A 5DUMH 3S88H 2EDLA 4GOSA 4LDLB 3QQ9D 5EZOH 4NQXA 2E27L 1MWAA 3CJJA 4J3XA 5FIEA 5M94B 3CC5B 2W59A 5CGYC 2V5MA 1E4XI 1G6RL 4OSUH 3O0RH 1XF4A 4ETQB 5T1KD 4R0LC 1AGEA 3IJHB 1UKTA 1CDGA 1DE4A 4P4RB 2MOVA 3ME0A 1L0XA 3ZE2F 4XI5C 2QQKH 3OB0H 3WIFB 1X5GA 4GRWH 4YHKH 1UJ3B 1FYTD 3HG1A 4LSQL 3N1GC 2P24A 5TF1H 1M05B 2IQ9L 3RL1A 3WKMH 3FFDA 4YPGB 3VG0H 3OTTA 4NQVA 4WW2C 2WINA 1KOAA 4D9RE 1VACA 3I50L 4J3UA 3UTPE 5D1ZA 1IL1B 5B8CC 2HWZL 3F7VB 5J89A 5C08A 4ZYKA 4QGYA 5A3ID 5C0EA 5FKPB 4KTEL 1MJUL 3BJ91 4N0CD 3GHBL 3V5HB 2ZWLT 3MOBH 2QSCH 1I3VA 3QFJB 1KPVA 2Y36H 3O3AB 2VZ1A 5E5RB 3S36L 4L8SB 1MHEB 4M4RA 4PLKC 4FQJL 1R5IA 4RA3A 5IBTH 1MCOL 2BJMH 1IGTA 3HG1D 1K2DB 2YKLL 4O51B 4Y19B 3RL2A 3DTXB 5FYKE 3HE6B 5HHXH 2X70B 3MRIB 2DQHH 1KB5H 2X4NB 2JB6A 1T89A 4X7SH 1F97A 3G08B 5I30H 2C4FT 3G5XA 1RUML 1A4JA 4FQPA 1BBDL 3L6FA 4YNYA 5E1HB 2I60L 3MGOB 3ARDA 4HSQA 3Q2CA 4OCYL 4WEUD 3JV6B 4MJ5B 5CJOL 1F4AA 1P6AB 4TVSa 3J7HA 3BUYA 3S3SA 1LQSR 4PRIA 4JDTH 1F4HA 4PY8J 1Q72H 4G3YH 3SGKC 4JFZH 5FYLH 2V2TA 4TSAH 2CLZA 4PJAA 4MNQD 4KHTL 3SCMA 4DUWA 3K3QA 4WI7A 4CDGC 3JWOH 2DQEH 1G7HA 2MHAB 4QTIL 5DSCB 1JNNL 4LGRB 4A2MA 1QKZL 2VSCA 1NFDB 1JNHA 4HH9A 2NY6B 4XZUB 2OR7A 5KSBB 1HHHB 4GH7B 1P5VA 5I1AB 2EH8H 2PXYB 3K1KC 4NM4L 3PABA 4FQCH 4JREB 2XZQL 2FHFA 2IALA 3C6LB 4PV9A 4PB9H 3WNOA 5ABDE 1TVHA 2Q76B 4WI5A 3RFZC 3DGGB 4QXGH 1OTTD 4YFDB 3S37L 4LSUL 4EI5C 2FJFB 2Z91A 3FQTA 5D6CB 2BVPA 4FTVB 5DEGB 1G9MC 3UYPA 2B1HH 3BPOC 2PO6A 1ADQH 1KIRA 2BHYA 2PTTA 4NN6B 3LRSA 4FP8L 1T1YA 5B38B 1J8HB 1CGSH 3SDCB 2G75B 1MY7A 1G7PA 5HGHB 4LSPL 2A6KB 2UYLB 1UXWA 1C8PA 3GDBA 3SCMD 4JR9L 2C1PB 5FHAH 5EBMA 3NAAH 2CIKB 2DIAA 3C5ZD 4QRPA 3QQ4A 3VFUB 3MROB 3DGCR 3UTSB 5BS0A 1VA9A 4O2FB 1GGTA 4JY4A 1Z3GH 1R3HA 1YPZF 5AZEH 3SN6N 5CEYA 1X4ZA 2GSIA 1S5HA 3VRLF 3AY4A 2NY3D 3TYFA 3ULVH 4TSCH 2B0SH 1KN4H 3UMTA 4U0RB 1AD0A 3MRKA 3JVGC 1U8PB 2HJFA 3ARBB 4U1IA 4PBVC 3GSNB 1X5ZA 2FBJH 3LCYA 3HMXL 5F7YC 3I2CL 4OD3L 4KU1A 2VISB 2MPAL 1GGIL 3KYKH 1T20A 4NQEA 4NSKA 4R97B 1I1CA 1RJCA 1D5IL 1IMHC 4ERSH 3V0AC 5E2WH 2CUHA 4OZHE 3G04A 2DM3A 2CKNA 3I6LD 1V3KA 4HDIA 1GZQA 1LD9A 1MJJB 1Q94A 2AK4D 5C1MB 1S7RA 2OQJB 4LLYA 1KJVA 2N4IA 3BWAB 3DX6B 1I8IB 3RZCC 4PR5B 4XXDA 3L9RB 1T3FA 4JFHE 2CDFB 1NCBL 1RIVH 4DVBA 1N6UA 4CKVX 2CUMA 2FL5A 5KBNC 4R0LB 3IDJA 1WSST 3MRJA 2R0ZL 2AJSL 2FEDD 4GSDH 1QSFD 3RX5A 3B9KD 4M48L 3O3UN 5D7JC 5SX5K 1IGJB 5GS0C 1JK8B 1MCFA 2F5AL 5IR1B 1U6AH 1CLZL 1IGFL 3MCKA 4PJ9A 3WDHA 2X1QA 4L29B 4NQED 2WLZA 5J0BA 2PR4H 3MMEB 4LLAA 1ZLVH 4WW2B 1HK6A 4QKXB 3RVUC 3GMQA 3ECBB 5HHQA 1MFDL 4XPAH 5BVJA 3SO3C 4FQIL 4I3RH 1E4XH 43CAB 2HT2D 4XMKL 5SWQB 3U36B 2E5EA 1ZMYA 3OAUH 4Y4FD 4A6YL 5B8CB 3N06B 1YEGH 4UMGA 3U4AA 4JQIL 2XN9D 3TO4D 3OAZK 5F7DB 1UM6L 4KDTC 1B4JL 3A6CL 4RAUB 3OKLB 4ODVL 4OI9A 4TOYL 4DTGL 1FFOA 4JO2L 5F72S 4QNPF 4AT6A 1MY5A 1IAKA 1QG3A 5L88H 4IHOA 5IHUL 4JPVL 4LLWB 4K2UL 2CQVA 1HSBA 2VXTL 3P0VL 3SOBL 3FB6B 1MCJA 3TVMC 25C8H 1E6OL 3VH8G 3T04D 3CXHK 3OWEA 1FL6A 1V7NL 1S7QB 3PDOB 4AZ8A 4LSSL 1U91B 4FOMA 3HI6H 3AREA 3OG6B 2M8XA 3MRRA 4JKKA 5MEPB 4M62L 1A6AB 3HZYB 4RMRA 5KVGL 3GRWL 3VFPB 3IU4H 1ZGLA 2VE6B 1FC2D 1E28B 3CFDA 3IKKA 1BBJB 5ENWA 3T65A 5I76A 3UYOD 4JB9H 1FZKA 1UEYA 1MCWM 1HN1A 1CD1B 5K9JL 3MO1A 4HEPG 1F2QA 2R2EB 1RV6X 5DVMA 1ZKAA 1IGYB 3WHXA 2IQ9H 4JFQB 5DD5L 1UGNA 4YUEL 4J1UA 2F58L 3ULUF 1VSCA 3MV7E 2KBGA 1MF2L 4YDIL 1GYAA 2D3VA 4NQCA 4B7LA 2CMRL 3BIAX 3M07A 4FHBD 2CUIA 5F6IC 3I50H 3TP4A 1FZJA 4PJBA 4J3OC 3UTTE 2HWZH 1BREA 5ETUB 5HDLA 5DTFA 2F5BL 3Q48A 3K80A 1DLHB 3ROLA 3GHBH 4EI5B 5IMMA 4PRPD 1C7SA 3LQMA 5C0RL 2CR6A 2HH0L 3KR3L 1TZHB 3LY6A 3BPOB 4M8QB 1X5YA 3O8XA 3QPQC 2R29H 3S36H 4UTAH 5HYSG 1HHGA 4G9FB 2OCFD 5AAWA 3ZYZA 3IFPA 2A6IB 5IEHB 5CEZH 3S3JA 3ZO0A 1HEZB 2DQJL 5EZJA 1WZLA 4RMWA 4PV8A 2NR6C 2AJXL 1NUFA 1S7SB 3QQ9C 3GBMH 4I3GA 3SHSA 3GNMH 3V4VL 4MJ2A 4X8XA 5DJ2A 3VXPB 3QA3B 3F5WB 1AI1L 4NQCD 4Z7VE 2XOTA 1FGVH 1BBDH 1D5MA 3S4SG 3LKNA 3IDXL 2B5IC 1T5XA 1PX3A 3ZYJA 2R0KH 5JNYA 1ZT7A 1FYTE 1ZWIB 4XBEL 4OCWH 3Q0HA 3VXSA 4Z7WA 2A6JB 3TBTA 5INCA 5CJOH 1N59B 1HDMB 1DFBL 4OLVH 1MRFL 2W9EL 3VI4F 2NY1C 3Q3GB 3G6DH 4NUGL 1JGDA 5DJ6B 4E0RA 1N7MH 1YJDC 1YEJH 2VLMD 1ES0B 4R7DB 5KTEH 3TWCH 1EIBA 5L8LB 4NBZB 2R2HA 1AR1C 3DETD 3MA7A 3D87B 1CTOA 4QTIH 1MI5A 3MFFB 3TA3C 3ESVF 1X6LA 4O2CA 4F7EB 1QKZH 2W0LA 3O4OC 4ZTPH 4OFIA 3UXFA 2W9DH 3QCTL 1PAMA 4HWEL 2ICES 1BQHB 4CMMB 5SWZD 5ID1B 5F9OL 2QSVA 4S0SD 2FX9H 1JUFB 1F00I 4NM4H 2XZQH 5M7QA 3MODH 4E42B 5A3IC 3G6JF 1I7RB 3KPRA 4OZHB 3IETB 4N0CC 3RP1A 3RZCB 2BFVH 1FZOA 1XGPA 4LSUH 3T8XB 3OKEA 2BOCB 1YPZE 1UB6B 1P9MC 4NKOA 5GRJH 4PRNB 1ORQB 5J11B 1J11A 4FP8H 1OQOA 3D39A 5FGBA 3HUJE 3GSWA 1DUZB 4FXLA 5EU7E 1VFBB 2IBGA 4XX1G 1IFHH 5F1OB 5IVXF 1U8QA 1W72B 4JR9H 4OIIL 5I66B 4Y4KC 1WZMA 4TUJB 4F3FA 5EU7C 1RK1A 1PYWB 2R4RL 2DQIL 3KG5A 2O61A 1WBZA 1BD2E 4WFGE 3PP3K 2APFA 4CAGA 4AJ0A 1XT5A 2VLRA 4QWWD 2AQ1A 1J0YA 3SO3B 4EDWL 2O5XL 4MNQE 4G6AC 4PD4K 3R0NA 4QRRE 1IC4L 4NO3B 3SE9L 1HINH 3DUUB 1HZHL 1YN6A 4JHAL 1NJ9A 1NMAL 4WU5A 1LEKB 4KUZL 4GKZA 2HT4D 1JGEA 3WNMA 4L5FL 4OQ1A 1G9ML 4PRAB 1FNEA 3VFSA 5IW1A 4JPKH 1Q0XL 1FH5L 2WIIA 2ZNWA 3I2CH 5LWYL 2FZ3B 3GB7B 2WWMC 5DD3H 2MPAH 3RWIA 1GGIH 1EFQA 3D39D 2IPUK 1R3IL 5DR5H 1HOCA 4LL9A 5JOFB 3P0YH 4PJXA 5EFIA 3TVMB 5DD6A 3N9GL 4IDJL 3E1F1 1HYSC 1MUJB 2EE2A 1CD8A 4X7TA 3WIIL 5EIIB 2XG5A 4FQ1H 5JO5A 1GGBH 2NTFA 1OB1B 3DV4B 5DQJB 1OTTC 2X9YA 1W0VB 2VLRD 4LDOB 3T4AB 4R90L 4O58L 1T21B 4IOSD 3QUYD 3EO0A 1R3JB 2WP3O 2XA8L 1LDSA 2R0ZH 4JHWL 1V3LA 5EOQL 4AIXA 4O02L 2QSTA 2FX8H 4Q97A 2KZWA 1F02I 3ALPA 1GAFL 4EN3C 4HJJL 4K7PY 1IGFH 5T3XL 4QNPE 3OL2A 3ZTNL 1NL0L 5ANMA 2HT3D 2I27N 2RFXA 4I77H 3FMGL 1UYWL 4WV1C 2IH1A 4MWFB 4Z0XA 5C7XL 4LVNB 1QVOA 5CLWA 2FJGA 4J4PD 3FQUB 3TESA 1QBBA 5IB4B 2FGWH 3W0WE 1MFDH 4U1MA 2MKWA 4FQIH 2OK0L 4WHYG 2WQRA 3CH1A 4ZFFA 3L3KB 1J0IA 3DXAE 3MV7B 3N1FC 3PP4L 4K3EL 5JIPA 3VFRA 3PDGA 5CUSL 1U3HD 3F12B 1YDPB 5I8CB 1WBYB 3A6CH 4S10A 4ODVH 1DJSA 3UTTB 2WM0A 4JO2H 2HKHL 4QHKJ 1JIBA 1T7VA 3MXWL 4Q9QL 1DBAL 4WVRA 4UNVA 4CNIA 2I9LA 2HG5B 2AK4E 1YQ2A 2GEEA 4HC1L 4K2UH 3TT3L 3P0VH 3SOBH 2X4OB 2EEDA 1E6OH 4J2XA 1OW0A 4JFFD 5IBUB 1JWUA 5ACZB 3BZEA 5F3HA 5CKAA 3D0LA 2GITA 5F71A 4YDJA 4PREB 4CRPA 3BN9C 5MENA 2IGFH 2O5ZL 4LSSH 4MXWL 1NC4A 1QSFE 5DZOA 3F7QA 5JUEL 2N56A 1YN7B 3MJ9H 4M62H 1CLCA 2B5IB 1Z5LB 4X8JB 4MDIB 5T1KB 1XF2A 3GRWH 3MLUL 4KH2A 4Q58C 5E99L 1S7WA 2FEDC 3BRFA 4U1GC 4Z7VB 3KS0J 2J3SA 3MJGX 3ULUC 2NY1B 3FONB 3GSNH 4OV6F 2PW1B 1FYTB 5HDBF 5K9JH 5JA9A 2QHLA 3SE4A 1FG2A 5B39A 4CDHA 1Y0LA 5F3BB 4L3AA 4GKNA 4U7KA 3TA3B 3TN0C 5CZVL 2BY2A 3O4OB 3LQAC 2AJUH 5DD5H 3T4YB 2XN9E 4YUEH 4M9OA 1KCUL 3GJFA 4YDIH 1N5AB 5DHXB 1LDPL 1S7XB 3DYMA 3R06A 4OZ4B 3U0PB 2CMRH 3V9FA 1R3KB 3DVNA 4HKBA 2HFFA 2J4WL 4FQHB 1EHLH 3C87A 3KPTA 4WRLA 5FF6B 4X7EC 8FABA 5AUMA 1CFTB 1MPAL 1BOGB 2DKSA 3DX7A 4OD2B 4YXHL 3SE8L 1O0VA 1OTUC 4L4VD 4R7NA 4WU7B 2C3WA 5HGGS 5C0RH 2HH0H 4MQXD 2DKMA 4MDJA 5EO9A 5T5NG 5CAYB 2R23B 2AV1B 4XWOD 3CXHJ 3MBEA 1JHTA 4PBWD 1JGLL 1J1PH 1YPZB 2XTLA 4LCCC </