2AJUH

Cyrstal structure of cocaine catalytic antibody 7a1 fab'
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
EVKLSESGPGLVKPSQSLSLTCTVTGYSITTNYAWTWIRQFPGNKLEWMGYIRSSVITRYNPSLKSRISITQDTSKNQFFLQLNSVTTEDTATYYCARYDYYGNTGDYWGQGTSVTVSSAKTTPPSVYPLAPGTAALKSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
molecule keywords ANTIBODY 7A1 FAB'
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajuH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajuH01
1X5LA 4YQXL 4QO1A 3WIFB 5I73B 5ITFB 2XWBA 3EDJA 4NRZB 4HQQH 5C08B 3VFMA 1QPPA 3TLRA 3V5HB 3MRLB 5D96C 5CEYB 2Q7YB 5I1DA 2AAVA 4JPIA 4R7DB 4X4ZA 1OGAD 5GGRA 3ZL4L 2FYYA 1F2XK 5HYJD 1SBSH 4N8CH 5DVOA 4K8RC 5ILTL 2XTLA 4G6KL 1OCWH 3D69A 4UOW1 3F12A 1S78C 3KR3L 3TFKD 1ZOXA 5LCVL 1I3VA 1ZKAA 4KTEL 5EOTB 2WBJC 5GGVH 4YJZL 5HYJB 4IEFB 3HTLX 3KPLB 3GZKA 2YMXH 1KJ2A 4ZQKB 3OKNA 4RGNB 2P24A 4G7YH 4JY5H 1OCWL 1U95B 2FHBA 3KPRD 2ORBH 4E5XB 2XN9B 3ULSB 1P7KB 1FL5A 4FFWC 4G6JH 2GT9A 3AREC 3TBYA 1L9NA 5KBNC 4HQQL 4HKXA 1NGXB 1WCQA 5ESQB 1UVQA 4F58L 2F74A 3KXFD 4PJAE 4QXUL 1P5VA 2W60B 1DLHA 3CFKA 1KCKA 5C09A 4XNYH 2X1PA 1DBKL 4RFOL 2GTZB 5IQ9B 4CMHB 2R4RH 2R39A 4NUGL 5CEZE 3O9WD 3MV9B 1VGKB 1SY6A 2E6PA 5H2BB 4OLWL 4JZNA 5DF0A 4KK6C 3W9DA 4LASL 3SQOL 2XIDA 3VI4E 3MYJA 4MVBD 4O02H 3MLRH 1J1PL 4U1IA 5DRXB 1A6VH 3C6LD 3L3DA 4PD4J 2ZKHL 2WBKA 1BREA 1QRNB 4OD2B 4XPFH 1U92A 4GS7B 1N7ML 4K7PX 5I1AB 3KNBA 5FA3A 3QFDA 2YPKA 1EHAA 5JPNA 1EXUA 3EAKA 5JXEA 1M7IB 1A02N 2GSIA 5CUSH 5DT1H 3SPVA 4U0RC 4N0CD 4TNWF 3D87B 1AGEB 3K2MC 1RY7B 4Z77A 1KNOA 3MZTA 3QNXB 2D0FA 5D1XC 3TZVB 2EECA 2NY1C 4MXWL 1WEJL 3H9HB 4ZSOE 4R0LB 2VL5A 4KI5E 5FKPB 2EO9A 2P46B 4GRWE 4AQOA 4P23D 4XBPA 3CXDL 1I9JH 5KANG 1A4JA 3BD4A 3MCLH 3BUTA 2W91A 5LJYH 4H0GA 3TO4B 4DN4L 5I1KH 1S5HB 1ZGLB 1HIML 4TUJA 1MQ8A 2AXFB 3D39A 4O00A 5ETUA 5EIIB 3U30B 4S2SA 4JQXA 5KSBA 3FQRB 5C07E 3VH8A 5IHZB 1MWAA 4DKDC 2Q8AL 2XKSA 4FQLL 2PXYD 4PGCA 4YNYA 3U7WL 5L0QC 4HC1A 4KXZH 1EBAA 1M05B 5GS2H 4MNHA 1JV5A 2IWGA 5HHQA 3ALWA 4WI8A 2BVOA 1LO4L 4YC2C 3L3KB 5D5MB 2ITCB 2VLMD 5DWUL 3DNKA 2Y7QA 5I76A 1I7TA 5DSCA 3QR2A 1D6VH 5B38B 3T2NH 2XA3A 2XXCB 2DLFH 2CRMA 4PRPB 5C0CD 2LQRA 1T1WB 5FGRA 1JN6B 2QQKH 1EAPB 4BZ1L 4A6YL 4WO4A 1S9WB 3H9SB 3BO8B 3T3PE 5FCUL 1Y0LA 1K2DB 3GSNL 3OJDB 5BCAA 1NCBH 4LDOB 2AV1B 3TCLB 1W72H 4OSUL 1IZJA 3HE6B 3HAEH 3S8WA 4N1CA 5AWNL 1PY4A 4WGWB 4MNQB 5F1IA 4WI6A 4YLQT 3M07A 4Y4FD 4NFCA 3G6JB 2HT3D 4UT7H 1YY8B 2NXZD 5F6IC 2BVUA 5CZXD 2E7LC 1OARL 4KUZH 5KTEH 2B1AL 3BP5B 3LQMA 3MRDA 7FABL 1EHXA 2CMRH 3O4OB 4PGZA 5FO8A 1NCCL 1WBXB 1YDPB 4MLIA 3VWKD 2R1WB 1KACB 1R3LB 3LH2H 4NQED 1NUDA 3SE4C 2RHEA 4OCXH 1NGQH 2KL6A 5GGUB 5F1KC 3ZE0E 3SGKA 3W82A 3QEHA 1OP9A 2Q3ZA 4NQCA 2HJFA 5FOJA 4I4WA 1XGYL 4R90H 2DD8L 4YXKH 3CU1A 1IC4H 5T1LB 4P5TB 4P2QB 2FB4L 1ZT1B 3GSXB 3IU3B 1YN7A 5SWQA 1RZKL 3P4MB 1YUHB 4JFHE 3QJFB 5F7FA 1VADA 5I2IB 2OJEB 3FB8B 1DBJH 5DFWH 1MIMH 4P9HC 3B9KA 3MLVH 3RX5A 3QUMB 5HI5C 1N59A 1E4XL 4GBXD 1E4XH 4X6CF 3V7MA 3V0AC 5I66B 1RMFL 4K3JL 4P5MA 4PLJD 3M8OL 5I1AA 1E6JL 1MIML 4F33A 6CGTA 5E9DD 4ZAKA 1ORSB 3CCHB 2YA2A 4WU7B 4KJWD 6FABH 5D93C 4BELD 2CUHA 4JPIB 1TJGL 4EUPA 1XR9B 3HAEA 5F7YC 5JHDA 1T2QH 2HRLA 4LCUA 4ALAH 3VMNA 3FN0L 1H8NA 1I8MA 3NACH 3QJFA 5D70H 2X4TA 1K8DB 3K0WA 4YDJB 1NCUA 5ENWA 4ZUWB 3T0AA 3QCTL 4OFYA 5E99L 1CLYL 2Z91A 1ZT1A 3IU3A 3KJ4C 2VZVA 5I8KL 4U1GB 3VGBA 5CCKH 4MCYA 3LH2L 5DMIL 4U05A 3AROA 1IQWL 1NCCH 4I8DA 5E8DH 4HUVA 1XR8A 2R9HC 1ZHBB 1KC5H 4KROC 1UCBL 1Q72L 4X6CA 1KCUH 4XNUL 1JGUH 3LS5L 4PRBB 4C56E 4UT7L 4P2OC 4EDWL 4J4PA 4B7LA 2H26B 1X6LA 5F7DA 1CXHA 2IBZY 2YWYA 1A5FL 1QLFA 4WFGD 1JHKL 2FCBA 3NFPA 4PJIF 4ZOCA 4Y5YB 3DLQR 1TETH 4OF3A 1GHFH 4PJFE 4D0BA 1EUUA 2EEBA 5C0AA 5C0AE 2DDQL 2UVFA 4UOJA 4MDIA 4X7SL 3O4LA 4HXAH 1HH6A 3OAUH 1I8IB 4MHHI 4PD4K 5J11B 1CDJA 1UWXH 3FRPG 4XCFH 3BYTA 4MNGE 4P9ML 3BPNB 5HI5D 3WN5C 4MNGB 2JLLA 3HZMB 3I2CL 3NVQA 3LPFA 3HRZA 1JNNH 4P2QE 4Y19A 4LQ1A 4TPRH 3LHPL 4JRYE 4X4MA 1A22B 2DQHH 1WAAA 2NY0D 1C08A 1BF2A 1RZIA 2IH3A 1U8JA 2VIRB 3T0EA 5IV2B 1U3HB 3ULUH 3RIAK 5IM7A 3BQUB 4X4XB 3O11B 4LP4A 4FTVB 5I71C 3TIDA 4LF3B 2VXTH 2GITB 4NHCL 3GHBL 5F71A 2FJFA 3GMLA 4YPJA 2WIIB 5I1KL 4L3EE 3S97C 4Y4HA 5DHVA 4K7PH 5D7KE 4QGTA 1RI8A 4D0CA 1R3KA 2R2HA 1RU9L 2V9QA 3RPKA 4LLMB 2NR6C 2OYPA 3VRJB 4WI7A 3GRWH 4LVHB 3GHBH 4NPYA 3LZFL 2HT2C 1JGDB 2DMBA 4MB3A 1JTTA 4PJHE 4ZO9A 5C0IA 1SEBB 3GGWA 4NBXB 3S5LB 1UWGL 5DQJB 5BQ7A 4HIXH 1JYVA 1XGTB 2XV6B 3ARBA 3B5TA 4KUCF 4O2CB 5FKAB 3RL1B 3JVGA 4X8JB 1YEGH 4AT6A 4N9GB 2PTUA 1IM9D 4X9IA 4B53A 2V2TA 2IPKB 5CILL 3PDDA 4M7LT 1XF4B 4HJGA 5D7IB 3SE4A 1DE4B 4TPRL 2X4UA 1UZ8B 1ACYH 3HUJA 5LGJB 2HVJA 1OPGL 2A6KA 2WINB 1F11B 1OB1B 1Q9OB 1FG9C 2QADD 5KG9A 2L7UA 3QJHB 4KHXH 3DIFB 1ZA6B 1ZT4A 1JFQL 3VFRA 3KNBB 5FA3B 3ZKXB 2IGFH 3GSQA 3RWIA 3U82B 4KZDH 3NA9L 5BW7A 5JZ7C 4J3XA 4LLUB 5T3XL 5B3JE 1MFDL 1T4KB 4PJDE 4OLWH 1U3ZA 5FYKU 2VR4A 2G60H 1H5BA 3G08A 4R4BA 1NBZA 3CK0H 4KJQC 3E6HB 1SEQH 2IBZX 1RZ8A 5GGTH 2EZ0D 5DUPH 3IFOB 3WMSA 2YUZA 3MACL 2C1OA 4NPYB 4LVNC 4RCAA 1VGKA 3E2HC 3T0XA 3VGGA 5E2VL 4GXUM 4F57H 1QD0A 4FQHA 3ALXA 4O5LL 4X6BA 4IOIA 1WBYA 1CXFA 1MCOH 3UJIH 5DJYB 4IIQA 5F6HI 4G9DA 4Y4KA 1U93A 1GH7A 2BNUB 3JUZA 4KK8D 5IGXH 4ONGH 5JIKA 1NMCB 3ZSTA 1ITBB 3F7QA 1J8HA 3MLZL 1UVQB 3I6KA 1G9ML 4DFIA 3ARPA 5H37H 1S78D 4OZHE 3TBYB 1RHHB 4QXTA 2HFGL 3H0TA 2X4QA 4PUBL 4C55A 3CVHA 1GIGL 3C5ZB 3KLAA 4QHUA 3VGEA 2AEWA 4E42A 3MLYL 3PXJA 1HH9A 1FNHA 1RUAL 4LSSH 5EBMB 1DQMH 4CJ0A 4F9PA 3GM8A 1MCWW 1SMOA 4HLZH 1ULVA 3L7FA 3E8UH 4MNGA 4K23L 4AJ0A 5FGBA 4MJ5A 5ESAB 4JANB 5I17A 3ZKSD 3NCYP 1SBSL 4N8CL 1FRGL 4X9BA 5FA4A 2C4FU 2ZCLL 1FAIH 4IJ3C 1I8IA 1AD9B 2ATPB 3QFJE 4LHUD 2LU4A 3MRCB 1DR9A 2OL3A 5D5MA 3MNVA 4ELKB 4W4OC 5C0AB 4TRPH 4R9HA 3EO0B 2F19L 1ZHLA 3U46B 2PW2B 3QUZC 5IVXA 2OLDA 2DTMH 2QJDA 2X4RA 1IKNC 2ZOKB 5EZLA 5F96H 5D6CB 1A7NH 3EBAA 3RTQB 5IHZA 4OZGA 5D7JA 4BM7A 5JXAL 2W9DL 5JZ7D 4M7JL 4J6RH 3D39E 2VXUH 4LDEB 2W0KA 4CU6A 5BZDB 4LAJH 1BFVH 2X4SA 4TVPE 4MA3A 4RFEB 5CJQL 3C08L 5JPMB 3A67H 3UJTL 1E4WL 2BXZA 1G7QA 4LMQE 4RDQG 1GOHA 4YWGH 3VXMD 5F1NB 3V79C 1FSKB 2F54B 3HB3D 4WW2F 1SJEA 4S1DD 3GNMH 3FAXA 3V8OA 2F58H 4H8WH 3GO1H 4QXGH 1EEZB 4GMTL 1RZ7H 4XP1L 1GGCL 3IETA 2QQNL 2VZSA 1KNOB 4UT6H 2WQ8A 3RWDA 4XPBL 4FNLH 4LIQH 5E4EB 1GJIA 4WTWA 4XPTL 5DJZA 3L7EB 4GKZA 2HT2D 3KJ6L 4HC1H 3PWNA 3EYFB 7FABH 3QQNA 4G8EB 3FCTB 3NZHH 2B4CC 1JL8A 1NBVH 4WY7L 1UXWB 1G84A 1U92B 3PV6A 4PG9A 3QDMA 3L3DB 4K8RL 3BD3A 1CGWA 1QA9B 1KXQE 3JSSA 3GSUB 4TSBL 2P8LA 2CIKA 1ED3B 3LIZH 4OSUH 2X1XR 4OLVH 4J12A 4S1SL 4LFHD 1IL1B 4GW1B 3C87A 2XQYK 2XTJD 1KLGB 1YC7A 3QDJA 2BNQA 3QO0B 5MENA 4JJHA 4A6YH 2GEEA 2I25N 4EVNA 1PKQB 4MAYD 4KPHL 5DJCB 1B0WA 1TFHA 2PYEB 5KAQG 4JZOA 3ULVE 2BVYA 3GMMB 3MJ8B 3IDNA 4R3SA 5FYLL 4I4WB 3JV5A 4PY7A 3BKJL 1S7SB 3QUMH 4KMQA 4QLRA 4NSKB 4FQXB 4Y1AE 2ZUTA 1LK3H 2APVA 2ED8A 4ZQKA 1BFOA 5D7JB 4UDTA 5CMAB 1U8HB 1R3LA 5J11C 4K8RH 1YPZB 1UZ6F 1XGRA 4WY7H 5HVHC 4MXQC 1S7TA 1VENA 2VDOL 3DOSA 4XC3H 1RZFH 4JR9L 3ZE1E 2J3SA 2FSEB 5D96B 4QTHA 4CN6A 1EO5A 4PRPE 3KLSA 1H3GA 4OFKA 1ZAGA 5L2JB 1IAKB 1NGYA 1T0NB 3QXAB 4L4JA 2A1WL 4XXDA 3A6BL 3C2AL 4V1DE 2ZKHH 3DHMA 2W0FA 4XMPH 3EOTL 4I0CC 4QHNA 4UU9B 1T89C 2DLHA 3HI5L 3RUGA 4PJAB 5ALCH 1OSPL 3SDDB 3DSFH 2K7PA 1I7UA 5HDLA 5H35A 1FP5A 4P3CH 1E4WH 5F9AC 3FN3A 4XC1L 3MUGB 5T5NF 3RVVC 1F4WL 4GKZB 5BVJB 3VXRA 3N1QC 3OAYK 1KTLA 1N3NA 2ADIA 2V7HB 3BT2H 3R06A 1UQSA 4M7ZC 2A6IA 3IETB 4XPFL 1NQBA 4XPBH 2ZZUT 4M8VA 3ARBC 1I1AC 2GJZA 2D7TL 3MV9D 3HNVH 4KJWC 3O8XD 1U8NB 4ODTH 5C0GA 5SWSA 1OAXL 4TSCL 2P42B 4RMQA 3NFSL 4BSWB 4F8QA 4G6ML 3EW3B 3V95A 4NUGH 2HTLD 5FYJU 3MLUL 3WFCL 5DHYB 3TPUA 4EI5A 1RJYA 1E4JA 1GOGA 3L1OL 3MLSH 3QUXC 3PIQB 4V2CB 3V6ZB 4GOSA 4KMTH 4LP5A 5CZVH 3DI2B 1QOKA 1D5MB 1S7QB 1QG3A 2X4NB 4H25A 3DBXB 2X40A 4JY6A 4NN7B 2DBJA 4XH2B 3RUGF 3IJHA 5D7JC 4ZSOA 1NDMA 3IAPA 4ELKA 1QFUH 3L95B 4XMLL 5EWIL 1FCCA 3CSYA 1HKLH 4JY5L 4HF5L 4KK9D 2FGWH 4HF5H 4BK5A 4TNWK 1X4XA 3C5JB 2QR0A 1GZPB 3LKNA 4HKJA 5C09D 3IRZA 2ED7A 4YFLF 4AL8H 4RGNC 3OXSA 1U8PA 4O9HH 5JW4R 1W0WB 3IVKB 1MPAL 2O5YL 1CFBA 4ODSH 4O2CA 4MA7L 1NAMB 3QFDB 5ICZA 1R3IL 4X6EA 1YJDH 5DD1H 1EO8L 2CK0L 4FOMA 5IUSA 2CD0A 5CKAA 5IVOA 1QR1B 1EEYB 1I3UA 3HMXL 4XVTH 2A74B 3C6LA 5C0RH 1R3HB 4D9RD 4XP4L 4UB0H 5D9SB 1A0QL 4MSWB 5ADOH 4L4VD 2R23A 3DXAA 4UT9L 5I75B 1UWEH 5T3ZL 5FXCH 4EI6A 1V3KA 3HNVL 3RWFA 1MI5B 4WU5A 4R96A 2AK1H 2GTZA 4PTUA 1VEPA 3UJIL 4PJGF 4Q9BA 2IH1B 2VABA 4LVEA 5EFIA 1KTDA 1BOYA 1L6ZA 3FT3B 1UENA 1UYWH 4NDMB 4E41E 1RUPL 3T3PF 1Q38A 1JZ6A 1WZ1H 3TO2A 5F8RC 4P48A 2VLRA 1SEQL 2FR4A 4KKAC 4WHTA 3TVMD 1FNSL 1B0RB 2VAAB 3OKOA 5F72S 1U95A 5C6TL 5T1KA 1CGSH 4PJEF 3N06B 5TH2B 3KPNB 3QEQA 4H1LH 1TZIB 5F9JB 1RK0A 1T03L 4P3DA 3NA9H 3WLWD 5T1DL 4BH7A 5JUEH 2X5PA 3C8HA 3WKNA 3HMWL 4KVNH 1CXKA 1JF1A 4QRTB 1C7TA 4YBQC 2VERN 3OG4B 5EOTA 4C83A 4GS7C 2CDEB 1NCTA 1XF5B 1P7QB 5E5MB 3DHJA 1UGNA 5JW3H 2YD2A 1U2HA 1OF2A 3BQUD 4JR9H 3HFMH 4Z7VE 1EHLL 3AU1A 5FKAA 4ZO7A 2MCG1 5IW1A 4OLYH 1AGFB 5BQ7B 1ES0B 3ARDA 1CFVH 3ELAT 3UP1A 4LCWB 1DSFL 5B39B 4Z7UA 5BO1L 3MA7B 1FDLL 2FO4A 1DQJB 1Q9KB 3STLB 3V0VB 3VXSA 1CFTB 4OZHB 5HGHB 1DFBH 4K3EH 4R0LC 3TPKA 1JZ3A 3LZFH 3KLHC 5FYJH 3OJVC 3D2UA 1MJUL 5T3XE 1WZLA 4FMKA 1I9RH 2YRPA 4APQA 4ZOBA 5TQ0H 3VI3F 4LCWD 2FIRT 4WO4D 4NRZA 5EPMA 1CL7I 3CFJA 4XNMA 3SE8L 5IJVA 4OM0L 3QIWB 1XCQB 5I8EB 2ARJA 1LD9B 3GSNB 1FNGA 3OKKA 1BQLH 5L7XH 4ZFFA 2QHRL 2X4TB 5ENWB 4ZUWA 1QNZL 2J1KA 5ANMB 5AYUH 1TIUA 4LBEB 5KVEL 2LVEA 4DKFL 4EI6B 3HLAB 3G5XA 5JOFB 4G6FD 4TVPL 1DQJA 1Q9KA 3VXSB 4JFDE 3IXTA 2C4XA 2AEPL 1OWRM 5B39A 3U36A 1KIRA 3QWRD 4HJ0D 1AP2B 2HJLA 2VXQL 3F58H 1VFBB 5EN2A 4G8IB 3WJLC 4XCFL 5TDOB 4JO3L 3C09B 1YEHH 3QAZB 3VFSA 1OAQH 1QFWM 2CLVB 4L4TB 1RV6X 4KROB 3RZCC 4NQCD 5I74C 3OAUL 3I9GH 1F3DJ 1HDMA 2NX5D 1G7LB 5TJWK 1J05B 2RCSH 3FO0H 5IMOB 1QLRB 3RPIB 2DLTA 1U58A 1IGMH 1IT9L 5E8PB 1S7UB 2MJWA 4LLQB 1OGTA 5I9QC 4J8RB 43C9B 3KYKH 3O6KH 4JG0L 3N0PB 3PGCA 4S11A 3IU4H 1YQ2A 3B9KD 5ALBH 2VDKH 3WO4C 1QYGL 4OLZH 4A2MA 1A7PH 5I1CL 4YBHA 1S5IH 3EHBD 4F2MA 5C6WH 1V7MH 2GY7B 3EFFA 5EC1A 5CEZH 1PKQE 4G9FA 1ORQB 4HLZG 2XICA 4LLYA 1ZXQA 4OCYL 5J1SC 5AAMA 3D25B 1MCHA 1A6WL 1KLUB 4JO1L 2IFGA 5BRZA 4PG2C 1T7YA 5HYSB 2AJSH 4MXVE 4Q9QL 4OF0A 4L8DA 1PKOA 2NY4D 1FORL 4DKEL 5MERA 2DQGH 1ZLSH 4QF1B 4DUVA 1UB6A 1LQSR 1M71B 3H2WA 4LSTL 1BMGA 4Q74A 2VLME 3TH4T 4U1HB 3TC9A 1EEYA 2Z31C 5SWZE 1CFQA 1QQDB 1RVFH 4HS8H 4POUB 3TBVB 3V7AG 5GS0C 6FABL 3C60D 1ND0B 4KI5C 1QBML 2JJTC 5FUCE 2FBJH 2NPLX 3BO8A 2W9EH 3WNKA 4WHDA 5D1ZB 5GS0L 4PGBA 5J57B 4PP1C 3DUSB 3LMJL 3V4VH 3QRGL 4HS8L 1KBGH 3VXUE 4OF5A 5J1AA 4WFFD 1HI6B 4EN3A 2V5RA 3H3PL 3BD5A 1SQ2N 3CVHH 1T5WB 1AKJB 5FFLA 1TPXC 4MQXC 4U1MA 1DQTA 1JGEB 1FORH 3QUYC 4CVUA 3NCCB 4Y8DC 2BSSB 1OARH 3PWPA 1I8LA 4DWHA 4JY6B 3MRGA 3VW3H 3OKLA 4UU9A 5GGQL 4CNIB 5T3ZE 4JREB 3HE6D 5E94A 1YEIL 4WW1B 4JFFE 4JG0H 1W0VB 1HINL 4HWBH 1KV3A 4YHIB 5ADPL 1JGLH 1BVKB 5GZND 4P2QD 2D2OA 3FOMB 1JYXA 4NCC1 3NMEA 1PJ9A 2EDYA 3D39B 1I7RA 1IT9H 3BKCH 3RZWA 4RMWA 1QHPA 1JK8A 4KK8C 1A6UL 4L4TA 2DJSA 2X70A 5C0EA 3EO1A 4PJ5E 1T1XB 3QDME 2YOCA 4RX4A 4NOBA 1LO0L 5E2UH 3RDTC 5KS9F 3JXAA 2HLFD 2P47B 4XB7A 4M03A 2GSGA 3GMQB 2VZ1A 3ESVF 2NQCA 4GRWF 4J3VA 4GH7B 3BKYH 3IDIA 1TVDA 2NTFB 4Z77B 2AVGA 2KKQA 4HUXB 4OUUA 4HG4J 1RIHH 3LKSB 2R29H 2W0PA 3DETD 4YX2L 3QIWD 3VXRB 3D6GA 3IGAA 1BVLA 1WITA 1FHGA 1K2DA 2NY5H 4ODHH 3VXQA 1IM9B 3FZUD 4YDVA 4M5ZH 4DQOL 2ARJQ 5JOPD 1XCQA 3L3GA 1T3FB 1GGUA 3MLWL 4W4NA 2B0SL 2V2WB 2Q8AH 2AXJA 2J2ZA 1J1XL 1KJVB 2R0ZH 3C9NB 1AI1H 2FZ3B 4HSQA 1QHOA 2P8LB 2PN5A 1N6UA 5C8JB 1LMKA 2XTJE 3BKMH 4P23B 4OZGE 2H41A 2V7NB 3SKMA 3CXDH 1DSFH 3G6JE 4PG9B 2PYED 5ESVB 1J1OL 2JCCE 2FSEA 1E28B 1J12A 5JLZA 4IDJH 1AGFA 4PLOB 3QWOB 2J4WH 1BGXL 2X9WA 4LHUG 4ODUB 2QV2A 4IBLT 5D5ME 1EJ6A 4JFYA 5DK0B 1OAUH 5EIIA 3IS0X 5CUSL 1U3HD 2B1HL 2XYCA 3CFDB 4TUJB 4Z7QF 3RIFF 2HFEB 4NSKA 1EFXB 1X9QA 3MRJB 1RIVL 5EUOF 5I1LA 2FEDC 1WC7B 1WF5A 2QKIB 3FTGB 4Z7UF 5FYKL 4PJXA 3JTSB 3GMMA 1WC7A 2QKIA 5T1KB 1G1CA 4RFEA 1T22B 2XA8H 4Q6IA 2X4SB 3MXWH 3JZ7A 3QB7C 4DZ8B 3QHZL 1DBML 2IFFH 5DD3L 2R9HD 3SO3B 3EO9L 3F7VB 1AD0A 1P4IL 4FQQA 3TZVD 5I0ZA 3X14B 1L7TL 1VPOL 1NCNA 4PJ7A 2YPKB 1E28A 3BP4B 5HGBA 4KGLA 1RUPH 2CIKB 1HEZA 4M61A 4Y1AD 2DICA 5FGCE 3VWJA 3RWEB 5A16A 2IANA 4P46B 1PAMA 3SKMB 2FL5A 1UXSB 3DX7B 4WEMB 3QXDA 2UWEA 1OAZH 3KVQA 5C2BL 4R7DA 4UMGA 3RVXC 4AENA 5HJ3A 1QRND 3PWNB 1KPRB 1XF1A 2YWZA 4LSVH 1MCNA 4RAUA 1L0XA 5DMKA 1C1EL 2ZNXA 4RMUA 1KIPA 2ADJB 4JKLA 4KI1A 1BPVA 3GMNA 1R5WA 3OKEB 3AXLB 5IR1A 2YC1A 2AKRB 2VZUA 2VC2H 2F54A 3EYQD 4LNRA 3BJLA 2X89A 1CE6B 4LSRL 2ED9A 4FFZL 2XPGA 4Z7QE 5EU3A 5IFAL 1LE5B 3PWPE 1A14H 1DUYB 2BNUA 4MQTB 4G9DB 2VUOA 4JFZL 1CGYA 1A7BA 1I7ZA 4Y4KB 4QRPE 3S96B 2BMKA 3O3UN 3LKRB 1UB5A 5FF6A 2Y07L 4G8FA 1QFUL 4LKXA 5I8OL 4KVCL 5CJOH 4UNTA 1RJYB 3B6SB 3BYYA 5EUOE 3TBSA 2YK1L 1WBZB 3MRCA 3NN8B 2X1OA 5IIEB 3TO4C 3Q6GL 1MHHB 4L3EA 2BVPB 1F97A 4M4RA 3W0WE 3QG6A 5FUOH 3N9GL 4ODXB 1NDGA 1QKZL 4ZS6D 1I1AA 2FB4H 3P4OA 4MJ5B 5ESAA 1Q9OA 4JVUA 5FECA 2J8OA 2GJZB 1NUNB 5LGJA 3H9SE 4S10A 4Y16B 3FO2A 5GZNC 1T83C 4YZFE 1NGQL 3TN0B 2AGJL 5C08A 1WAAE 3UC0H 5FYLD 4HPOH 4CADB 4DOHE 5TE6H 2P8PA 4JVPA 4X4ME 3TN0A 3I3EA 3BWUC 3NPZB 3QO1B 3B83A 3SGJC 2ZUXA 1TJHL 4U1JA 4ZYKA 2VQ1B 2ICES 4BKLB 2J8UE 3NFNB 4ONFL 5F93C 1NGPH 3NCFB 5GJTL 1S7VA 1TQBC 4FABL 4P2OA 4XBGA 4NWUH 3O41A 2Y4SA 2BCKB 1KGCD 4QHNB 2L7JA 2XWTA 5F89B 2R2BB 3RIFK 5JIHA 3RNQB 3UPCA 1CG9A 1K4CB 5SWZB 1VFOA 1N5AA 3P30H 5DEFB 4MMZC 4HD9A 4YAQB 3GSOA 1Q9WB 4K2UL 4L8SB 2BDNH 4U1KA 4CADA 3C6SA 1XGRB 4JHWH 2IADB 2AJZA 3G9AB 4X98A 4JAMB 3R8QA 1ZLVK 1FH5H 2AXHA 4KK6D 2YD5A 5D71L 1S9YA 3QJHA 3MROB 4ZUSA 4FS0A 2HFFB 2DLIA 2D7MA 5IB3A 3ME0A 4EUPG 2X4UB 1AQKH 5F3HA 2JIXA 3MYZA 3WN5A 1CDHA 2ADGA 1CD1B 2H6PA 3HG1D 3NIGE 3T4YB 1EIBA 4P57B 2Z93A 4B50A 3MA9L 4FFWD 2EKJA 3MFGB 1NFIA 4GO6B 3RAJL 4YHML 2Q7NA 4MJIA 1MRCL 2PXYB 4WV1B 1NFDA 2DI8A 4PRAB 4LKXB 1MCLA 4NFBA 2YD8A 3S6CA 2VH5L 1T20A 3U36B 3CMOH 2R2EB 1BWWA 3VWJC 5T5FH 4DW2L 1FE8L 4IRJA 1S9XB 4MVBC 5A16B 3TYGL 12E8H 3C2SA 1DVFB 3FFCD 1K4DA 3VXSE 2WBJA 3IDYB 3T08A 4NM8H 5TF1L 3BMWA 3OB0K 3O2VH 2NXYC 5FOBA 5LXGL 3ULVH 4P23C 1F6AA 4X8XA 4F37K 2CKBL 5EU7E 3OWEA 3F7VA 4GFTB 4TUKH 5D7LB 4H8WL 1EEZA 4XCCH 5F44A 4HV8B 3H3BC 4YHYC 2HKFL 1JGLL 4PJFB 2G9HB 1XFPA 1I8MB 4TULL 1HINH 4QRPB 1KPRA 4ZOAA 3GBML 1YMHA 3VWJD 5T3ZD 2O93L 5KSAC 2EDDA 2EDRA 2E9BA 1TVBB 3VW3L 2DLEA 1AXSA 5GJTH 3DX7A 5JDSB 1ZHKB 1KCVH 3ZYZA 3CVHL 4GW4B 4WENB 4JM2B 1ES0A 3LY6A 3GIZH 1CDIA 1JWMA 2BZDA 1TITA 4OZFB 2Z92B 4PJCA 4PJ5D 4KV5F 3WS3B 5E7FA 2Z92A 2B20A 4X7TA 1RIUH 5L88L 1F02I 5ADPH 3BZ4B 1BQHB 1JF1B 5IT2L 4LSPL 3WO4B 1JRHL 1FYTE 4J3OC 3EDEA 4TUOB 2R8SH 1G7MB 4JZJA 25C8L 3VE0B 5J12C 2E5EA 1CYGA 3DYPA 3VXOB 5DMYA 1CBVH 4G7YL 4QOKE 4RGMC 4LOUC 3KPRB 3OGCA 3CLFL 2Y36H 1NAML 2ZCLH 5DC0A 1HOCB 4DVBA 4WJ5B 3KPRE 4P49A 1AGBB 3HZYA 5C9KA 2X2YA 4WHCA 2Q8BL 2F19H 2EDTA 3SDCC 4LRIA 2BRQA 1CFSB 1GPOH 3MV01 2EDBA 1NEUA 3QWOA 1JPFB 1EHNA 4U4BA 5K9QG 3ZTNL 1P2CB 3H7LA 2ESVE 1EO7A 4NRYB 3CVIL 1YNLH 3JUYA 3WYRA 4PJ9A 2AK4A 4MMXC 1T7XA 2D31A 3A0OA 5MEOA 1VESA 1G7PA 1RJLA 4IIQB 1R24A 3U4BH 4X9GA 4F57L 3SCMC 1D5IH 4AH2B 3SY0A 4FG6C 5BV7C 4WEBL 3DVGA 4WNQA 1H3XA 3RRQA 3FO0L 1HQ4A 4S0TD 3PP3H 4XWOD 3MV11 1EPFA 1NBZB 1G7HA 5HGAA 3QEQD 5J9PB 5DD3H 5CEZL 3T3MF 3L3JB 3QHZH 4U7MA 5LBSH 1YN7B 5SWQB 5IP4A 1IKFL 3BGFB 1RZJH 4GUPA 2N56A 2BSSA 2AQ1A 2ZJSH 3O3DA 2V2XB 3F62A 5FYKH 1AKJA 4EIZC 9CGTA 3G5YB 3F5WB 3MV8E 3MROA 5F8QC 5F6HJ 1CLZL 3RIAF 1A6ZB 2OZ4L 1CQKA 5I18L 1UT9A 1F4AA 3BZFA 4LU5L 5TE4L 3S4SG 4D3CL 1QLEH 1F42A 1EZVY 4XZUB 1F8TL 2C3WA 1MNUL 1GGBL 1IGCH 4JN2B 3WNPA 1XH3A 3LEXB 4XVSH 5DQJA 3MRDB 2NTSP 2PF6A 2WANA 4OCLC 4OIIH 4S2SB 5GHWH 2IFFL 1OM3H 3T8XB 3U9PL 3VXRE 1A7RH 4K55A 5IEKB 4NO5B 4A2LA 4Y2OA 5HVHB 5DC4B 1JZ7A 5K9KB 1BBDH 2YKLL 3WL9A 3PGFH 4O58L 3BJ91 4HIHB 4Z7WA 3CDFA 3SHSA 4I3SH 3G04B 2LU3A 4Z7NF 4ZPTB 3WFEL 3IDXL 2C7UB 3HC3H 3V4UH 1WT5C 2B1HH 2ARWA 4GSDL 4YO0B 4C58B 5IF0A 5JW4N 4Z7WF 1BBDL 5J1AB 3F7RA 2A6IB 2OCFD 1UQSB 4M5ZL 2DLGA 1JNLH 3QRFM 2ADFH 1BGXH 4P9HH 4ETQB 4XRCB 4PRPA 4RWYH 4Z7OF 4JFPB 3P73A 3E3QC 3GRWL 1I9IL 4PJBF 1A8JH 2XNAA 4I3SL 3THML 2NY6C 3W0WB 5F9DC 3MNZB 4LHQB 5I76B 1NAKL 1I7UB 3CFBA 5EZOL 4ZPTA 3HA0A 3KYAA 1BJMA 4WWKC 2EICA 2BVOB 1OGTB 1PX4A 4LLQA 2Y6SC 4I5BB 3QG6B 1I75A 1UB6B 5AZEH 3FQXB 4A6YB 3PL6A 5HHMD 3KS0H 3MLWH 1ZT7A 2X4PB 4O58H 1CI5A 2ITDB 5B3NA 2DQFA 4NUJA 4F3FA 3QNZA 2P8MB 1FG2B 3ZSSA 1EHLH 3VGAB 1NBYB 1ETZA 1ORQA 2WLYA 2BY0A 4Z7WE 4G9FB 1YPZA 4HEME 4M4PA 1GGBH 1KOAA 1OW0C 5FK9B 3LKOA 3LEYL 1FVCB 1Q0YH 2WWKT 4NN5C 5CD5D 1S7RB 2AK1L 5HDBF 1HHKA 3W39A 3SO3C 3IDGA 5GGSY 2PCPB 2CXGA 4RBPH 3JBG7 3O3DB 5E2UL 1U6AH 4H20L 4R7NB 35C8H 3OKMB 1KJ2B 4P59L 5D6DA 3X11B 2GK0A 2CKBB 3MRFB 4YHPA 4PJIA 4JPKL 1FNSH 3UBXB 5I8KH 2ESVB 3V6BR 5IMOA 3KPOA 1JHKH 2NY5C 3SJVD 3AAZB 3QA3A 4U6HB 4U6VH 4HK0A 3GSNA 5AZ2H 2PTVA 4FFVD 3BN9D 4EVNB 1JHTB 3VCLB 2WUBH 4QXWA 4TVPD 2P5ED 1FZMB 2CIIB 3U1SH 4YH6A 2DL2A 1NMBL 5BS0A 5JR1H 3VXUD 2HTKC 1EA9C 4LSTH 1WGOA 5BZWB 2VDPL 2W59A 4JFED 2ID5A 4EQ2A 3QDMB 1Z5LA 4AEFA 5BZWA 4Y2DD 2FO4B 5C0BB 3O81A 5D8JL 1U8LB 1D9KD 1JRHH 4HGMA 3FRUB 4H8WC 3SDAD 3IJYA 3PF2A 4NHUA 1FZMA 2CIIA 2XZCL 3SCMD 2W9EL 4MLSA 3QUXA 4NQCE 3K4AA 4UBDD 4JM2F 3O6LH 1U36A 1F3RB 3PWPD 5F7HA 1P7KA 5HY9A 4LEOA 3EYVB 1U8KB 2FECL 1T22A 3S34H 4LPTA 2R0LL 2Y36L 1JWSA 3OKNB 3O3BB 4EN3C 1RD6A 2AEQL 2D4FA 3LN4A 4X6FB 3P4NB 1RFDH 4YHNA 4TSCH 4PB0L 3ARRA 4NQEB 4MD5A 5MEQB 2DL9A 3QEHB 2DM3A 4JZJC 4LLWA 4LARL 2W65A 1MIEH 3MODL 4AK1A 4C56D 2FJHA 1V7NH 4NN5B 1CICC 3ARDB 3L5HA 5EC2B 3PHQB 3CSPA 2P5EB 3E6FA 1LGVA 2X4RB 2ZOKA 1LILA 2WQRA 3O3AA 4KAQH 3BMVA 3MXVL 4GQ9H 5FGCB 1YEHL 1ZHLB 5J7CC 3S3SA 3QNZB 4ZFGL 4ZUUA 3O45B 3FT2A 1MLCA 1HN1A 2A83B 3BVNB 1C5DA 2OL3B 4D9LH 3OR7B 3WJJC 4JM2D 1HXMA 3V6FB 4HS3B 1JP5A 4QHLA 3UTTD 4NNPL 2FZ3A 43CAB 4BA8A 4CUCA 3S7GA 1CS6A 2OI9C 4JHAL 3RKDC 3SDXE 3RX7A 3CMOL 2GHWB 2YD1A 2I26N 4JFOB 4FQIL 3R0NA 2FR4B 1OVZA 4P4KC 4WHYH 2DWEA 5JQ6L 2WUCH 1Y18B 3KXFA 5D93B 5CHNA 1VKXB 4XGZA 2AJVL 2CKNA 3RAJH 3SQBA 4ODWA 5EFIB 4S1QL 4M7LL 5GS0D 3LN5A 4TSAL 1BEYH 4JQVC 2QR0B 2NCMA 4M6NL 3TEUA 4DKFH 1W72L 4OJFL 4WW2C 5IEHB 2EXWC 3HE6C 3PJSA 1U91B 1P4LB 4JN1L 5BO1H 5C0JB 4U2YA 1IEAB 4C4KT 1LO2H 2CK2A 2NZIA 1IVLA 3VJ6B 3F7PC 1B2WH 3WIHL 4YNYB 4PRAA 5F7LB 2WK2A 2L4OA 3K81A 5IEKA 4JFFD 4MXVF 5DGRA 4N0YL 5I0DA 5D1XD 1PVHA 5JXEC 3LEXA 3MA9H 3VRLF 3QAZC 4XNZC 4LPUA 1NCAH 4RWHA 3ARED 1WTGT 2F53D 3T04D 4JFQB 1BZQK 3PL6B 4YUEH 4JRWA 4BSWA 4NYLA 5DJ6B 5DWUH 5CWSB 3OKLB 4Z95H 1OP3K 3HNSH 3IJSB 4GW5A 4EDXA 1OHQA 2CDGB 4XB8A 3PNWB 1CE1H 3T2OA 2WINA 1QBBA 3DGCR 3TZVA 4TVSa 1BEYL 1BWMA 2NY7L 5KSAD 4HWUA 1H3VA 1F3DH 1I1FB 2Z31D 4L4TE 4LGPB 4NN7C 2AXGA 3QZWB 4XH2A 3RWCB 4S1QH 5I9QB 3V52H 1YZZA 5DC9B 4FABH 3SGKC 3U83A 1N3NB 2ADIB 3JV6B 4L1DA 2VJXA 3L3JA 3MREA 4HZLA 5CBEA 2EH8L 2NY4C 1MVUB 1EXUB 4WFHE 1UH3A 1L4IA 1P6FA 3ISWA 4FNLL 4YO0A 3ZDXF 5A3ID 3UX9B 2C3XA 1A6VL 4HPOL 1RZ7L 4DUWA 5IHLB 3RNQA 1F4YL 5C09E 5CSZB 4UT9H 1NGZB 5IB4B 4PJAA 4G80A 3HC4H 1GL4B 4NCC2 5L8JB 1F2QA 4Y4HB 5DHVB 1G7PB 4P2OB 5JA9A 2EH7H 2Q76A 2SEBA 4LMQI 4J6RL 4NKIL 4IM8A 4OF7A 1P2CA 1MELA 4QXUH 1OL0A 3BXNA 3LD8C 3G5VA 2VLKD 5I6XB 3OKYA 1RULL 4NCDA 1YNKL 2DQIL 3JWOC 3QUYA 5EU6B 3AVEA 1NC4A 2V5SA 3ULVC 2OZ4A 4S1RL 4WO4C 1DBKH 4Y88A 4PTTA 1OT2A 4W68A 1W72B 3CZJA 3G5YA 3Q5OA 3U9UB 3DURA 4OCMC 4Q9CA 2X7LB 4JG1L 1JIBA 4X6DF 1SM3H 1AFVH 4JFZH 4JQXC 3LS4L 4ODXA 5M7QA 1W0YT 2YZ8A 3DXAD 4BSJA 4U1SA 5HGDB 3QT2A 5FHAH 3EOYG 1JUFA 1KN4H 3IDJB 5TGBA 1YEJH 2W9DH 5L2JA 1CK0L 3ES6B 1CK0H 2FX8H 2FHFA 4KHTL 1A1NB 1AO7D 1OT1A 1MCIA 5F70A 3VFTB 5MI0C 3D48R 4K3HA 1KN4L 2DI7A 3G9VA 4G6KH 4KVCH 3NBNA 5EZIH 1QLFB 1BFTA 5I8OH 1VACA 5GSRB 4UAOB 4PJCB 2K1MA 4JFEB 2H9GA 4TRPL 3SGEH 3ZL4H 2X4OA 3IXTB 3VFWB 3TBWA 4LKCA 5GGRB 4KDVA 3BE1L 4ZUVB 4KXZI 3P11H 1TZHB 2ZSVA 5EZIL 3T0ED 4JFXB 1FFOB 3KHQA 3PABA 2DQIH 5D2LA 1BBJB 1B90A 3NAAL 3E8UL 4QWWD 1QRNE 4JZOB 3KLHD 3X3FH 1R5WB 2ESVD 1ZVYA 1F4WH 4P2OD 4OV5B 4Y4HD 2ZUQB 5C0NC 1N4XL 5A2FA 2P5WD 1A3LL 1GIGH 2WLZA 3MTRA 2JB6A 1LEKB 1W8OA 5JQHC 4LPCA 4HPYH 1J0KA 2J88H 3MC0A 2MTPA 5T3XD 3HC4L 4H20H 5IBTL 3CXHJ 1JGVH 3LB6D 5LKNA 1DBMH 4U3XA 1ZK9A 3QI9D 3OL2A 5HI3D 4L9DA 3HI5H 4I48B 4KZDL 5JPMA 2PTTA 1UM6H 4YXHH 1CL7H 3VMOA 1PSKH 1QTYT 1PLGL 5IMKA 1IGTB 4F33B 2FEEI 3TH2T 1AQDB 4QRPD 5HTSA 4WW2B 4YK4B 2AK4E 1U8IA 2IPUG 2MWCA 3T4AA 5DUPL 3QBTB 4ZMAT 4LPYA 4K71C 3WNOA 5DD0L 2OJEA 1NFIB 3FB8A 2UWEE 1WCBB 4Q6YA 3SDCA 1UH2A 2IANE 4KQ3H 4ELMA 4NIKB 1R0AH 3C5SA 3VFPA 2CUIA 5B4MC 1J5OH 3ZO0A 1EGJA 1J1OH 3TJHD 3HZKB 3W0WD 4D0DB 1FNEA 3NTCH 2H2PC 2F5BH 3MJ7B 4DTGL 4I0PA 2P7TB 1NEZB 4J4PD 4Y0GA 3HI6L 1WZMA 3DARA 1RZFL 5E1AB 2ICWJ 2X9YA 4MJ2A 4L9LC 4RQQB 5CIPH 2CXKA 5FYLE 4JN1H 3P9LB 1FAKT 3K4DA 1YEFL 5KSAB 3LDBB 1M6OA 2HN7A 3IDXH 1LP9F 5JIPA 2VNCA 4PJCE 5BJTB 1MWAL 3MUZ1 4MJ6B 4PS4L 5CIPB 4XNQA 1NSNH 5BVPH 1QFWH 5DRWB 4HH9A 2GIYA 4R4FH 4KQ4L 2D7NA 5LG1A 1A7OH 1YYML 5CSZA 4UQ2B 2AV1A 1OTTC 3H9YA 5DRZB 3ABZA 4MJIB 2ENYA 5DO2D 2EDWA 3SKNA 1XF2B 1UACL 2VQ1A 1GZQA 5KS9A 3RNKB 2DDQH 1GGYA 3MOBH 3OZ9H 4AEHL 1EAPA 1YN6B 4P57A 2CDFA 1JN6A 4OCWL 4ONHA 3ARZA 4Y7MA 4TNVK 4D3CH 2OR7A 1PG7L 2E6JA 3HZVA 5I19H 5DUBB 3WDIA 2EKSB 4Q2ZA 3DV6B 3KJ4B 1CGUA 4J4PC 4NO0B 1G1YA 2ZG2A 3INUH 5DK3A 5SWZD 1QO3A 2F15A 3N85H 1QSEE 1L7IL 5HGGS 2YSSA 1OB1A 4ODBD 4GAGH 1NLDH 3QIBD 3HE7A 3NCJL 2B5IB 5E03A 1HCVA 1RZJL 2MHAA 2IQ9L 1Q72H 5LBSL 3G6DL 4RISL 3ARDD 4GXUN 1HE7A 4UINH 1X5HA 4QOKD 1MHHA 2EC9T 1J8KA 4HWBL 3O8XC 3OTTA 1V7NL 1YY9D 3RGVD 4FQ1H 1XIWB 3MUY1 4YAQA 5DZNA 3D9AL 3ARBD 5DEFA 3FOMA 4WEUD 3Q2CA 3V2AR 3NCMA 1HHJA 1D5IL 4BQ8A 1MHCB 2MFNA 2R2BA 2AEQH 2RR3A 4CNIA 2YBRB 3PWPB 1FRGH 1AGDB 1BECA 4XAWH 3X3GL 1QFOA 2EXYD 1JWSB 1HHIA 3MRNA 4ZFOL 2R4SH 1CGXA 2BC4B 4N0UB 1HSAA 1KBGL 5LGHL 3VFOA 4JO2L 5HY9B 2IPUK 2XQBL 1GAFL 1PYWB 1KENH 1AY1L 4BQ9A 5D7IA 4WI4A 1XF4A 1IQWH 5C0CE 2DTML 3NOIA 4NKOA 4UDUA 1MCWM 3MR9B 2MPAH 3TV3H 5GS1A 4Y2DB 2OR9L 4PGBB 1E4KC 3QDMD 4Y4HC 1RVFL 4YDIL 5SV4A 1JF6A 2R1YA 4PB0H 2DYPB 3IAQA 2QSQA 4ERSL 2FJGA 5C0BA 4X7FC 1FAIL 2F5AH 3RVWD 4QY8B 2XQBH 32C2A 1CFQB 3BISA 4RAHA 5EH1A 1I1CA 4BSVB 2Z8WC 2VUYA 2MQ3A 3MRRA 2BNQD 4KDWA 5MEND 3I75B 5GJSH 1QPXA 1TZGL 3OR7A 2I60H 1QBLL 2BP3A 3ORJA 1NJ9A 1X5JA 2P5EE 3KPQA 3VXNB 4Q0XL 3B6SA 5I30L 5BRZB 2IQAA 1JI2A 4MCZA 2R69L 4U1LB 5L8LB 2MKLC 4Z8FL 1S7TB 4QRSB 5I1EL 4PREB 4N1EA 2PXYC 4WV1C 3CFEB 5IV2A 2GAZB 2FX9H 35C8L 4QT5A 3H7BB 3QFJD 4XCEA 3QXWA 3BW9A 1KCLA 3IKCA 5E1AA 3KYOA 1INEL 5I1GL 4FQXA 1IAOB 1G7JB 3MJ7A 3PXHA 3RGVB 5KVDL 2M8XA 2NXYD 4FXGB 4JCLA 5CSGA 5E95B 2H8PA 3TGXA 4QRRD 1I8KB 3L5IA 1S7RA 3STZB 3MJ8A 3O6KL 4PJXB 4R3SB 4AG4H 3O3BA 4TULH 4Z18A 5E6ID 2DQTL 3EDKA 3C5ZC 1QLRA 3RPIA 3UZEA 3EHBC 3UTSA 1VFMA 3LAFA 3FO9A 4XI5C 4ZFZA 3CK0L 2RCSL 4L5FL 2YEZB 5D4QA 1HNFA 4QKXB 1Z9MA 2Z35A 4NO0D 1P69B 1LVEA 1IKNA 4W6YB 3S3JA 4ODUA 2CRZA 3T4AB 1JPGA 3JVGC 5DEGB 3WO3B 1VFBA 1QBAA 5EN2B 1C16A 5GRVL 4D8PB 1ED3A 4KV5E 4P99A 4ZXBD 2PR4H 3WJLA 1OAKL 2HKHH 4GRLB 2FL5B 2MQ0A 4PJEB 1MJUH 3EZ8A 4HCRA 1NC2A 3MRLA 3BP4A 2EDFA 2DQEL 3GUTA 4PRNB 4WTZG 4I18A 5INDB 3OGOE 1FDLH 1KCRL 3SE8H 2R1XA 3GMOB 1ROWA 3DX6A 3ILPB 1UWGH 1XMWA 1ZVHA 1LD9A 4JKMA 3AAZA 3MRBA 2IJ0C 3HI6H 1YUHA 1HSAB 3V0WH 5K9QI 2DM7A 2GK0B 3DGGB 3PABB 4K7PL 4M1CC 3FB6A 1DQLH 3B9KC 4L3CA 1KYOJ 1MJ8H 3CZFA 1EV2E 4TNVF 4NJ9L 4I18B 5INDA 4IRJC 3ZDYF 2RQ8A 5J13C 5DA0B 3FKUS 4JFYB 4PJDB 3ARFB 5I66A 3OKDA 4O2EA 5GRUL 1CFVL 2X70B 3RKDD 1G6RH 1J11A 1QVOA 4S0SD 5DRNA 4ZUTB 5CKGA 3T77B 2VAJA 3P30L 3VFTA 1M7XA 1J9CT 4K3GA 2DQHL 2P49B 2ICWI 1AIFA 1MCBA 5DI8B 1OY3B 3VXRD 1BFSA 4NQSA 2ITDA 3HC0A 1KXTB 2VLJD 2YD3A 4FQCL 1R3JB 1VHPA 1G0DA 3KG5A 5D2NC 3D3VD 4U1SB 5HGDA 3RHWF 3ZKQD 2EE3A 4OZFG 5ISZD 1DDHA 1J5OL 1S9KC 1FZJA 3DURB 4MA8L 1E27A 4K94C 2J88L 2D9CA 1MLBA 1C12B 3JTTA 3ZKND 2DQCH 1MQKH 1A4KB 4HX1A 1N4XH 5D1QB 2FRGP 3SKNB 3MRHB 2HG5B 3UC0L 2DQTH 2BY1A 4QHUB 1OD9A 1J88A 1BX2A 5DD1L 5FO8B 1EZVX 1G7JA 3DYMA 3ILQC 3BHBB 3B3IA 3U4BL 4XXCC 4P4KD 4EDWH 3DX8A 4F58H 4HWZB 1PFCA 4G7VL 3FQNB 1G9MC 1IC7H 3QZWG 3S3PA 1KCSH 4L3ED 3GI9L 4GQPH 3TVMC 2QBWA 4NKDB 8CGTA 4UIMA 3VD9A 1U93B 1JGVL 2P48B 1UWEL 3RVWC 4RAVB 1FL3A 4MCZB 2IC2A 5D9SA 2UZYB 3WDHA 1I1YA 2YN3A 4OLXL 1ZVSA 4U1NA 4GJTB 5C0EB 3B9EA 1DEDA 4IOSD 1YECL 3O6FB 4PYHA 4W4OA 2WWMC 4UTAL 1XT5A 3WKMH 1GSMA 2CK0H 1HILA 3H42H 3JTTB 4DGVH 4Q7DA 5C0CA 4YHIA 3BRFA 4JLRA 3E1F1 2KZWA 5IVZB 5D1ZC 2WV3A 3ROLA 5DURB 2YN5A 3WIIH 3MRKB 3HCVA 3WFDH 1FSKC 3TBTB 5L2KB 5KJRH 1AO7B 4MD4B 5KG9B 3GMPA 1T5WA 3VRIB 1N0LA 4I2XB 4JPVL 1DVFC 5IB5B 5KN5A 4GRMB 3W9EA 3T77A 4AEIL 4HLJA 4PJGE 1AQDA 3VH8B 4LRNH 3BP7A 4ZPVA 4PJDA 2VWEE 4KK9C 3KR3H 2KQMA 2GFBA 2UUDK 5C2UB 4F15B 1JGDA 3RY6C 25C8H 1WTLA 1WLHA 3VRJA 1MFEL 4F9LA 4LLMA 2R8SL 2ATKA 3SY0B 1A4JB 2Z4QA 1IEAA 2HVKB 4P46D 2QSCH 1AP2A 2E9WA 3CH1B 4D0CB 3NFSH 1YMHB 2I07B 5FM4A 1OAZL 4HK3N 2GY5A 2H45A 2OMBA 5H2BA 1T7ZA 3P4LA 3BSZH 1AR1C 4I18C 2YXMA 3TYFA 1WZKA 1KIQA 2CKBH 4S1RH 1RZGB 2JJWA 3ROOB 2FECI 3O2VL 4HWZA 5HHVH 4D9RE 5LXGH 3ULVL 3GJFB 3KYMA 1KEML 5AUMB 3B3IB 4PJ5B 4NM8L 5FM8A 5TF1H 5D2LE 5IVNA 3KPPA 4XP5H 3OJMB 5JPNB 4U33A 1B3JA 4IMLA 2GT9B 1UJTA 5GSVB 4X7EC 3GBMH 1CTNA 1D6VL 4OCRL 3UMTA 1U8MB 3LEVL 4GKSB 1YEDB 2YD9A 1N0XL 3V6OA 4FQ2H 1LO4H 3VXSD 3VXPB 3VE0A 4G6FB 2DBLH 2G5BA 4L9LA 1MCKA 4NGHL 3VFVB 4Q6IC 5D7LD 3CC5B 3STLA 2F53A 2Y1VA 3VGFA 4MHHG 4E0RB 4LCWA 2DS4A 5BV7L 3RY6A 1D5XB 3AU1B 3MOAH 2VWEC 5DUMH 4LL9A 2VDOH 4KPHH 4ELMF 1F4XH 3IFNH 3M17A 4N0UE 4JRYA 4LLVB 4UOW0 4F7EA 3OKDB 4FXLA 5E8EB 3IFPA 3K4ZA 1F6LL 3QEUA 4ZUSB 1WFNA 3MOAL 4RQQA 2NY3C 3SBWC 1JF5A 1MJJB 1KB5B 3DWTA 2LAGB 1KSRA 4PPTA 3ZTJH 3G6JF 1Z9OA 5F1SA 5INCB 3MRBB 4PREA 4YHYB 5K9OA 2GJJA 1JNHB 1T1ZA 2FX7H 4HC1L 5KVGL 1FVDA 4E9LA 5J6HB 3L5JA 2GI7A 4LIQL 3FT3A 2VKXA 4GMSL 1MH5A 3MCKB 2E7MA 4WI2A 4XCNA 5GIRA 1JPSL 3SGDH 2XZZA 3NGBB 1JE6A 3WUWB 4CMHC 3GO1L 3SKJL 4O02L 2DKSA 2BVTA 4MXWH 4LASH 5F7WC 3DRTB 3PV6B 4APQD 3QUKA 4J3SA 4X5WB 2RFXA 5DLML 3BUYB 3QQ3B 4PRIB 1V3MA 1X44A 3DVNA 3TVMB 2DBLL 3VFNA 4U6TA 3WS6C 4LSQH 4URTB 5B8CA 3CUPB 4AMKH 2IG2H 3WUWA 4PJDF 4MXQD 4OZIA 3FO9B 2NNAB 4ZFZB 3GSVA 2JELH 3MODH 3PQYA 4RZCA 2QSCL 1IGYB 4XPHH 3ULVD 3BDBA 4QRRE 1AJ7H 1QKZH 4JHAH 1UCTA 1T0MA 1ZA3B 1NPUA 1SJEB 5J6HA 4QGYA 4PB9L 1INQB 3SQOH 3WN5B 5D6DC 3JWDH 1JNHA 1T1ZB 3GSXA 4PJIE 5IMMA 3RDTD 3ARYA 4HULB 4ONOA 1KEMH 2CLZA 2VITA 1XCTB 3MOQA 2ICWB 4P0DA 4N8VB 1FFOA 5D1ZD 4XPGL 5CGYD 5B3JF 1IC5H 1V3LA 3H7BA 5EU4A 1ACZA 5IOPA 2WP3T 1PZ5B 4MAYC 2IH1A 4LPWA 5E8EA 3BP5A 5D8JH 1CICB 4HFWA 1MFEH 1ERNA 5IFAH 3BI9X 1K4CA 2AERT 4LLDB 3SCMB 3Q6GH 3I6LE 3T65B 4OZ4A 2NY1D 1QZ1A 1FO0A 4JPWL 4LPXA 2J6EA 3P2TA 5IW6B 5IMMB 3H42L 3LKPB 4DJMA 1YNTA 3CDYA 3WKML 4NM4H 3RL2B 1TCRA 1JTPA 1TQCC 5A43C 4RFNC 1X7QB 2J12B 5DJ0A 4GAJH 3O4OC 3MJ9A 4F8TA 1Y6KR 2DYPA 2WUBL 5TPWH 4LSVL 3BIKA 5HVFB 3R06B 2N4IA 3PGDA 4HBQA 1EH9A 5KSVB 4G3YH 5SX5K 3K8KA 4MB4A 3NIFF 3VD5A 3TWCH 5IW6A 1FFNB 4Q97A 3O6FD 5F97E 5HHOB 1KYOK 4OF8A 3ZT7A 3CFCL 4ZDHA 4NT6A 1IGIL 2P1YA 4PJ8C 4N0RA 4O51A 2KDGA 5DJYA 3B43A 3VGDA 1MFAH 1Q9LB 1NMAL 2RAMA 3GHEH 2ZCHH 2YPLA 5GGTL 1FNLA 2MKWA 4HJ0C 4HJJH 3DXAE 2BSED 3P9LA 4Z5RA 4O5LH 4L8CA 4PJ8D 5AZ2L 4HUUB 4RMSA 1KN2H 2JE8A 2Z4QB 5DHYA 3TPUB 2VLKE 4RNRB 2PYFA 3MMEB 3U0PB 2JB5L 4WUKH 5DK2A 3GEWB 4M48H 2M1KA 2FLBT 2MCPH 4UDTB 2BMKB 1EFXD 2D7QA 1K5NB 1MY7A 1I7ZB 3QH3A 3DUUA 4FFYL 2VL5B 5GPRA 3U48A 4F7CA 5ID0B 1F11A 1MCRA 4WUUA 2FHCA 1CVSC 2EZ0C 4KI5D 1YQVH 5DJDB 2EC8A 4M7KH 1FO0H 3P0VH 1WCBA 4P5TC 3FOLB 3KDMA 1QFWI 4HIXL 2QADB 4UTBH 5JXED 4LVOB 4NQDD 4N9GA 5HI4D 1Z9SA 3FRUA 4OFPA 4MD4A 3FMGL 1P9MA 2VZTA 5TQ2L 3MRKA 4KMLB 3BUYA 3FO1A 3QQ3A 3B2UD 8FABA 4PV8A 5JW4M 4J3UA 5FUZL 1CDBA 3NH7L 4XTRC 5BS0E 2ZWLT 3MGAA 4HW6A 4OGYL 3C9NA 1CD0A 5I1HH 4HEPG 1RJLB 4XCNB 5GRJH 1NCAL 5CLWA 2HRPL 5DDHA 5DVKA 4P2YA 5HHPA 4OQTL 1IAKA 2XFXA 1ADQH 4GLRI 1NGYB 1A1OA 1T0NA 1T3FA 5IHUL 2J4WL 2EE2A 2HN7B 2C26A 3PJSB 3SEPA 3FFCE 3KXFE 3GSRA 1B2WL 5DD6A 5FCSH 3WIHH 2ESVA 4HXAL 1JWUA 3MUHL 2LVCA 3LKSA 4NWTH 1BD2E 5AUMA 2HRPH 4Y5XB 3RWGA 1BFOB 3ZTJG 5DJXB 3G5ZA 3IDIB 4LCIL 4NQEE 4C59B 1KT2A 1KPVB 3T0DA 4DVBB 1T1YB 1PG7X 3IDGB 1JNNL 1J0HA 3HAEG 3NH7H 5L9DL 4FN0A 3ZDZE 2KH2B 3JTSA 4AM0A 5FUZH 1WIPA 2DWEB 2MOVA 1WISA 2AJ3B 1BD2B 1WSST 5ANME 2X9XA 4ESKA 1S3KL 1VACB 4H0HB 4XHQA 2PYEA 5GSRA 3UPAA 5CJBA 1P9MC 2Y72A 3AMLA 4F7PB 1HHGB 1D9KA 4OGXH 4OGZA 3REWA 1U3JA 1MNUH 5A2LH 1GHFL 4LIQE 5SV3A 1S9VA 4U6YA 2JCCF 1TDQA 2OL3H 3R1GH 3QUZB 4I5BA 4RIRA 5I15L 3PWVB 3U2SB 5ACLA 3DMMB 1X5IA 4H26B 4D9LL 5E6IB 1T6WA 4M48L 5D1QC 5DFVC 4O2EB 4PR5B 2DF3A 5EO1A 1A3QA 4QCIB 2OXGA 1KJVA 1LEIA 1U8QB 2BNRB 3BPCA 3TM6A 2DMCA 5TPWL 3RHWK 1KEGL 1AGCA 1P84K 4C56A 1XGQA 4KKBC 5ECJE 2EIEA 3QFJB 2FNBA 3WSQL 5CD5C 4X0KB 1ND0A 1FLRL 4AIXA 1TQCB 2NY0C 1P7HL 4RZCB 1YEKH 4U1HA 4OM1L 2NNAA 3UZVB 3L3HB 4PBXA 1TMCB 2HVKA 1CICD 5HVGB 1FLRH 4K3JH 3OQ3B 4L29A 3GRWA 3OSKA 4NHUB 1KELL 3IJYB 1KPUA 2GSGB 4FXKA 4NZTH 1UADC 3FQUB 4IMKC 5A40E 3QULB 4ZO8A 1FQ9C 3NCEB 1RZKC 3BDYL 3BDYH 3QUKB 2ZSWA 4U0QB 5L88H 4NQXB 4PGDA 4GLRH 2UZIH 4MDJA 5GS2D 1JZ8A 3JV6A 3B9KB 2V6HA 1NFDE 1RZ8B 1RZKH 1OSZB 4QRRA 3L6FB 4M6MH 3PQYE 4I2XA 1BZ9B 5JW4Q 3CLFH 4HMCA 1H9VA 4WW1A 2YRZA 2Z35B 4YXLH 2X89D 3UYRL 3HCVB 3VU2A 5CJXA 1D5ZB 1JPTL 4GUPB 1ZLWH 2IPTH 4HK0B 4P5TA 1Q0XL 3KPMA 3DPBA 2NX5B 1A9BA 4BZ2H 4UQ3A 3U9UA 4YDKH 1DBAL 1NUGA 4KROD 2DD8H 4YXKL 2BFVH 1KLFA 1A3RH 3ULUC 1UZ8A 5K59E 5T1LD 3EYQC 4U6VL 2VOTA 2CMRL 2EE6A 1OSZA 2VSDA 3VD4A 5F88B 2H3NA 4CN1A 4K94L 3HHRB 4MGXA 3CXHK 1DQQA 3C5ZA 3KLAB 2Q6WA 4ZXBA 2PCPA 4QRUB 1NLDL 4XAWL 1XGTA 3ARBB 3X3GH 4WWKA 5GISH 3RJQB 1QUNA 1DEEB 3SDDD 5L9DH 3GGWB 3S5LA 3G6DH 3TA3B 4QT5B 4WFEE 3PWUA 4XCEB 4X4YB 3M17B 4PRIE 2DLFL 4KJYB 1CG9B 3G5XB 3CZFB 1YY8A 4XP6H 5B22A 4PJ9B 3GBLA 3FB6B 1I1AD 1UC6A 4FQ1L 3PHOB 3O41B 3SE9H 4X80L 4HGWB 1DVFD 3H3KA 2QQKL 3GJEB 3V9FA 2Q86B 4KY1L 4NNYA 5E8NA 5DQ9A 1NBQA 3NFNA 3SDDC 4NN6B 1SYSA 3GSNH 1YYMH 2EDNA 1C12A 5IM7B 1H5BB 3G08B 2DAVA 1ZEAL 2VDQH 3P9MB 4K3DH 2VZ3A 5IB2B 3ULUD 3D1MC 2XNAB 3MV7D 2NMSA 1T0PB 1PG7H 3SKJH 2D4DA 5KVEH 2E3VA 1QFWL 4HG4K 4OZHA 5DXWA 3U7WH 4PS4H 5DI8A 2XRAH 5DQDL 3DYOA 5H37G 4XP9L 2EDHA 3I3DA 1CD8A 2CPCA 2EC9U 4PJAF 4JY4A 4F9PC 1YEFH 5MHSD 1CDCA 1JPST 2Q86A 3T09A 1JTOA 2PUQT 3PHQA 2VLJA 1JWMB 3MCLL 4OZIF 2BVQB 2IBBA 4I1NB 2FJHB 4J1UB 4TYUA 5GRJL 2AXFA 3FB5B 4G42B 4N68A 3NGBC 5ISZA 1DN2A 1HIMH 4NZJA 2ZNWA 1NC4D 3ILQD 4U3HA 4KKLD 4XWGL 4FQ2L 4PJBB 2AV7B 3RVVD 3BEVB 3KPNA 1N5YH 4BK4A 5DD0H 2B2XH 1U8KA 3ZKNC 1MCPL 5DT1L 1OLLA 1OQOA 2FJFB 1CVRA 4HV8A 3V6OC 5DUML 2H3NB 5ERWB 1AO7E 5C7XL 2YUVA 3IB4A 5DJ8A 1T2JA 5DMGD 1RUKL 4ETYA 1U8JB 2VIRA 3DTXA 5TE4H 5J6GB 2EYTB 2YUXA 3K7UA 3RWHB 1AO7A 2AS5M 5ITBL 4L4VB 4IS6A 1IGFL 5T3ZH 1WIOA 1LHZA 3W81A 3F8UB 4ONHB 1PSKL 1AXTL 1WK0A 2EIZA 4NOFA 2MNUA 4NWUL 4JKKA 5BOZG 1GGIH 4PJHF 1RJCA 2FDBP 2J7LA 2OTUA 1ORSA 4HGWA 3VXMA 2B39A 3OF6A 1A9EA 1NKOA 4PJ8B 2IF7A 4Y5YA 3KPOB 1Z0NA 3EYOA 3MLPA 4LHUB 2GKIA 2DIJA 4YK4C 5EC2A 5FAAA 4JPWH 3U0WL 1JHLH 4EUPH 1W2KT 5DD5L 4JDTH 4U0RB 5I2IA 4HH8A 3PUCA 1VCAA 3SGDI 1PQZB 4G3YL 2JCCB 5KJRL 5GRYA 4PJCF 3B2UC 3W39B 1BOGA 1LO5B 3QI9A 5F88A 4P3DB 1NDMB 5F9JA 1FYTA 2XG5A 5CJXC 4P2QA 4MQXD 2AK4D 3VG9B 1XGQB 2VXSH 1OGAA 4E41B 5CLTA 3ZDXE 2H32H 2H1PH 4GAJL 5HYJA 2Q8BH 3OGCB 4ODSL 2PYFB 3MMEA 1A9BB 3BPLC 3WE6A 4ZS7H 4QCIA 3FB5A 4DEPB 4BFIA 4F3FB 2Z91B 1NKRA 3Q1SL 2X1WL 3CLEH 1N5AB 3GM0A 4ZD3H 4JZJB 3KPQB 3DI3B 2FX8L 1R3JA 4LHJB 1CTOA 1FBIL 2YD7A 3QNYA 4PP2B 4Z5RB 5E2TH 1QEWA 1G9NH 3FT4B 3TNNB 3SDCD 4WU5B 1ZLWK 4CGTA 5I1JL 3GBNL 2DMKA 3B5HA 4QYOA 4QHMA 3TNMA 2MHAB 2AABL 2OP4L 3P77B 2HMIC 1RUQH 3U6RB 3D3VA 4QY8A 3DXAB 3G6JA 5C2BH 4NO3B 5C8JA 4WW2A 2Z8RA 1JHLL 1QO3B 5CD3B 1IJ9A 2VC2L 3MLSL 3W2DL 1ZHKA 5E08L 4UTAH 1GGIL 4Z76B 5BMFL 1MI5E 3WFCH 1OWWA 3NIFE 4ETQA 1YNKH 1C7SA 2EH7L 1RUKH 5DYOB 2VDLH 3H9SA 1C1EH 2DIBA 3ZLQC 3VWKB 2FH6A 4NKIH 3HPJB 2UY6A 5H35B 2BOBA 3VFOB 4MS8D 3X13B 1JMZA 3AS0A 2Z0BA 3KGRA 1U41A 4CBPA 2XA8L 4YGAB 4KHXL 2YBRA 4YE4H 1WQVT 2ZPKL 4YFLI 2IG2L 1I7TB 4OZHF 4NZDA 4R2GC 4XNQB 3GMQA 4XXDB 1LEIB 3GSRB 5DD6B 2Y5TA 1MJ7H 1XGUA 3T8XA 5GQBA 4DGYL 4XC1H 2HH0H 4PR5A 3ARFD 2CRIA 1CIUA 1YEGL 1B4JL 1M05A 5LQBL 4QRUA 1T04B 1WBXA 4XZUA 5DMJB 3C09C 2X4OB 5M94B 5HYFA 1PW3A 4JB9L 1OSPH 5CGMA 5GZOC 4PRPD 3RJDA 1T7WA 2EYSB 4QTIL 5T5FL 4DW2H 5ID1B 1RU9H 2MQCA 1VA9A 2VXVH 3PWJA 3UROR 3K2UL 4NQDE 1U8NA 1MFCH 1D5BA 4FTVD 5IR1B 5EZJB 1BHGA 3O6FC 4YHMH 1C5BH 3OJDA 1D5BB 3MNZA 4KDTA 4DOHB 4IRSB 1TJIL 1MFBH 4MB5A 4FZ8L 4PJ9C 2L0DA 4RAUB 4RSVA 3AREB 3P73B 3VXUA 5C0DB 3DVGB 2GSIB 4N1HB 5ID1A 3LRSA 2EYSA 3K74B 4EI5D 3SDXF 5EORL 5KW9H 2R56L 1FNAA 4JKPL 1LO2L 3NABH 4UV4L 3LHPH 3GSUA 2YR3A 2BHYA 4XPAL 3QUYB 3DV4B 3CDGA 4KKCC 2E6QA 4NRXB 4KKAD 4P5KB 1BF8A 2G5RA 3QDJD 3O0RH 4PRHB 3ARDC 3WFBL 1QACA 1X5XA 3OPZL 1M7DA 1IC1A 4LVOC 1KCRH 4X0KA 3MJ9L 5D7LE 2YPLB 4JJ5A 3FQRA 4QXGL 1ZSDB 3IKKA 2DQEH 1NGZA 1I1RA 3D25A 4M5YH 3S88H 32C2B 1HQRB 1UJ3A 4LVHC 4LCWE 3SJVA 4NRXA 2BFVL 1A7QL 5HSFA 4OCRH 4UIKH 2HKHL 2LE9A 1NGXA 5D2LB 3VWKA 3U0TA 2OQJA 2EXYC 5J06A 1CD9B 3NZHL 3RZCB 5E8OA 2O5XL 3LRSB 5BZDA 1EDQA 3LRHA 3TBWB 2ZCKL 3V6OE 4N8VG 2FGZA 3SDYL 4WVRA 1AGEA 3H3PH 2H9GB 3PL6C 4WTZA 1T21A 5AYQA 1HWGB 4M00A 2DJ4A 5E8PA 4RMVA 2YA0A 1S9VB 2HJKB 1HCFX 2UZIL 4OZFA 3BSZL 4EQ3A 5JLZB 4QYOB 3TNMB 1LO3L 1AGDA 1WFUA 4UNUA 4YIQB 2I60L 1ZANH 4JQIL 4GT7A 2FBJL 3S4SA 2G5BB 4L9LB 1BFVL 1NGWB 2IPTL 4Z0BH 1J86A 4YXLL 2NYYD 1SVZA 3RI5F 4R2GB 5D7IE 1C5CH 5E9DA 5DVLA 1ZLSL 4O2FB 2FX9L 3H8NA 1MIEL 4X6DB 3FCTA 1MCEA 1Q9LA 3LMJH 3V4VL 5IJKC 1SYVB 3GB7A 4DUXA 3M45A 1I85A 3VXTA 2B8OT 2CR6A 1BVLB 3IGAB 2W60A 4GRLC 2WBJB 1C5CL 3WUWG 4ENEC 4JRXA 3BESR 2EDOA 1VB9A 2EIBA 3GKZA 1N26A 3KPTA 4D94A 4G43B 4K23H 5FGSA 3Q6FB 1IM3B 2BNRD 3A6OA 5EIVA 3BOVA 2QSTA 5EOCL 5KSUA 1G7QB 1GZQB 5KS9B 5IB4A 4NQTA 1VFUA 4FQHB 1JZ2A 3MACH 5IWLC 5SX4H 2FLRT 3D5OF 2VN7A 4GRWB 3TH3T 1EGJL 5IBLD 1NFDB 3R1GL 1CFTA 2E8ZA 1IGML 1UH4A 1BQHA 3WSQH 3IT8D 5JIIA 1O5DT 2ZUYA 4PJXF 4OGXL 5E5UB 1AR1D 4Z7UE 1JYNA 4X7TB 3F12B 2UYLA 3I9GL 3SKOA 5CIPA 3S36L 3QUXD 3CDCA 3ZE2E 2X44D 4IRZL 5L2KE 3FT2B 1AH1A 5IB5A 3RWIB 4PV9A 2PO6D 5HGBB 4MNQD 3W5MA 1Q0YL 2JIXD 2CGRL 3KPSD 4QRTA 3IU4L 3FFDA 4ZOEA 3J7HA 1A7QH 3PNWA 4M62H 1LNUA 4NBZB 3RZCA 3DETC 2OBGA 4JKWA 3MBXH 4P4KB 1AD0B 3PWLB 1CZ8H 4PJBE 5JO5B 1MUJA 1B0GB 1NCBL 2XZAL 4OLEA 1U42A 1L7TH 1T5XB 2DJUA 3VFMB 3NZ8A 5DZLA 1RSFA 4AEHH 5D1QD 5DFVD 2NY6D 5L7XL 4ENED 2G2RA 4DCQB 5HDQH 1SJHB 1HH9B 4NJ9H 4PJBA 1INQA 2APTA 1I4FA 4PLJC 2IQ9H 3QEUB 2JCCA 3GI8H 2OX5A 4KZEH 5ISZB 3VRLE 1VGEH 4LLAA 4D9QD 4PTUB 4Y4FC 3UAJC 5EO9A 5BVPL 4PV9B 3GDBA 3F65A 2BVQA 4TVPH 3RWFB 2BVEA 1J8HB 5J13B 3BWAB 3DVNB 4IHOB 3DO3A 1FL6A 4NO2B 4RWYL 1F90L 3L5XH 4HKBB 4BQCA 2ADFL 2ILLA 2RFXB 2P43B 1WFOA 3BPLB 3DRTA 4K7FA 3HPLA 3GJFK 4FQLH 3WFHA 4XBEL 5AZEL 4U3CA 3VFVA 3OMZA 3EFFB 3BIKB 2OK0L 4ISVB 1A4KA 3B8SA 1IAIL 5FYKE 4DZBB 3Q0HA 5IB2A 4OM0H 4QNPE 3MUJA 4ZTOL 2F5BL 2EIZB 1FV1A 1L0YA 4KQ4H 4F7TA 4GG6B 1NSNL 3WHE1 5E5RB 1MRFH 1QSEB 1YNTB 2C9AA 4LLUA 1DL7L 3WFEH 1B6UA 2VISA 1IM9A 3UPRB 5CWSA 2LABA 4OIIL 2AEIT 1R0AL 4G8GE 3PWJB 2B0SH 2VE6B 4OT1L 5C6TH 4UTBL 2GCYA 4PJ5A 3EZJB 4HKZA 4M43H 2A83A 2DQDL 2VKWA 5HDBE 3AS2A 3L5XL 1KB5A 4Z78A 3BDXA 4ZG1A 3QISA 5C1MB 1QVOB 2CLVA 3DUHA 3QXTA 4XTRD 4LKCB 1IFHH 3VFWA 1WWAX 2NX5E 4CDGC 5EU4B 1PLGH 4EBQH 4HUNB 1U91A 2WWMD 3CFIC 2ZPKH 2D7OA 4ORZC 2Y5TB 2XZQH 1MFAL 1X3DA 2KQNA 3GI8L 5I75C 2HT4D 4OFVA 3SDXB 1INDH 4R4ND 1DZBA 4X6FA 4E0RA 1CGSL 3BP7B 4ZPVB 1FFPB 4LBEA 2N7BA 1MI5D 1GYAA 4XMKL 3WS6A 5F3BA 5I6XC 3AFLA 2XZAH 1DTUA 5JORA 4PP1D 3VMPA 1LP9A 4HXBL 3MBXL 3VXPA 2QSVA 4GRMA 4U1JB 5KN5B 4DVRH 4X5LA 3W2DH 4V1DB 2ARJB 3O4LD 3ILPA 5EB9A 3N1MC 4HJJL 3CX5J 4LCUB 4M1CD 5AD0A 3GHEL 4WCYL 1MPAH 4QHLB 1CXEA 4QRRB 1DN0A 5CP7A 1O0VA 3ET9F 1KC5L 2NXYB 4NO3A 3ZDYE 4Y19D 3N1FC 4WU7A 1UJ3C 4GBXB 4GXVH 4IDLA 4FRWA 3KYMB 4XP4H 4WI9A 1G7IB 5I1EH 3EOAB 4MA1C 5HHME 3BH8A 1YNLL 4Z7VA 3ARGA 3QHFL 1FC2D 2MPAL 3RY4A 3TV3L 3RTQC 4PJ7B 5IIEA 5E99H 2E7CA 1EO8H 1GPOL 1R3IH 5E5MA 5FO7B 5BRZD 1I1YB 3QCVH 1GAFH 1IC5L 3O9WA 1H3PL 1QBMH 5GJSL 2XG4A 4P5TD 1PY9A 1FGVL 3EJYC 4D2NA 4Q6IB 4MD5B 3P11L 4DKAA 2VR5A 3CDGB 5F7DB 1OGAB 3C8DA 3B4NA 4AL8L 5IT2H 4J23A 2FGWL 1OQXA 2X1QA 4R2GD 4HAGA 1S7SA 4YDIH 3C60C 4C57C 3MBEC 3QDGB 3MLVL 4NZUH 3BW9B 3OX8A 1MLBB 4LHUA 4JRYB 4AMKL 1OGAE 1Y6NR 5D7SH 3FB7B 3TBTA 5L2KA 3U2SA 1UWXK 3V5DB 3NCJH 4LCCB 4Y5YC 4YDJA 2EXWD 4U6YB 3B2VH 1JI1A 3QDJE 4JFDA 3QHTC 3EYUH 1BZ9A 4JDZA 4QHKI 4MNQA 2NY2D 4M5YL 1I3GH 2CO6B 2OXHA 3TT3L 1IEBA 1VEMA 4HCRL 4XPHL 3SOBL 4YPGA 5T33L 1Y0LB 3RWEA 4AH2A 4GKNB 1XIWD 2YZ1A 3EUUA 5M95B 3DO7B 1DBBL 2O5XH 1O7VA 1Z6JT 2K7QA 3LN9A 4ZNCD 1IEHA 5LVEA 4CN4A 1EEQA 1NFDF 4FQQB 1DLFH 4LAQL 4OD1L 1CLOH 1W0WA 2GJ6A 5D2NA 3X11A 4QRQA 1FJ1B 4UV4H 4ZAKC 1BM3L 1G9EA 1BX2B 2R56H 1U8OA 2FWOB 4XCYB 3HNSL 3L95A 2FX7L 5KVGH 5IROA 3VXTB 4Z95L 3FFCB 5DHXB 1F3JA 1V8HA 1E6OH 1D9KC 5CEZD 1MFBL 4X6DA 5GGVY 4OIBA 4X7DC 5IJVB 3GMOA 5D72H 1N64H 1FZJB 1IEBB 4H5SA 3GUTB 4OI9A 4KC3B 3JV4A 3TYGH 2C5DC 3LQAL 4EI5B 2RJMA 3CGTA 1QP1A 4XPAH 3P77A 2I5YH 3GKWL 3Q3GB 2VXVL 4PY8I 2VN4A 3NABL 3BVNA 4MAYA 3BZ4A 3WHE0 4I3RH 2DQUL 3MRGB 5IVXE 3PQYD 4ZUUB 3FO1B 3EO0A 1F4XL 3WLWC 3BN9C 1MEXL 3FQTA 4MAYB 4OLVL 5FKPA 5C70A 4XT1C 3O2DH 3ZHKA 4R0LA 4M93B 4KTYA 3CFBB 2WP3O 3UTTE 2VLJE 3MGOA 3I84A 2YEZA 1B4JH 5IMLA 4RRPG 3RWJA 3UYOD 4MYWB 5DJDA 4JM4L 3VFGL 4RGMB 4E41A 3MUGA 5D72L 4HIJB 2AJ3A 5D1ZA 3P4NA 3K2UH 1WUNT 4YE4L 4QOKA 4UT6L 3WIHA 2XY2A 3HMWH 1E6OL 4KVNL 4MD0A 4KK5C 2AJXL 2C7UA 1J1PH 5KOVC 1URLA 3I6LD 3RGVA 2JJSA 1PQZA 4Y2DC 2VTFA 4OJFH 3LIZL 5DHVH 1IE5A 2DQJH 3EKCA 5D7LA 3PHOA 4AY0A 5AG9A 3O9WB 4XP5L 2LTQB 3OF6D 3W9DB 5B38A 5GISL 1JWUB 1KTDB 4K2UH 4KJYA 4ZS6C 3R8BB 2R4RL 3M1BA 4PRNA 1J8HE 1NBVL 4QRSA 3PWUB 1NANH 2P4AB 2A0LD 4R96B 1AHWB 2JJUA 4MNHB 1NC2B 3SGJA 3UTQA 5C3LD 5IFHH 3DX8B 4WWKB 2GTWB 1DLHB 3CFKB 1SY6H 4BFEA 4ZDHB 2YUWA 2QQNH 3MRHA 2KZ1B 1OOAA 3UBXI 3IYLW 4Y1AA 1I8LC 3GFUA 1E0OB 5KZCD 4RGND 5DEGA 2APWA 5FUOL 1QR1A 3PGDB 3TN0D 4XVUD 4KU1A 2VB5A 4JGUA 3QWQB 5JW5A 4PV8B 1DUZA 3UJTH 4TQEL 3GSQB 4M6ML 5ICZB 2R0LH 3WFDL 2RIKA 1NAMA 4ZFGH 1F13A 5JORB 4ZFOB 4OFYD 3IVKA 4KHTH 1SVCP 1G7HB 3SDCB 2CKBA 4FA8A 4WRLA 4DGVL 3GSWA 1BLNB 5FHAL 3TT1L 4NZTL 4LLDA 3MX0A 4G6JL 2RGSA 4D9QE 5FO9A 4KWUA 1WWWX 1TCMA 3WIIL 2ORBL 4ZSOB 1G9NL 3U30C 1R24B 2I9TB 5FK9A 1BQSA 4OLXH 3FQUA 4XVUC 1IAMA 1QRNA 1FZKB 2IAMA 4OM1H 4NKQB 4OFDA 3MLZH 2AK4B 1NL0H 1BJ1H 4L3CB 5IGXL 2R2HB 4MJIE 1NFKA 1J0YA 4KTEH 2E9IA 4CL7A 1RULH 4XNXL 3QCVL 1MCSA 1KEGH 2UWEF 2V5YA 4FQJH 4YHZH 5LWYH 1FNGB 4I0PC 3U4EB 4OBRA 1BZ7B 5C0GB 5I8EA 1YECH 4PJ7F 4XMKH 4U6XB 4G8GB 3W11D 1IILE 4AIZA 4YHLL 1IGYA 5EC1B 4MA8H 4HKXB 1T80A 1FFNA 1QSFD 1AHWC 4JFXA 5E7BA 2F8VA 5JMOC 1KTLB 3UO1H 4Y19B 2X41A 5GS1B 5BVJA 3HZMA 1YN6A 3MA7A 1P4IH 4V1DA 5EU6D 2EH8H 7CGTA 3BAEH 4HKBA 3MO1A 1RURL 5IFHL 2E27L 3KHOA 4GKOA 4IHOA 4R26H 2C1PA 1U58B 2QQLL 5LAXA 4FTVE 3BWAA 3HI1B 2XT1B 1VPOH 3PDOA 1MCPH 1NC2D 3MRNB 1NCWL 4OAWB 4OTXL 1BJ8A 4JM2A 1Z0MA 2KPNA 4HIHA 2NY7H 3VWKC 4Z7WB 2BNRE 1E4XI 1MHPL 3IFLH 4KTDL 4XAKE 1BAFL 3SCMA 2PKDA 3UTPE 2WM0A 2YXFA 2ADGB 4M1GH 1RK0B 2COQA 2XZQL 5HYJE 5K9OB 2CR3A 2FYYB 3C2AH 3WE6B 1T1YA 4UI2A 3L7FB 2A9NH 4I9WD 1HKFA 1RIVH 1UB5B 1YMME 2C3GA 3QXUA 2OK0H 5C7XH 5CEYA 1FYTB 1NC4B 1BOGB 1LO5A 5ANMA 5FDYA 3TIEB 1MCDA 2XRAL 5DQDH 2DQDH 1HSBA 2XPGB 2VABB 1GCFA 3BGMB 2X42A 4KKBD 2A6DA 2D3VA 1HZHH 3RA7L 3VH8G 2NW2A 4FQPA 4M3JA 1KB5L 3I6KB 3VXNA 2OTWB 5DDHB 3AXLA 4O4YL 1FZOA 3BP6A 2R2EA 3QG7H 3OXRA 3PQYB 2AI0H 2J6EH 3L6FA 4KKCD 3PGFL 4N0CC 1QFHA 2NY0B 2NY3B 3S37X 4GW1A 4IDJL 3U9PH 3ARXA 3AGVA 4YEFA 2BY2A 4XVSL 4X7SH 1P1ZB 4FQIH 4P9HL 5EA0H 4X6EB 5JHLH 4JFFB 1RUML 5EG6C 5MEOB 1N59B 1MOEA 3MREB 1EMTH 2OTWA 3OHXA 4L29B 3EJZD 4M02A 1WICA 1OF2B 1IMHC 3QCUL 2EIDA 1U8PB 4P2RD 1CT8B 5TDNB 3QZWA 5I8CA 2QHLA 2JIXB 3L3OB 4Y16A 5J6GA 5FB8B 3L7EA 2YKLH 3OAYH 3QXVA 1I4FB 1A6UH 3I6GA 2JB5H 5DJ8B 1I1AB 2CDGA 3P4OB 4HIIA 3LKQB 3ROOA 1OTSC 5GGSA 2WUCL 4H25B 1NEZA 1LO0H 1KIQB 4TTDC 4AT6B 4XPTH 3WNMA 2AJZB 4O2FA 2EDQA 4ZNEA 1NCDH 3RL1A 3DX9A 3MJGX 4K7PY 3QQ9C 2Z8VC 5C07D 2HMID 3VFUB 1F8TH 5JO5A 4LARH 4JHZA 3TT3H 5GGQH 4OI7A 1QSFB 3U7YL 5ISZE 2I27N 1I3RA 4IRJD 3B2VL 2D9QB 2NY2B 1TZGH 2W07A 5ICYB 3S96A 2QL1A 3LCYA 5TE7H 1D3CA 3EOBA 3HR5B 1TJGH 4KJQD 3WNNA 3KPSB 4M7JH 3QQ9D 1S7VB 2WBJD 4PJ7E 2PO6B 2IBGA 3U46A 1MRDL 5DR5H 2CLRA 4PRDB 5ESVA 4NZUL 4JDVA 3HZVB 5DMIH 4M8QA