2AJVH

Crystal structure of cocaine catalytic antibody 7a1 fab' in complex with cocaine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
EVKLSESGPGLVKPSQSLSLTCTVTGYSITTNYAWTWIRQFPGNKLEWMGYIRSSVITRYNPSLKSRISITQDTSKNQFFLQLNSVTTEDTATYYCARYDYYGNTGDYWGQGTSVTVSSAKTTPPSVYPLAPGTAALKSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody 7A1 Fab'
publication title Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
total genus 41
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajvH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajvH01
3PJSB 5EU6A 3T4YB 3V5DB 5HHXH 1FZKB 2EIZA 4KI5F 3RZCB 4P3WA 5IB3A 3ECBA 4RNRB 4G6FD 1DQML 3NIDF 1U8QA 5TDOB 3FQWA 3KPPA 4P2RA 4JHAL 1KIPB 1DVFD 2CPCA 3MNZB 2ATKB 4YNYB 4KVNH 3T0EC 3UYRH 4PJ9A 1A7OH 4PR5B 2VDML 1M1SA 1RULL 3ZE1E 1E6OH 5DVOA 5B8CA 3QAZB 2E6PA 5E6IC 3MRNA 2HVJB 5ICXB 1YPZF 2EE9A 2YKLL 3GI8H 3RIFF 3HLAB 1MELA 5J7CC 3HRPA 4X80L 3HG1E 3QJFA 4PLOB 1G0XA 4F33A 4U3HA 4LVOB 1H0DB 4GH7B 3QQ9D 5EFIB 2WNGA 4IDLA 3SKMB 4YUEL 4M93C 3G6JA 4KDTA 3UTPD 4FQQB 5IHBA 1AXTH 1P4LA 1KC5L 1OCWH 3IDYC 3LQZA 1WIOA 1NCNA 2APTA 3RBSA 3QIUA 4DW2L 4FNLH 3G9AB 4QRRB 4CW1B 1Q9LB 4PGEA 4O2FA 1DUZA 2OP4L 1CLYL 1DL7H 2C3HA 2HKFL 5A3ID 5BXFB 2AP2A 2JLLA 2FYYA 3T09A 4GBXD 4M1CC 4GG8A 4PJEB 4M7KH 1EBPA 5DEZA 2WP3O 1EAPA 2J6EL 1GL4B 3HPJB 4UB0H 5EBMA 5F9AC 3RKDC 4FQXA 5DT1L 4WW2B 4CN4A 5CEYA 4L5FH 3TESA 2C1PA 3I9GH 5D7LD 3ZSSA 2JK5A 1MFAH 5A2LH 3PNWA 2FL5B 3P4OB 3V52H 4XVTH 1PW3A 1QKZL 3K1DA 4GAJH 5EZLB 2XXMB 4DCQA 4TNWF 1TQCB 1EUUA 4M7ZB 1MHPL 3L3OB 2X4PA 1FE8H 3QEGH 1A9BA 3BIAX 5SWSE 3K7UA 3SDAA 2O5YL 3C5JB 4Y88A 1XZ0B 3DVGA 4OGAC 4Z77A 1BVKA 3TO2A 2FR4B 2I9LA 4DUWA 1YQVH 2F74B 1O7SA 4GQPH 4PJCA 2HRLA 5IVXF 2J5LC 3DJ9A 3RA7L 2PXYB 4X83A 1T21A 4XMLH 5K59E 1L7IH 1S3KL 3FQTB 1GJIA 4ZG1A 4P4RB 1SYSA 3BD5A 2CLRA 3WNMA 2JCCE 1NCDH 3DUUB 4LMQI 4P57B 5SX5K 3UYOD 2Y36H 1Z0MA 4HQQH 4ZS7L 2EDJA 1MFEL 1P7QD 3X17A 3R8QA 3WHE1 1UVQA 1HQ4A 4RMTA 2OR9H 4QOKE 5IHZA 2XZQH 4G80B 3ILPB 4QXWA 1HCVA 4GMTH 4S1SH 2X41A 3GK8L 4HFWB 4BZ2H 5FHAH 4P0DA 3U9UA 4HCRA 2ICCA 2VKWA 3FT2A 3WHE0 2F54D 2I60L 5DRZA 1JPSL 1ZHNA 2YWYA 3PQYB 1EBAA 2PKDA 3EAKA 1JGDB 1NUNB 3QSKB 4DGIL 1A4KA 1F6LL 1QBBA 4K07A 5I1EH 5BS0D 4KJWC 4Y16B 4F9LA 2KL6A 4HJGA 4RAUB 4F7TA 3KLAB 2DMBA 4FZ8L 5I9QB 2XIDA 2PUQT 5AUMB 1JWMA 2UZYB 1WAAA 3IGAB 1GZQA 4R97C 2Y6SD 3EJYC 4NNYA 1C5CL 4XNQB 2YPLB 1SM3L 4YGAB 4YDJB 3E3QE 1MF2L 2NLJA 4ZPTA 1DUYA 4PLNC 1U2CA 1QSEE 2RQ8A 3C5SB 1ED3A 4Y1AB 4X6EA 1Q9WB 5JIPA 3CDCA 3RWFB 4KKAD 1JHLH 3ARTA 1KXQE 2YR3A 3WD5H 1QSZA 1CWVA 2Q7YB 1F8TH 2XA8H 1A6VL 4RGNC 3GI9L 5L2KE 1XH3B 3MLTB 5CZVH 3FOLA 1DSFH 4PP1D 5KN5B 5C0IA 4JPKL 1CTNA 4FQ1H 4MD0B 2Z92B 4HH8A 2EDQA 4WWKB 2CK0L 4POYA 2W9DL 4F8TA 1P4IH 4FTVE 4PRHD 4C4KO 3BN9D 5C0AA 2L0DA 4LQFH 3VFTA 3OXRA 1L6ZA 1YN7B 4E41E 3GSWB 4OLWH 2H32H 3H9ZA 1WFOA 3GHEL 3QG7L 5E4EB 4X9BA 5JORB 4AL8H 1A1MB 2QADB 3HI5L 1ZVSA 3EO0B 3EJJX 4OI8A 1KLFA 1MLBA 3IFPA 4KRMB 3SGJC 5GS3A 1A6TA 2Q76B 1V05A 1N0LA 4MJIE 2Q8BL 4PRNB 1ZGLP 1TZGL 2B7DT 5EPMA 4P5TA 5F7EH 4KDWA 3DMMA 3FZUD 4KFZC 4S1QH 1LE5A 3GB7A 5J1TC 3HI1A 3NFSH 5EZJB 1MOEA 2NPLX 4U1GC 3GMRA 4HZAA 1BQLL 4JO4L 5JOFA 2BOCB 4EOWH 1J87A 3GMOA 2V7HA 5F1OB 1HEZA 3SE3A 3F7YB 3WBDA 2NY1C 2EIDA 4N68A 4DOHE 4WU5A 3QDHA 4GRMA 3DVNB 5HHQB 4XP4H 1MEXL 2W0FB 4PJ9C 3IDIB 2Z31C 3ZE0F 1QLEL 4Q7DA 2DQGH 2QHRH 5B8CC 3MA7B 1OAXH 4X98A 4MXVF 4XXDA 3RWJB 1QACA 3TV3L 5FUCE 1A7QL 1FFOA 2YBRA 4KKLD 4O4YL 5E1HB 1X44A 4XMPL 1T66D 4NM4H 1IAIM 1ZA3A 4UINL 2WINB 1T03H 4WENB 3HZVB 1T22A 2FWOA 2ZPKL 2YRZA 1DQMH 3HZKB 1F3JB 1OP3H 3VJ6A 2XPGB 4AIZB 4Z5RB 4NZTH 1IL1B 4KDTC 2UWEE 2IQAA 2C4FU 4LU5L 1OGTA 4LLUB 3FQRB 2GCYB 5EU4B 3LCYA 3QIUC 3MA9H 3CMGA 2R1XA 2NY5C 1Q9KB 3VFWB 4IRZH 3TVMD 1VCAA 4PJAE 3MRIB 4PJXE 4OM0L 4G8GE 3RKPA 4JCMA 3DVIA 3F62A 3MRLA 5LJYH 2R23B 2J8UA 3FFCA 2ITCB 1MLCA 3KYOB 4ZUSB 4FQXC 1YYML 3KDMA 2E27H 4HIJA 5F1NB 3IU3B 3UTSA 1EO8H 5D9SB 5IMMB 5I2IB 5J6GB 4DGVH 5JW4R 1A14H 1CE1H 4ZFGL 4OIIL 1NFDA 3ARUA 3T3PE 3VH8B 1G7JB 3TCXA 4JQIH 4HUMB 3U2SA 2OQJA 3EDKA 2VB5A 3CU7A 4I9WE 4K94C 1W0VA 4JO1L 3QXVA 3HMXA 1YEKL 4IOFC 3IXAA 1H8SA 4O51B 2JIXB 3RQ3A 3L1OL 3SDAC 4OBRA 3UCRA 4U4BA 3HE7D 4WTZA 2HKFH 1FRGL 3L3KB 3O3BB 3RZWA 2GTWA 4K9EC 3NZHH 5C3LD 1UADC 4O00A 4TQEL 2RAMA 4JHZA 1BD2A 3T8XB 2VDOL 3WFHA 1CDBA 2A2QT 5DT1H 4JREB 2BNUA 2V5TA 3FMGL 2C4FT 4RX4A 1DQJB 3GKWH 4HS8L 4XHJC 5IROA 3GSRB 4Y2DA 3MJGX 32C2B 4F2MB 4Q6IA 1EVUA 4EDXA 2IGFH 1KJMA 5C0BB 1C12A 4HKXB 1V3JA 4MXQD 4JVWA 3CXHJ 4S1RL 2XWJA 5FKAA 3L95B 1U8KA 2VR5A 1UT9A 4K7PL 4WEBL 1G7LB 4LLMA 2O5YH 3L3GB 4K23L 3TBYB 5MENA 2P45B 4F3FB 5DK2B 2GTZB 4LNVA 4L8SB 4QRQA 2IH3A 3GSXA 3D18A 5DD0H 1S7WB 5L0QB 3D3VA 3CC5B 3LKOA 4F9LC 1ES0B 1DQTA 4LASL 4N5UA 5C09A 3U30C 1CICA 4HCRL 3MV7B 5ESVB 2JB5L 3QXDA 3BH8A 1N6UA 2FJFB 2O61B 1TLKA 3KLDA 1EEZB 1CT8B 1U93A 5C0CB 4FRWA 1GOFA 3D0VB 3QQ4A 4GKOA 4GW1A 5GS0H 4HJJH 1NFIA 4LSRL 1F4WL 1U8MB 1QPXA 5IBTL 3KPRD 5IMKA 3VCLA 5HYJD 3KYNB 1T0NA 2HFEA 4WEUD 5E9DE 3TYGH 3GK8H 5D1XA 3VXMB 5CJ5A 5TF0A 3D2UD 4ZFOA 4L4TA 4JY6A 2I60H 2HH0L 4ODUA 2BRRH 1QBLL 1DQQA 3VXUE 5EU3A 2ENSA 5INCA 1OAKH 3SKJH 1MY7A 3LRGA 2AV7A 4X7TB 1MREL 2W60B 2VZTA 4M00A 3EZJB 4OF3A 1RJLA 1DBBL 2CDGA 5CBEB 4FZ8H 2GK2A 2Q7NA 4QXGL 5CFHA 2NZ9D 2FJHA 1FAKT 1OTTD 3B2VL 2VE6B 4UAOB 5DJ6B 5GRYA 1CXLA 1S7QB 1SM3H 3H9SD 2DS4A 5TDNB 4OZ4B 4M4RA 1FL3B 5HHVL 1XF2B 4NO5B 1MI5E 1V7NL 4HV8A 5GGUB 1II4E 4JFED 1RJZA 1YPZB 4U49A 3WJLA 1TZHB 4OCMC 2XWTB 3AVEA 1DBKH 4MNGE 5IW6B 3EO1A 5JDSA 3AREA 4P5TC 3ZDZE 3P2TA 3DMMC 1H3UA 1TQBC 3NACL 1A6VH 3GI9H 4N9GB 4OFPA 2DBJA 5GGVY 1R0AL 3JUZA 2C3XA 2VDPL 2ZUWA 3C5ZC 3BW9A 1OAZL 3RWIA 4FQLL 5F7FA 2CK0H 4PRIB 5AZEH 3UTTA 3SE3C 1IGIL 4OJFL 3MV8A 5KZCB 3T3ME 1CG9B 5JW4N 4PJDA 3LEXA 4R26H 1JFQL 1VKXB 3QG7H 4CBPA 3ROOA 4WTZG 1TTGA 3KPSA 3HI5H 1IGML 1Q94B 3TH3T 1M6OA 5JA9A 5HSFA 4JPVL 3GGWB 3UTOA 4LGPB 2IH1B 4PG2A 2Q8BH 1XIWB 4PGBA 1WISA 4U7SA 5F93C 1T2QL 5BZDB 4AQOA 2G5BA 4NWTH 5I71B 4I18A 1PKOA 2F8VA 5I19L 5MI0C 4NRXA 3PL6B 1BZ7B 4X4XB 4X5WB 4CU6A 1BAFH 2LU3A 4WI5A 3UEZA 3VD5A 3V6OE 4J1UB 4TOYH 1FNHA 4E42A 4HC1L 1NEZB 2EDTA 2XN9A 3UBXB 1OOAA 2R2EB 4JFOA 1D5MA 3PWPE 3GHBH 4IMKA 3DXAE 5ADOL 5HYFA 2V9RA 2DB8A 5I1GL 2IFGA 1JRHI 1TETL 2MOVA 5EUOE 2OK0L 3O41B 1T89A 1Y18B 1QLEH 1ACYH 1W2KT 4HEME 2ERJC 4FOMA 1SJEB 3A6BH 3C60D 4JANA 2YD7A 5JPNB 2WIIA 3TV3H 4X7CC 5IVXB 3BD3A 1JNLL 4O4YH 4QHUA 5B39A 4CN1A 4EZMA 3RL1B 4NQSA 1FO0B 1INEH 3IS1X 1G7IA 4UINH 5D7IF 4C58B 1ZKAA 3ARBA 1I3UA 3CFCH 5E99L 5F7DA 3VXRD 1C5DA 4S2SA 5E2UL 4BQBA 3THML 4X99B 2W38A 1S7UA 5DK0A 1IGFL 3QB7C 3FKUS 5INDA 3HAEB 2A9NL 4XWOC 2R4SH 3ES6B 2F9BT 3MSPA 3LKNA 3MFFA 1LEGA 3DV6A 1UJ3A 1TJHL 1ZHLA 2ICEB 1EZVY 5FK9B 3NH7H 3EJYD 1NLDL 4OM0H 2RFXA 4WY7L 3BPCA 4YHNB 4N0FA 1SBSL 1PKQA 4KK5C 1XGUB 4J8RA 2UZIH 1J12A 4ZUVA 4MWFB 5F88B 1CFSA 4NRZB 2GKIA 4NKDB 1CL7I 3VE0A 4XNMA 1GPOL 1P84J 1CXIA 1S9KC 4Y2DC 2B5IB 3QDMA 5B3JE 2BZDA 2PYFA 5DHYB 3WDIA 5D6CB 4Q6IC 4RGND 3MROB 3DRTB 3QIBA 4HKBB 4ZFGH 3UJIL 3IETB 3HG1A 1HINL 5DJ8B 2DLFH 1DEEB 1SY6A 1VFAA 3F12A 3TA3B 2IAND 5TGBB 1Z5LB 4JO1H 3WN5C 1HXYA 2EDRA 4XP6L 1C16A 1YEKH 1NGXA 3U4AA 1UB5B 1TMCB 4M9OA 5GGQL 1G7HB 3QNZA 4JRYD 3OKLA 1U42A 4KRNA 5H35B 1KIRA 2IG2L 3EFDL 4UT6H 2J4WL 1ZXQA 5IBUG 3HTLX 4TQEH 3RX5A 4F15B 4HX1B 1Y6NR 3IS0X 5GISH 4JJ5B 1CGWA 4YZFF 1A6AB 1X6NA 3RTQA 5BRZB 1MFCH 1CICC 4FQCH 2Z8VC 3FMGH 4YBLB 3VRJB 3MO1B 3QI9D 5E5MB 5BV7H 2ZWLT 1MRCL 3WNOA 4LIQL 4YHMH 3V7MA 1VPOH 1C8PA 1I3RB 4ENEC 3CFDB 3R1GL 1MVUA 5B38B 2NTFA 5I17B 1S78C 1REIA 4PJEE 1Q9OA 2EDKA 5I8OL 5D1XC 1BQHA 1BWMA 2C5DC 3LKSA 1U92A 2AJ3A 1NGPL 1U3YA 3IKCA 3RHWK 4PJ9D 4XPGL 3QXAB 2BSSB 1T5XA 2VZOA 2Z31D 4C57C 1JPTH 3G5XA 4P2QD 3DV4B 4E5XA 3W0WB 3MOBH 1RZGB 2AKRA 1AH1A 3OG6B 5CP7A 3D9AL 5ALCL 5SWSA 15C8H 4RGOH 3V6ZA 1JK8B 3AB0C 4LASH 2AEWA 3W9DB 4N8PA 4P9HL 3ARFD 4ZUUA 2JB5H 5DRXA 4Z78B 1AJ7H 1F2QA 4UTAL 1WIUA 4PRDB 2A0LD 3I84A 3I75A 1F4WH 4OBSA 2E8ZA 2ICWA 5B39G 4JG1L 3EYOA 1WVZA 4NQEB 4M43L 3UTZB 4YHIB 2A83B 2JCCA 4RBPH 3V4VH 1J1XL 1KB5B 1KNOA 3QUYA 1J0KA 4FP8H 2HH0H 4NFDA 4BFIA 5B3NA 3AREC 3C8HA 3INUL 3SDXF 2WUBL 4QOKA 2W65A 3KHQA 3LN5B 4UQ2B 3BH9A 1I7UB 5L9DL 3LKQA 1AGCA 1UEMA 4LCIL 1IC7L 2X4OA 1AE6L 1DBBH 4UBDC 5FYLD 4U6HB 1U3HD 1FYTB 2D7TL 4BFEA 1A4JB 3SDDB 3L3HA 5CKAA 2XTLA 3PQYE 1EFXD 1A9EB 1ZSDA 2AXJA 1N59A 5HHVH 1HDMB 1MCEA 1V7NH 4MX7A 3RVXC 4HULB 2L4OA 2X4SB 3MRMA 4G42A 4PG2C 5GS2H 4UZGA 5BQ7A 2DKUA 2ZCKL 1ZAGA 1IGJB 1NCBH 1J18A 4HK0B 5ICYA 5FUZL 2WQ8A 4I18C 3SE9L 2YPLE 1IGYA 5TE7L 1QSEA 4IOFD 4X9FA 3KG5A 3NACH 3DX7A 1R0AH 1FJ1A 2FIRT 2VDPH 5F9WB 3L7FB 4FQLH 4GMSL 2APFA 4NJAL 3T0XA 4OI9A 2GITB 2BC4A 1CFVL 4IMKC 4ELKA 5L2KA 3GJFK 3S5LB 2W91A 4LSVH 3PWUB 3ULVE 1JFQH 2DTML 3NFNB 4ZXBB 1T89C 3P30H 5HY9A 1W72L 3ZTNH 2APXA 3X3FL 4XHJD 1A22B 4QHNB 3C8KB 4G6ML 1NGZA 2IJ0C 4LVNB 1IGMH 2MFNA 3SKOB 3TGXA 5I8CB 1MUJA 5HHOB 4ODXB 3WIHA 4E41A 2GSIB 3U6RA 1NLBH 5KG9B 2KPNA 4CADB 1NC4A 5DQJA 4KZEL 1U8LB 1T2QH 4LNRB 3WMSA 2UY7A 3ARBC 1LNUB 1KCLA 3QISA 4MJIA 4WI9A 3CDFA 1L9NA 5DJAB 4YHLH 4LCUA 1VFOA 4HC1H 3S4SB 4HUXB 4F9PA 3LIZL 3MRGA 2OL3H 1TPXB 3GSNA 1UJ3C 4X4ME 5I1GH 2XY1A 4JZNA 4U1SB 1TETH 2OK0H 1WCQA 1E27B 2MPAL 1OAUL 2ADGA 1VFMA 1T4KA 3DO7A 1O5DT 2OI9C 1JNLH 4YFEA 3RRQA 1CBVH 3VXQA 4JN1L 1CFTA 1S9WB 4NYLA 2GT9B 5EBWA 5FECA 3CLEH 1MNUL 1UQSB 3GMLA 3PP3H 4F58H 5E99H 3KXFD 2YRPA 3GJFA 4UIMA 5LAXB 1JZ8A 5C0RL 3THMH 3CFJB 1S7SB 3TN0A 3QWOA 2BXYA 2NTSP 1IGFH 3QIBC 4NQTA 4FFYL 5T3XE 4LFHD 5FDWB 2A9NH 1IEHA 3TT3H 1OAYH 5MERB 5I8KL 4DWHA 3O11A 3O9WD 3BQUC 4KI1A 5C0AD 4KK8D 1HHHB 2A1WL 3ZDYE 2DDQL 5JHDB 4L4VB 4WY7H 1DLHA 1SBSH 2UWEA 5HGHB 4JG0L 3VGGA 4JFPA 1GGIL 5HDBF 3VFUB 4HAFA 2X4TA 1RD6A 4PJAA 3FQNB 4PJXA 4R4BA 4LMQE 2NY4B 3RTQC 1I8KA 4H26A 5J57B 2YPKB 3O6FB 4KQ3L 5EUKA 4LCCB 3LQAC 1U95A 4DFIA 1J5OH 2BSTA 2K1MA 2F8XC 2VLKD 3C5ZD 3LHPL 4OQTA 1HINH 1CFNA 4PLJC 3SCMA 1XGTA 2PW2A 3ZYOA 3VFGL 3V8CA 1EHLH 1ZS8A 4R2GD 5A16A 1T5WB 4OD2B 3V5HB 2AK1L 3LQAL 1N5YL 4P2OA 3EFDH 2J4WH 1T1YA 1EHAA 4L8BA 4WI3A 3E6HB 4F37K 1QFUL 1S5HA 5I30H 1BVLA 4OAWA 4UUJA 2CDEB 2IALA 2Y72A 5FKPB 2FDBP 4DVBB 1ZHBB 1MRCH 4U6XA 4XNYL 4ALAH 2OR8A 4U0RC 1BOGB 3FB8A 3LKPA 1ULVA 4GUPB 4X9GA 4NO3A 3PIQA 5KJRH 4L8CB 4F7CA 1MFBL 5E94A 4CKVX 3HPLA 3V7AE 3QUYC 3BXNB 1NC2D 5AYUH 2W0PA 4OM1H 5F8QC 3UJTH 3F65A 1I8MA 1T0MB 4XPGH 3S3SA 3GRWA 3MXVH 1I9JL 2JTDA 3VFMB 2ZUUA 3B9EA 1IM3A 1AGFB 4J6RL 5C0BE 5IR1A 1B4JH 3D9AH 5ALCH 3U83A 3KR3L 3QWQB 4FQ2H 3WFBH 4MXWH 4IRJD 3RUGE 1C5BH 2OMNA 2P44B 2H32B 2Z8SA 2F5BH 4LPTA 1A1OB 3UROR 3OSKA 1I1CA 1MCHA 3P73B 1IAIL 1QFWH 2IC2A 1T04B 4YDKL 1AKJD 4GT7A 5IEKB 1YJDC 2AQ3A 1J1XH 3F5WA 1UKSA 5A43C 4ZQKA 3E3QC 1H15B 1KPRB 5IMOA 3MRBA 5D7IB 4MD4A 2V7NB 2WUBH 3TPUA 5DRNA 2YRLA 4PY7B 1HE7A 4OLYL 5DUML 5C0CE 5C07B 5E9DA 1BZ9A 3MRDA 4OZIF 3VWJB 5CUSH 1KCSL 3MBED 5D1QB 4U0QB 4KK5D 4XPAL 3SE8H 4EI6A 3V0VB 5GS1A 1AE6H 2R9HC 4W70A 5GGRB 3MGTA 3JXAA 3VXME 3VXUA 3QEHA 1N0XH 1FNEA 1F3RB 4EBQL 4PIRF 4QTIH 1S9VA 1QBML 3G08B 4G3YL 3CJJA 2AAVA 1AI1L 5I66B 4N0RA 3G6DH 1F4YL 4IMLA 4P5MB 1K8DA 3O3AA 4X6DF 4TVPD 4DKFL 2D9QB 4JAMA 1QO3A 1K6QL 4MVBD 3OKNA 3CZFA 4RFEB 3O6ML 1HILB 1NMCB 4UIKL 1WCBA 1HWHB 2ZCKH 3DTXB 3WXVL 4UDUA 3FO1A 1RHHA 5FCSH 4JFFD 3UP1A 1MI5A 4Z0BL 5FUZH 3SE9H 2C3VA 5BVJB 1NGYA 2ZUTA 1YNLL 3X14B 3VG0L 1EPFA 3TYFA 1QLRA 3JVGA 5FCUH 1JZ4A 4B50A 4EN3B 4HMDA 3OKYA 4GMSH 2P5WD 4MNGA 5DS8A 1KEGL 3JV4A 4F9PC 4Y4KB 1P9MA 3GBNL 3F7VB 4D9QD 4LGSB 1F4XH 3FB7A 2ZSWA 2DTMH 1B0RA 1W72H 3MGOB 3A6CL 4JFHD 2R2BB 2MQCA 3X3FH 4O2EA 4G6MH 1QPPA 4D9RD 4ENED 3VFOA 3HZMA 5HHNA 4LSSL 4PRIE 2MKWA 1AD0B 1TCMA 1I9IL 1GVIA 1S78D 2K7QA 4PJBF 5AD0B 4KZEH 2ZCLL 5D1XD 3Q0HA 1NMBH 1FLRH 2GUOB 4K8RC 5DD1H 4K3DL 2AGJL 1UWXH 4PV8B 5JO5A 1A3QA 2FLBT 4LEOB 3TN0C 2FGWH 3D39D 2YA0A 2EDHA 2UV3A 3AY4A 1JZ3A 3GSUA 5F6IB 1D5XA 4KQ4L 4IHOB 4QRTA 3CVIH 5KANG 4JZJA 4NT6A 4PJ8A 3KPNA 1KLGA 4LLYB 3FHAA 3U4EB 3SPVA 4H20L 3J8F7 4LQ1A 1IC4L 1FORL 1XR9A 3ROLA 2MPAH 3FO9A 1R5IB 1ZTXL 4K8RL 1OAUH 1OTUC 1RZKL 3WDJA 2ZJSL 3QUXA 1NGWA 4IEFB 3BZEB 3PWPA 3DXAA 1DDHA 1XAUA 1JWSA 5IHUL 4EKXA 3B9KA 3MRKA 3LSOB 1SYVA 4ONGL 2AI0H 5EUOA 1FSKB 4AM0B 1BGXL 4DK3A 4OLZL 3MGAA 4YEFA 5KS9F 2WK2A 4LBEB 1MNUH 1K2DB 5SWZB 3T0AA 3G5YB 1MWAA 4XGZB 4LCYA 2FSEA 4NHUA 4NUJA 3RI5F 3OQ3B 3MACH 1BP3B 4TSCL 4PYGA 1KIUA 1N64L 5FHBL 2HTKD 8CGTA 4YHPA 2EE2A 4ODSL 4IOIA 3NZ8A 4UBDD 3OKDB 1OGAB 3SCMC 3MRRA 4OCRH 3MV8D 2A1WH 1MCLA 2NNAA 3SDXB 1WUNT 1NDGA 2P8MB 3OJ2C 5J9PA 3MV9B 5FGRA 5IVZA 4P2OC 1I75A 3HC0A 1IVLA 3RVXD 1YMHB 2UUDK 3KPSD 3O4LE 2B2XH 4QGYA 2PYEB 3ARDA 3V5DA 3T4YA 3OGOE 1Z3GL 4JEGB 1FZKA 3JSSA 2OYPA 3MLXH 4RNRA 4YHZL 3BP4A 4KQ3H 4RFOL 5TDOA 4XNZB 1IGCL 1KIPA 3VXPB 3MNZA 1IM9A 2APBA 2ATKA 4YNYA 5H37H 4HKZB 1B88A 1JHKL 4N0CD 1WEJL 2DQHH 4TTGA 4PR5A 4RMQA 5TPWL 5B21A 2IPTL 3JWDC 2OXGA 3EYSL 5CMAB 3QDGB 2B1AL 3QCTH 5GGVH 4HLZH 4Z7VE 4ONFH 3X3GL 2AK1H 2HVJA 5ICXA 2IBZX 3QG6B 1HSAB 1MJ7H 2CRZA 3NTCL 4YH6A 1MH5B 3HLAA 1OB1B 3CGTA 1CN4A 4PLKD 1Z6JT 3V6FB 1H0DA 1DP0A 2YN3A 5ALBH 5E8EB 5EFIA 4HW6A 3LDBB 4JFZL 2PW1B 3SKMA 5I6XB 1UCBL 3N9GL 4HS6A 4QNPF 1PSKL 4PGDB 1I1AD 3GRWL 1OL0A 4N5ED 4RAHA 4MNQD 8FABB 4CW1A 1Q9LA 2GAZB 4WFHE 4IRSB 43CAB 5BRZE 5HHME 5BXFA 4ZUWB 3A67L 5CJXA 4XCEB 1I8LA 1I9JH 4PJEA 1U8PB 2R39A 5D7JD 2EICA 4GAYB 1P2CB 4J6RH 1AP2B 5GS1C 2RHEA 3BDBA 3C2SA 4I0CC 4WW2A 4XCFL 4YBQD 1RPQA 2VLJE 5L2JB 4JKPH 3KR3H 5I1LB 1CCZA 2FL5A 4Z7UF 5E2WL 3PWNB 4Q9CA 4M8VA 3N1PC 4GSDL 5DWUL 5E03A 5EZLA 2BVYA 4LSDA 2CDFB 1BBJB 2P8LB 4Q58C 3L3OA 3LMJL 1QRKA 1FN4A 1EJOH 2BNRB 3QZWG 3GZKA 2DMKA 3C5JA 4WGWB 3BQUD 1XZ0A 2FR4A 5BVPL 3CH1B 4MMZC 2F74A 2QQKL 5DUMH 4P46B 3JVGC 4MXVE 3O2DA 4EVNB 3BPNB 4P4RA 2WUCH 4NQEE 5I1AB 3DUUA 4FZEH 4P57A 2CGRH 1HCFX 1P9MC 3HMWL 3I3DA 5D2LF 2WLYA 2QQLH 4DJMA 3BGAA 4G80A 1EJ6A 3ILPA 4JFDD 2VTFA 1YY8B 1KG0B 3N1QC 1RJCA 4HFWA 1NBZB 1N4XL 1K9TA 3GNMH 5FYLL 1K85A 1NCCH 3QUKB 3PQYA 1FYTE 3CCHB 2KDGA 3IT8D 1JGDA 4KWUA 4ZOAA 4KJPD 4G9FB 1MHEB 1F6AB 5E2TL 5I15L 2DAVA 3OKMA 4PP2B 1SVZA 4Y16A 5IQ9B 4DZBA 1FPTH 4RAUA 1YC7A 3KLAA 3CVHL 4NNXB 5AUMA 3AY4C 3TP4A 2EXYD 3IGAA 3MLYH 1A0QL 1VGEH 2C7UB 4JZJC 3MUY1 5DFVC 2YPLA 4PJ8C 5D1ZD 3Q5YA 5SWSD 1JHTB 3OAZK 2GY7B 1Q38A 2ADFH 5KTEH 3BMVA 3C5SA 1G0DA 2ESVE 1EMTL 4M3KB 4R4FL 2ZCHL 1IT9H 2V5RA 3QUXC 1Q9WA 2NY0B 4LSSH 5F97E 5EDXA 3RWFA 3B9KC 1T7YA 1RUML 1I9IH 4P23B 5E2VL 5EG6C 1KELH 4LHUA 3NGBB 2Q7YA 4N1CA 3SKUD 2ZCLH 2CH8A 1XH3A 3MLTA 3LEYH 2FX8H 1TVBB 2VERN 3IFLL 3MJ9H 5KN5A 4HGWB 4P3CH 4WCYH 2Z92A 1BFOB 3PP4L 1RK0A 3RPKA 4XWGL 5DJYB 4ONHB 5HHOE 1WJ3A 3PV7A 1TIUA 5DI8A 5AG8A 1YN7A 3GSWA 4XVUC 3EGSB 2H2SC 4YK4B 5CD5D 1X5JA 4ZO9A 5EU7E 5JORA 1A1MA 1S9XB 4BJLA 3KGRA 1FORH 3EO0A 1UENA 2G2RB 3TO4B 2Q76A 3FAWA 3S6CA 3HUJF 5T33L 2ZJSH 1LQSR 1CD9B 2JJSA 4PRNA 5TE4L 5ID1B 4WW1A 5EULV 4X4MA 4JE4B 3ARDC 4RISH 4MA1B 3TNMB 3VXSD 4QHKJ 3P77A 5E8PB 1SBBA 1QG3A 3EYUH 3P4MB 2BOCA 3KPQB 5BV7B 1VA9A 3T2PA 5FUOL 2CR3A 4TSCH 3DVNA 5FHBH 1T2JA 2W0FA 1DZBA 3FRUA 2G9HA 5IB5B 1FH5H 4FABL 4MHHI 2HLFD 3MA7A 5L2KD 2YUZA 1SEBB 4HXAL 3RWJA 5TH2B 4KHTL 4PS4L 3N06B 3TJEH 3HZYB 2P5EB 4WFGE 1D5ZB 1FC1A 3OWEA 4FTVD 4UU9B 2NY6C 4YPJA 5LCVH 1IRAY 5GSVB 2WINA 4LVOC 3ZO0A 3QCVL 5AYQA 3K8KA 1YEGH 4MB4A 5JNYB 4YHZH 4ZAKD 2E3VA 2J8OA 4U1NB 5JA8B 4Z5RA 2XPGA 4AIZA 4QRPB 4L4VE 1RZJC 1IGCH 1IL1A 1E6JH 2ZOKB 3WFDH 3X13B 4X6DB 4XBEH 3FQRA 3GSQB 3EYVA 4YQXL 3CFEA 5EU4A 2MWCA 1I7RB 1Q9KA 3VFWA 1WEJH 3MRIA 2IPTH 2XKNA 4JY4A 2RBLA 2H2PC 3EYSH 1EO5A 2R23A 3MCKA 3O8XB 2B1AH 1FVEB 2ITCA 4OB5H 5CJXC 1I8LC 5EB9A 3KYOA 4ZUSA 5EOQL 3IDNB 1GC1L 4WW2C 3BP7A 5F1NA 3IU3A 3MRPB 3UZQA 5EIVA 4HUWB 5D9SA 4OSUL 2X70B 1EZVX 5I2IA 5J6GA 1B6DA 5CGYD 4JFZH 4ZO7A 5TQ0L 3N9GH 2YD5A 4M1DL 1PSKH 2PR4H 4X6CF 3VH8A 4LOUC 1G7JA 1TQCC 3VG9C 4M7ZC 4XZUA 5EBLB 1L0XA 4QXUL 4LARL 4KXZI 5IK3B 5C08E 3S36H 4ZYKB 4PJBB 4LHUG 3HE6D 1S8DB 3Q5TA 1XFPA 2Y23A 3U0WL 5GZND 2DLIA 2KKQA 2NY7L 3SHSA 1ONQB 1R24A 3A67H 3QP3A 5DMYA 3QDJE 3AMKA 3I6LE 3T8XA 3DLQR 3BHBB 4ISVB 3DO3A 5AEAA 1NPUA 4JDZB 3WL9A 3T2QA 2YC1B 4DN4H 4YX2L 1DQJA 3H8NA 1M7IB 1C7TA 4OFVA 3GSRA 2J8HA 32C2A 4F2MA 4G8GD 4HHAB 2QQNL 4YC2C 4GSDH 1MAML 5C0BA 5DC4B 5ERWA 4HKXA 3ARRA 1JF5A 4X9IA 5HD8C 4OI7A 4PUBL 5HDLA 1I9EA 3GMNA 3AXLB 4JFXB 4RGMC 3RUGA 5CGMA 1G7LA 4NCDA 3BKCL 2X89D 3L3GA 3JV0A 5KS9B 3TBYA 3SCMD 3O4OB 4F3FA 1T80A 2F19L 2GTZA 5BVPH 4L8SA 4M1GL 4CL7A 3I6KA 2QQKH 4Y16C 1S7WA 3P9LB 3CC5A 3RIFK 4M6AA 1ES0A 5I9QC 3RIAF 1F11A 1QSFB 1S7XB 1U3ZA 5ESVA 4I9WD 3ULUD 2O61A 1FFNA 1QFWI 1EEZA 2HTLC 1CT8A 3MRQB 5DMKB 5C0CA 4RAVB 2OL3B 3SEPA 3HMWH 4LRNL 2HJFB 3WYRA 1JE6A 3OAUL 3WFEL 1U8MA 5J06A 3KYNA 1TCRB 2VLRD 4WUUD 3VXMA 2VXUL 5FYLH 4WI8A 3ARWA 2EDXA 4V1DB 4HIIB 2QQQA 4JRXB 3ULVC 1U8IB 3RWEA 1BLNB 2DYPB 1U8HB 4X7TA 2GK0B 3C2AL 2QR0B 2AK4B 4WFFE 5E2TH 2EEAA 4S1DC 1QD0A 4HJ0D 3KYMB 3MRHB 5CBEA 2ADJA 2ZUQC 5C0DB 2CJUH 2FD6L 4RIRB 1T6WA 1JV5B 2NY2C 1UKQA 5DJ6A 1S7QA 5TDNA 4NQCB 4OZ4A 4LPYA 4FFWC 4K94H 1FL3A 2GJ6E 3ULVL 4XBPB 4NO5A 1XF2A 3LQMA 1NBVL 2QADC 5IQ7L 2XI9A 5GGUA 4H1LH 4B5EA 4GXUN 4GRLD 3U0PB 4G6FB 3SQOL 4KKBD 6FABL 1YPZA 1ADQA 5GSRB 1TZHA 1A7NL 2JJSC 3P4NA 5DJZB 3X12B 1YEJL 2FRGP 1DVFB 1L7TL 5IW6A 4OZGE 1C1EL 5GQBA 2LU7A 1MQ8A 1OQOA 4PFEA 4N9GA 4ZO8A 3JWOC 3FRPA 3GMMB 4YHKH 3WS6A 1I1YB 1XGRB 3EJZD 5JMRA 3PP4H 2BHZA 4PRIA 3VH8G 1SMAA 4MDJB 1ZT1A 4G8EB 4J4PA 1FFRA 4LSTL 4XAKE 1CG9A 1HIMH 5HGDB 1K3IA 5EA0L 4AZ8A 1TITA 2BY0A 4IOSD 4YZFE 2NYYC 3JV6B 1G9MC 1YMMD 5T1LD 4WJ5B 1BBDL 3MZGB 5J6HB 1Q94A 2F58L 4Y5YB 5A2KH 2I9TB 2HLAA 4P4KD 1OVZA 2IH1A 4C56D 5T33H 4CNIB 2DQFB 3O45B 1XIWA 3WUWB 2X5PA 3V7AG 1CI5A 1WK0A 2O5ZL 5BZDA 4LLQB 4K3JH 4NSKB 1RIHL 3MRJB 2IADB 3FT4B 4G8FB 3TNNB 3PL6A 3KLHC 1BZ7A 4X4XA 1HK6A 4X5WA 1A47A 5DJXB 2DIJA 2WWKT 4J1UA 2YXMA 1PYWB 3QO1B 5T3XL 4LEXH 3UBXA 3HN3A 2R2EA 5C0ND 4HS3B 5F9DC 1CGUA 4GBXB 4HXBH 3S36X 3FT3B 3MTRA 4ZPVB 3DARA 4NN7C 3SJVD 2GJJA 3O41A 1Y18A 3PWJB 3EZ8A 4PJFF 4DZ8B 3FFDB 1FVCB 4FABH 1SJEA 1C7SA 3C8DA 5D7LB 5SWZE 4CVUA 1MCCA 1FAIL 3WIFB 4HXAH 2V6HA 4ZSOB 2EC9U 1ORQB 1RZFL 5I1JL 4PS4H 1H3XA 2DM7A 1FCCA 3JUYA 5GJTL 2OCFD 3RL1A 1FO0A 1QYGL 3NA9L 5CEZD 2ADIB 1FGNH 3B83A 4MA7L 4FN0A 2FATL 3PGFL 4RMUA 3STLB 3BWUC 4FA8A 1LO0L 3QCVH 2X7LA 3WDHA 5HI3D 2E9IA 2V2WB 3DURB 4X99A 5D2LB 5FV2A 1A21A 3HAEA 1ZEAH 3ES6A 4GQ9H 1DLFL 1BIIB 4YQXH 1T0PB 2PYEE 3Q6FB 2DJUA 2ICEA 5CZXD 5FK9A 4R4ND 2EE3A 3MREB 1QHPA 4YHNA 5DFVD 4PTTA 3FN0L 1Z9SA 4HH9B 1P7QB 5HI4C 3BMWA 2BSRB 3P9MB 5F88A 2JF1A 4NRZA 5DSCB 4NKDA 4OT1H 4YXKL 3SY0B 2P48B 1AHWB 4LCWE 4U6VH 4Z7VA 4NZUH 2F54B 4OSUH 2MCPL 4U2YA 3OPZH 1QEWB 3QDGE 1YNTB 3MROA 3DRTA 2BY2A 4HKBA 1FZOB 3IETA 4OLXH 5DJ8A 5T5FL 5BS0B 1DEEA 5GGSA 3H9YA 2EC9T 3TA3A 2HJKB 4JQXA 4N1HB 3MJ8B 5TGBA 2F53D 2JJVA 1Z5LA 2EO9A 3S88L 4LDEB 4GXVL 2B4CC 4Q9RL 1UB5A 2OLDA 3BEVB 4XVUD 3D85A 3G04B 3LH2L 3FRPG 4JM2C 1I9RL 2H26B 4LVHB 1DTUA 5H35A 3M1BB 5D7KD 4L8SC 2X4NB 5L0QC 3TM6A 2HRPL 4BKLA 2MSPA 4HX1A 2AERT 4JJ5A 3PDOA 1A6AA 5BRZA 5HGBB 2D4DA 5F9OL 4YX2H 1IC5L 3ARDD 1T2XA 1I3RA 5LKNA 4UTBL 3L5JA 3CFDA 1MAMH 5I17A 5DO2C 1W72B 2XWBB 3WFCL 2VLJA 2XRAH 4PUBH 1IM9D 2GFBB 3NMEA 4PRHB 5CSZB 4HKJB 3PG2A 4Y19D 1FZJB 1ZMYA 1IFHL 3PHSA 3L9RA 5JR1L 3GDBA 3BKCH 3CLFH 2BSSA 4X7DC 2QLVB 3MC0A 1LO3H 2F19H 4HMEA 5C6WH 1DEDA 4GAGH 5KVGH 2NR6D 1KSRA 4JN2A 4NN6B 5D71L 3UBXG 2F5AH 3OZ9L 2VL5B 1B0WA 5HPOA 2BNRE 3E8UH 3W9DA 4UAOC 4PPTA 2NY6D 4Z78A 1H3GA 4PRDA 2V17L 4HWZB 2VWEE 1LDPL 3NCJL 3OAUH 4Y5VB 5DHVH 2W59A 3WFEH 1MCWM 1IQDA 5L6YH 4NQEA 2H3NB 3UTZA 4YHIA 2A83A 4U6YB 5E7BA 3X11B 1KB5A 2CUMA 4XPHH 5ID0B 4KV5E 3D25B 3QFJE 3QQ3B 2DQUL 3IAPA 5BZWB 4TUJB 5HXMA 3B9AA 4TSAL 5FDYA 1ZANL 3GJEB 3LN5A 4C83B 4UQ2A 1NKOA 4DVRL 1BECA 1I7UA 3C2AH 2UYLA 1ZV5A 2H2PD 3WS6C 3GM8A 4J3VA 1P5UA 3HAEG 1B4RA 4TVPH 1G1YA 1OW0A 4U6HA 1WBYB 3H42L 4F57H 1FYTA 1YECL 5ETUB 4NCC2 2A6KB 3M17B 4J4PC 1A4JA 3SDDA 1ADQL 1MRDH 3BZFB 4LP4A 1AGDA 1NJ9B 1A9EA 4P2RE 4HIXH 1FNSL 2CSPA 1NUGA 4QWWD 5GGTH 1L6XA 1HDMA 2FEEI 1NBVH 5HDQH 4X7FC 2X4SA 4DEPB 5F21B 3SQOH 2ZG3A 5DJ0B 2FHFA 3CK0L 1A64A 1XIWC 1A7NH 1CFQB 5JIIA 3EW3B 4BSWB 1IBGL 4HK0A 5I71C 2X4UB 1C1EH 2MNUA 5DA4A 2VC2L 3TVMB 3E2HC 1FNGB 3ELAT 4KK9C 2FX7L 3RU8H 2DWDA 2GITA 4FHBD 2D4FA 3WFZA 2XNAB 4LSTH 5F8RC 2ORBH 4XPBL 3S5LA 5EA0H 5KSAA 1HQRA 3PWUA 3NFNA 4ZXBA 1QQDB 3GIVB 4Z76B 4QXTB 3FB5A 4QHNA 3C8KA 2G60H 3SKOA 3BT2L 3HS0B 2DQJL 4B7IA 5I8CA 5HHOA 2VMFA 4N0UE 4ODXA 3HNVL 2GSIA 4Z0XB 5K9JL 1FL5B 4JFQB 3SDCD 4ERSL 1U8LA 4LNRA 2KBGA 2C1OB 3IU4H 5MEPB 1RK1B 5F1IB 4PJCF 2RCSL 1S7TA 1LNUA 4L3CB 2HT3D 5KVEH 2CLZB 4KAQL 5T5NG 4MZ2A 3V4UH 5GRUH 4I8DA 2X9WA 5DJAA 3ISWA 5B38G 4PY8J 3HE7B 1NSNL 4EUPH 4WI6A 3S4SA 4HUXA 3MODH 5E00B 2AQ1A 2D03H 1BMGA 5JIHA 4U1SA 1A1NA 1FDLL 5C7XL 3BO8A 4BFBD 1E27A 4KROD 3OXSA 4Y5XA 2DQEL 2VZUA 2YPLD 1OWRM 3LS4H 1G9NC 5DF0A 3WKMH 3RVTD 4BK5A 3I2CH 1PG7L 2CRMA 4UT7H 3BAEL 5GRJL 1WZKA 1CZ8L 2VH5H 1QYGH 4G6JH 3S34H 1S9WA 2GT9A 5FM5M 3OHXB 1UQSA 1XT5A 4LDLB 4QTHB 5C0FA 5LAXA 4LHUD 4WEMB 2B5IC 3M07A 1PEZA 5A2IH 2OR7A 1S7SA 5C0JB 4KUCD 4Z7QF 5FDWA 3RWDB 1QLFA 2P8PB 1GOGA 5CINL 1NCWH 2P5EE 3VFRA 4PY8I 3O3DA 1DLFH 3QRFM 1G84A 3TBTB 1UFUA 5MERA 3TA3C 4JQXC 4L4JA 5BW7A 1HHHA 1X5IA 2NY2D 2HKHL 3H9HB 1UWGH 4L4VA 1I4FB 2NW3B 5HGHA 2FHBA 4QRPE 4HUVB 4KK6C 3VFUA 5K9KB 1E28B 2YEZB 3STZB 3LRSB 4NGHH 4F15C 1CXHA 3C9NB 3V6BR 2N4IA 2OTWB 3FQNA 3KPRB 4H0IA 5HYJB 3QIWD 1F45A 3O6FA 1AD9B 3HC3L 4LCCA 1L9MA 4YBLC 5CJQH 1JI1A 3D2UB 2N1KA 1VERA 3HCVB 1R3KB 4KH2A 5E6YA 1PZUB 4OUUB 2WBJD 1RY7B 5DTFB 4N90E 1WAAE 3TT1H 4PTUB 4XMKH 5IF0B 3OKKB 1B90A 5KSVB 4EXKA 4GKSA 3CFBB 3IDGB 4RFNC 3RY4A 1ZLWH 2VZSA 2E8YA 5DEFA 4B41A 1N6QH 2ID5A 1T5WA 5I0ZA 4OD2A 4UDTA 3V5HA 4QHMB 4Y4HD 3DROB 1CGSL 3H9SB 5FOJA 2ITDA 3O6LH 1F90H 2MCG1 5C9KA 5C08A 2BMKB 1QFPA 3NCYP 3E6HA 5DMGC 3TIEA 3KJ4B 1TJGL 3DX6B 3G6AB 4JFEB 3BN3B 3S5LG 5FA4B 3IKKA 3BE1L 4PJBE 2AV1B 4R3SA 2CDEA 5F9OH 5FKPA 4PRPE 1IC5H 4DVBA 1Y0LB 2EH7L 3IDYB 4ZUTB 4D0DB 3UZVB 1IILE 3KLHD 2C3GA 1BOGA 3B4NA 2VDKH 4RQQB 3UDWA 1UM4H 4GUPA 3ZKMC 2DBLL 1LEIB 3WFCH 4H5SA 1DFBL 1XGPB 4H8WC 3BXNA 3UPAA 4WO4A 5IFAL 1PY4A 1T0MA 4XCCL 5JR1H 2XTJD 5CJ8A 4I3SH 3NPSB 1AGFA 4HZLB 5I8EB 1MCFA 1GXEA 3S4SG 1OW0C 1YY9D 3AU1B 7FABL 1UM5L 1FIGL 1PVHA 1INQB 3OZ9H 5F72S 4KMQA 3SDDC 3RDTC 1NMAH 1KB5L 1JRHL 2DMCA 4M3JA 2CLVB 2IEPA 5C9JB 1YUHB 3V0WH 3VDAA 2H32A 3C6SB 4PJFB 4K3GA 1A1OA 5JZ7C 1JBJA 4RWYL 5AZ2L 1J9CT 1JI2A 5I76B 1DJSA 5E8DL 3NCJH 3P73A 4GLRH 5HI5D 2EYSA 1T04A 1FNLA 1HHJB 4JPIB 5IEKA 2H1PL 4FG6D 4OLVL 3E1F1 5ICZB 2J8UF 1QSFE 1H15A 1KPRA 1YZZA 2V7NA 4TSAH 3BVNB 1MPAH 4PB9L 3OJMB 4PY7A 4IS6B 4DVRH 5C07A 4NQXB 4OCWH 5IMLA 4YWGH 2VXQH 5F9WC 1G6RH 5D1QA 3V0VA 3WE6B 1K4DB 3C60B 2YA1A 3P11L 3H42H 5GGRA 1YECH 5HI4D 3GO1L 4V1DE 2B20A 4YDVB 2CIKB 2VUOA 1D6VL 1F4HA 1N5AB 5KSAC 3IDMB 1OSZB 3S37L 4ZXBC 5I66A 3DNKA 1IMHC 4LVNC 4BH7B 5C0GB 4YAQA 3VXRB 2YMXH 4R96B 4RFEA 1HILA 2R69L 5HYIA 3K2UH 1CL7L 3DTXA 1AXSB 3RY5A 5EU7C 3WNKA 1IBGH 1JTPA 1A2YB 3MLUH 3WNLA 1XGQB 2BERA 4KVNL 5BVJA 4NQCE 3UYRL 3ZKXB 4LSQH 3VWKD 1K5NB 1A7OL 4JPWL 1KYOJ 4JM2D 4EDWH 4EN3A 1E6OL 3RGVD 1J05B 3F7QA 4KRLB 2NXYC 1EAJA 3PGDB 3FCTB 4OZGA 4NOFA 1JPGB 3L3IB 1BFSA 4RCAA 4Y4KA 1G7QB 1PEWA 5ESQB 4CN6A 1MJUH 3F7VA 2BVPB 3GI8L 3B3IB 2I07B 3MGOA 1YEHH 2R2BA 4Y5XC 4DN3L 1RVFL 5FYJD 5C3TA 3BT2H 1AD0A 3HNVH 4RGNB 2E7HA 1OTSD 4DQOL 5DO2D 1M05A 3MJ6A 3PXJA 1KCUL 1BJMA 1D7FA 1JGLL 1OCWL 1CGYA 1F02I 2RCSH 3RL2B 2IANB 5F3BB 2D9CA 4FNLL 4PV8A 1BD2E 4LEOA 4ODWB 4M6NH 2ARWA 1E4KA 4JRYB 3FB6B 4IHOA 3D69A 4K71B 4FFZH 5DQ9A 2B1HH 4M7KL 3U4EA 3VI4F 5BW7C 4UB0L 3DWTA 1FDLH 1YJDH 5CP3H 1M71B 5C7XH 2XOTA 2F8OA 1R5IA 2DTSA 4L5FL 2HWZH 3QI9B 4MAYA 1U58B 5DYOB 5F7NC 3BZEA 1BFTA 3SDYH 3QWRD 2YPVH 4MSWB 4XPTH 3V52L 4XVTL 3LSOA 1PG7H 4JKMA 3BAEH 2RB8A 4GAJL 2J6EA 4AM0A 3MLRH 1U8QB 4TTDD 4AJ0A 2NY4C 3FQWB 4LAJH 4LBEA 3O6FC 4LCCC 5SWZA 4ZFZA 3QEGL 1FE8L 2GSGB 2R8SH 4UV7L 4CJ1A 2NX5E 5D7LE 4OLUL 4PJ9B 5C09E 3QUZD 4ZSOE 3QPQD 1W0WB 2Z31B 4O9HL 4P2QB 2EDLA 3MFGB 3RVUC 1YQVL 3NBNA 3OKDA 3VGAC 2XACC 4X6BB 1NDMB 4J4PD 3G5ZA 4RA0C 5GRWA 2CO6B 4U6TA 2DKSA 2P8MA 4QGTA 4MQXD 4Y8AA 1NCDL 3ARFB 4NM8H 1KTLB 1TZIB 2SEBA 1YMHA 1YEDB 3NCYS 5SX4H 2PYEA 2OR9L 3BRGC 3IB4A 1RJYB 4HIHB 4GMTL 4S1SL 3FQUA 5F96H 4BZ2L 3HC3H 3UAJD 4IDJL 2O26U 3IJSB 1WBZB 2D7NA 1A6PA 3LQZB 5I16B 5FB8B 4WI4A 5B22A 3VXPA 4URTB 2R2HA 2HP4A 3UDWC 5E6ZA 5EC2A 4HKZA 4PGEB 5HYSB 5IWLA 3JTSB 3CX2A 1KJVB 3MNVB 3MRCB 4U1HB 2FYYB 1U3HB 5CMAA 1AO7D 3U36B 3QDGA 4WO4C 2OSLB 3EDDA 4AEIL 2R0LH 2D7PA 5D8JH 2A6IB 1EFXB 5E8OB 3QEUB 3FN3A 1KCRL 3F7PC 3QG6A 1HSAA 5EN2B 1MH5A 2Z9TA 5HYEA 1OB1A 5T1KD 5AAWA 3PNWB 5BS0E 1TJGH 2AW2A 3OF6A 3BE1H 2E9JA 2PW1A 4HUUA 1N8ZB 3L5XL 3FAXA 3UX9B 3QRGL 1PFCA 4PGDA 2X4PB 2Q8AL 1F8TL 2Z91B 1SHMA 5CZVL 4H1LB 1DSFL 2DBLH 1X5YA 2W07A 1MCNA 3EHBD 3O4LD 3WSQL 2GAZA 1AFVL 1DFBH 2QV2A 3DVGB 3TO2B 4IRSA 3K0WA 4NNPH 3DUHA 4ZUWA 4XCCH 5DMIL 3KPOB 5SV4A 3K4AA 2EDDA 2E7CA 3MUHL 4XCEA 3VGBA 2VO5A 1U8PA 1A5FL 3W9EA 2KH2B 4GAYA 1P2CA 4J12A 5D1QC 4OFYA 5TE6L 5L2JA 1UM5H 4NRYB 3FHQA 4P9ML 3TJHD 5IHZB 5I1LA 3ULSB 1NBYB 1JRHH 4O2CB 5EORH 3PWNA 3DYPA 4MCZB 4ZNEE 5IFJB 4YDLC 4LSPH 5CD3B 1QRNE 2X4RA 2VAAA 4RWYH 3FT2B 2CDFA 1BBJA 4S1QL 1MJJB 5E8DH 3NFSL 3Q1SH 4NCC1 2W9EH 1X5GA 2BNRA 4NQVB 1FZMB 1NMCC 1YEEL 4OLVH 5I1CL 1Z0NA 4CVZB 5IG7A 1J8KA 3ULUH 1SQ2N 4ZS6C 4HJGB 4F7TB 4I77L 4PB9H 4XP4L 4AK1A 5DD5H 4HG4J 4ODBD 3U30B 2BNQE 4P46A 3I3BA 1KXTB 1N2RB 3D85D 3SBWC 4EN3C 4EVNA 4AQ1B 3DSNA 4N8VA 3QFJA 3U46B 3P11H 1OAXL 3QT2A 1TVHB 1AR2A 1B3JA 3EDEA 3F7RA 1H3VA 2NY3D 1WWCA 3GO1H 4Y4KC 2DJSA 5CCKL 1D6VH 5J1AA 4MGXA 4LPWA 4RSVA 5HHMD 4NM4L 1QFWM 3S37H 3JWDH 4KPHH 4ZOBA 3OMZA 5KAQF 2H41A 5TQ2L 1KG0A 1T03L 1NBZA 3KXFB 4WHYH 1SMOA 4ESKA 3PHQB 5D7SL 2ZUSA 3QUKA 1JIBA 4ZMAT 3DETD 1PG7X 2HG5B 2R69H 3CCHA 4TSBH 3VU2A 4NZTL 1CL7H 3LRHA 2VLJD 1PKQE 3OB8A 4ODVH 4G9FA 1MHEA 1F6AA 4YLQT 3AROA 3O9WB 1GGUA 3MA9L 4PP2A 2UZXB 3BEWB 4IRZL 4NBYB 3VFTB 3SGDH 4JPWH 4NNXA 2OM5A 3U1SL 2AXGB 5A1AA 3U82B 3RPIA 4XH2B 1E4KC 4PD4J 5EZIH 3EYQC 3TWCH 1RUKH 3WHXB 3QDME 4PJ7E 5FYKD 2X1OA 1JHTA 1MLBB 3RJDA 1HH6B 2JJWA 1CGXA 5DDHB 3MLWL 4DN3H 2E27L 3UPRB 3TEUA 1RVFH 4MAYC 3FOMB 1EO8L 3PHOB 4DGVL 1A14L 1CE1L 4P23A 1J86A 4DQOH 1QNZH 4M61B 4NQED 1FSKC 3UTQA 2VLKB 3C5ZB 4JQIL 1KCUH 2JJUA 1GSMA 2C3WA 3GMRB 4AIXA 1J0ZA 1JGLH 1TVBA 3QUMH 4HGWA 3HFMH 4NQDD 1BFOA 1FGVL 5T3ZD 2EDNA 1XF4A 3OBAA 4WU5B 4N0UA 1EVTC 1VDGA 1HSBB 2APWA 3H0TB 4R2GB 5DJYA 3LN4B 5L8KB 1HYSD 1FBIH 4ONHA 2AJYH 4ACPA 4FMKA 2EDOA 4OF5A 3NZHL 4P59L 3BIBX 3QXWA 5LGJB 5K59F 2G5RA 4PJ5D 1S9XA 1ZLUH 3RDTD 1KFAH 3S97C 4WVRA 2G2RA 2JCCF 3TO4A 1P6AB 2G75B 1QR4A 3HNSL 1TFHA 3GKWL 1OWWA 4N8CL 2Z93B 5ID1A 5MI0B 4RBPK 2IGFL 2DQIH 3TNMA 1EX0A 4XP1H 1PG7W 4G43B 1OAQL 3VJ6B 5E8PA 2X1XR 5GRVL 3REWA 4M4PA 4XRCB 2IQAB 1XGYH 1WZLA 3P4MA 5E24E 2XG4A 3KPQA 1NC2B 1J0HA 4UV7H 4Q2ZA 4OLUH 2ESVD 1LK3L 4X5XB 5GS0C 3TCLB 4M62L 2BOBB 4O9HH 3TZVD 3NABH 4R9HA 5IWLC 4HWEH 1GZPB 5CEZH 2ERJB 5IB5A 5DD0L 3MUGA 5GGSY 3S3PA 3O0RL 1LK2B 4GRWE 3WLWC 3ZKND 2HMID 4FQPA 1DN2A 1R6VA 5DD6A 5KSAD 4IRJB 2ZNXA 4UQ3B 3DHJA 3HZYA 2P5EA 1D5ZA 5TFSH 5SWQB 4UU9A 2A74A 3P0VH 4N8VG 4CVXB 5C1MB 5GS0L 4HJJL 5GSVA 1FFPB 3IFNH 5HHOD 1CF8H 5JLZB 4L3EE 4OQ1A 3TYGL 5JNYA 1AKJB 4IJ3B 1VESA 3LDBC 4IDJH 4BQ8A 5C0EB 2E6JA 3U2SB 4ELMF 1FVDB 4QRPA 4V2CB 4JY5L 2BRRL 5HGAB 3DUSB 2ZOKA 3X13A 1OAKL 3SKJL 1RV6X 3IXAB 2ICES 1CYGA 3GSQA 5DHVB 3DRQB 1I7RA 4KMTL 5I1KL 1MQKH 3MBEB 2NXYD 1NFKA 1IAKB 3QFDB 4CRPA 4IRSC 3O8XA 4KKCC 1FVEA 3LV3B 1ZK9A 4AEIH 5F7YC 3LPFA 3RP1A 3ZMRA 1YYLH 4M5YL 1KCRH 1W8NA 1QFHA 3IDNA 3BKYL 1CGVA 5GXBB 5F7LB 3CPLB 4ZDHA 2FECI 4HUWA 4AIOA 2X70A 2O93L 4A6YH 3QULA 1LO4H 3CU1A 4G6AC 4XPFH 2FH6A 3S37X 1DBKL 3L5XH 2ATPB 3PWVB 3OJVC 4JFFB 4P5KB 3QRGH 3RI5K 1HZHL 2EKJA 3WN5B 5EBLA 1XF3B 2Q8AH 3H9SE 3I02B 5IK3A 1VFUA 4WFGD 3MCG1 1MCDA 4C4KT 1C08B 4PJBA 3WSQH 4I0KA 4PRPA 1AFVH 5AZEL 3N0PB 4JFEE 2P5WB 3D18B 3LKOB 1SJHB 2VWEC 1AQKH 1ONQA 5DMIH 3ZT7A 5H94B 3BP5B 4NP4L 4R26L 3MOQA 1A5FH 4P46C 4POZC 1XEDA 3BHBA 4JLRB 4ISVA 3KPTA 3BPNC 1KPUB 3QHFH 4MJ6A 4JDZA 1DBAH 5TE6H 3F8UB 5ILTL 2YC1A 4GW1B 1F58L 4P9MH 5M94B 2HFFA 2XICA 3PP3K 4D8PB 5HBBA 4HHAA 1MAJA 5D1XB 5DD3H 1WZ1H 4NWTL 1VHPA 4XNXH 4U1KB 4BSJA 4Q6YA 3CD4A 5EU3B 5DXWA 3JBG7 1BAFL 3UO1H 3AXLA 4JFXA 1QUNA 3D39B 2CKBL 2UWEF 5J3HC 1YEEH 4TOYL 4LL9A 5I1CH 3RVUD 5KS9A 3CFKA 1A8JH 1RJLB 4HT1L 1GIGH 3GHBL 1GRWA 2CDGB 4I77H 5JHLL 1BQSA 5HPMB 4PJFE 3P9LA 1XF5A 4MA3B 3KJ6H 1UXWB 1BEYH 1QTYT 1WFTA 1ACYL 1CK0L 3A6BL 1QSFA 1S7XA 2X42A 4EUPB 1KEML 2IFFL 4HC1A 5C08D 1T83A 2EZ0C 4GLRI 4WI7A 5CBAB 3T65A 5CCKH 2OL3A 4W6XB 3ZDXF 2HJFA 1INEL 2MQ3A 2WBKA 2XY2A 1WQVT 5TQ2H 3CFCL 2NXZD 1TCRA 1T6VN 1ACZA 3EO1B 2NY0C 3QDJD 5D7SH 3RVWC 1KENL 4V1DA 4XI5D 4HIIA 4P23C 2DIAA 4G6KH 2GJZB 1IAOB 2R4SL 1BLNA 3BW9B 2DYPA 1U8HA 2GK0A 4JFYA 3ME0A 2QR0A 4RDQF 3ULUF 3EO9H 4L9LA 4PJHF 4XCNB 4WO4D 3MV8B 3KYMA 2YD4A 3MRHA 2HT4C 3NH7L 5IUSA 3TFKD 1U41A 5C0DA 3U1SH 4RIRA 3P0YL 5IJVB 5C6TH 3ROOB 4UOW1 4LK4A 5F3HB 3PWLB 2UZIL 1KIQB 2DWEB 3KPSB 4YK4C 4NQCA 5MP6H 3T1FA 4GO6B 4P2YA 4XBPA 4AH2B 5J13C 3OB0H 4XBGA 4DKEL 1KTDB 5DFWH 1FC2D 3MLWH 3U0PA 3TO4C 4I5BB 4UOW0 1JNHB 5GSRA 3T08A 4FS0A 5DJZA 5IOPA 2YUXA 5D72H 5HJ3B 3OV6A 4MA1C 3O2DH 4JZOB 5ACMA 3GMMA 2DLFL 1RIVH 1EEUA 3BZ4B 1I1YA 2Q86B 1XGRA 1FGVH 1D5MB 5BV7C 4MDJA 1BVZA 4F7MB 3R0NA 3ETBF 2QL1A 2Y5EA 4EJ1C 2EE6A 1D9KD 2IBGA 5HGDA 2VLMD 3IDXH 4UT6L 4P59H 4HMCA 4OCYH 2APVA 3LD8B 1AGEA 3JV6A 5GISL 3BUYA 4PJGF 5J6HA 2IANE 4Y5YA 1MFCL 1WWWX 2OJZL 4FQCL 3BFOA 4XTRD 3HNSH 5DFTA 4R0LA 2I9TA 5IBLD 3IXTB 3ARPA 5BV7L 4LVEA 2DQFA 3O45A 2YD1A 3WUWA 2OJEB 1UYWL 4BM7A 4YHML 1VPOL 4LLQA 4N8CH 4O5LL 5DURD 4NSKA 3MRJA 1I1AB 1V3LA 3FT4A 3EFFB 4G8FA 4UMGA 3ZTJH 3B9DA 3WO4B 3KNBA 5CLTA 4MNQB 1OAQH 5DK0B 3TNNA 1P7KB 2MKLC 2DM3A 1PGRB 5DJXA 2GJ6D 3IJYA 4BFGA 4ZS6D 2WWMD 1PYWA 3LPWA 3MFFB 4L3AA 3DV6B 2P7TB 3HB3C 3QO1A 3QEQE 1R3LB 2XQBL 1LK3H 4J7RA 1F5WA 4GBXA 4M62H 4MA8L 1KLUA 3FT3A 1X6LA 1JPTL 2PTVA 3QQNA 5D7JB 1S7RB 4ZPVA 3W11C 3CDGB 3MOBL 5EIIB 3BSZL 5K9OB 1IGTB 2QSCL 3DX8B 5J11B 4DZ8A 2IAMD 1JUFB 3FFDA 1DE4B 2QKIB 1FVCA 1FG2A 2NX5A 2OI9B 3O0RH 15C8L 5D7LA 3O8XC 4RGOL 2R2CA 1CFSB 3AC0A 4ZSOA 1ORQA 3VE0B 1AJ7L 3P9WB 5DUPH 4QF1B 2V2XB 4JB9H 1WC7B 5EO0B 4JGUA 3DECA 4P2QE 5LGKA 3STLA 1U8JB 2Z8RA 3VGDA 3CX5K 4JHWH 2YWZA 1P5VA 3AMLA 3V4VL 3DURA 1J8HD 2RIKA 3ZDZF 1CD1B 3L6FB 4FP8L 4OKVB 3F12B 4JY5H 2YD6A 5CEXB 3BQUB 3T0ED 1M4KA 1BIIA 5DQDL 3DI3B 1RZ8B 3Q6FA 4KMTH 5FA3B 5I1KH 4MHHG 3QNZB 2Z35A 2B8OT 3OKLB 3MREA 2HN7B 5C2BH 3MLPA 3EYQD 1Z9OA 5E6ID 5SX4I 1LVEA 1QSVA 3IJHB 4HH9A 5FM4A 4GW4B 1P7QA 5LG1A 1UWEL 3TBSB 2BSRA 3P9MA 4M5YH 3JWOH 1ND0B 5DSCA 2QSVA 4MAYD 4JFDB 1MJ8H 1G6RB 3BKYH 3SY0A 2JJTA 4YJZL 2D7OA 3CIQA 1AHWA 3FN9A 5MEOB 4LF3B 1X7QB 1LEKB 4YO0A 5FYLE 4FQHB 4LHQB 1BX2B 1F13A 1Q9OB 1NCBL 1UWXK 1BQHB 4WUKH 3LKSB 1G9MH 1U92B 1HZHH 2E5EA 5BS0A 5DVKA 3MJ8A 3W81A 2RR3A 4OZFH 5E5RB 2H6PB 3BEVA 4B53A 3QHZL 4M1CD 3SKNA 2H26A 3O4OC 5AAMA 5D1ZB 3M1BA 5CP7B 2X4NA 3JV5A 2VDQL 4JGJA 3RKDD 4LSVL 4NP4H 1U0QA 4JQVA 1H3TA 4Z7WE 2VQ1B 3P30L 3ZTNL 3MMEB 4GG6F 5HGBA 5ILTH 5KOVC 3TBVB 5K9QG 1PLGH 1T83C 3ARYA 1F58H 3PUCA 1IC1A 1HI6B 4P3DB 1NLBL 4YHYC 5CSBA 1NL0L 2JCCB 4BH8A 5EOCL 4NZJA 4KC3B 4KUZL 4BUHA 1W72A 2XWBA 3WUWG 2YD3A 2W65B 2GFBA 1DBJL 4PRHA 5CSZA 2CKBH 4HKJA 3H3PL 1FZJA 4YHLL 4ZNEA 4OGAD 2CIIB 1QRNA 4LCWD 1U91B 4HT1H 5CIPH 2OL3L 5JHLH 4L9LC 4Q9QH 3BPOB 4M03A 3L3HB 2AEPL 2X9YA 4O58H 4E0RB 4HWNA 1CK0H 2K9UA 4Q74A 2VL5A 5KBNC 1KEMH 2IFFH 3LN9A 1P1ZA 1DN0B 3K8MA 5GHWH 1CBVL 4V2BA 1WBXB 3LY6A 5JW5A 3OKEB 4HWZA 2Y7QB 3BKMH 2BNQA 3VXSB 3S8WA 3OF6D 4Y5VA 3WLBA 4FMFA 3CLEL 2A38A 4GKZB 2H3NA 4F58L 5B3JF 1A7PH 4U6YA 3X11A 1I1RA 5ID0A 4Z7QE 2B39A 3D25A 1KENH 5BZWA 4TUJA 3GJEA 5I73C 3Q2CA 4KJWD 4LKXA 1TNNA 3TT3L 1OAYL 4U3XA 3KYKH 1ZHKA 3PF2A 5FO8B 4ELMB 6CGTA 4KKCD 2AJVL 1WBYA 4PREB 5L2KB 5CHNB 3KXFE 5ETUA 5ISZD 1NBQA 4CJ0A 4KRPC 3P0YH 3BZFA 5D2NB 3ABZA 4FTVB 4OFYD 1NGZB 1JGUL 2DQTH 3BGFC 3NCCB 1ZWIB 43C9B 4DKEH 1Q1JL 5DRWB 2FCBA 3QQ9C 4Y5YC 3EDFA 2ZKHH 4ZAKB 4R0LC 1T1XB 5E7FA 1U8NB 3BKJL 5MHSD 5DJ0A 1LDSA 5IROC 3ALWA 2ZUXA 4HWBL 1CFQA 1JF6A 1SEQL 4PJ7A 1J5OL 3SGDI 5F6HJ 5FYKL 2HA1A 4X4YB 3NVQA 1CLZL 3UZEA 4NO0D 4GS7C 1DR9A 4LCUB 1FNGA 4G7VL 1MCJA 4PJIF 1RZ7H 5FYJH 4J23A 5K33A 3MRGB 3RIAK 1EHLL 4PRAA 3D0LB 5A3IC 3W82A 3CSGA 1LD9B 1MSPA 3VFSB 4GBXC 3AAZA 2XNAA 3JWNC 3GIZL 2ADGB 1CS6A 3QFJD 1T4KB 4LPVA 3GIVA 5DEGB 4QXTA 4Z76A 3HRZB 4QO1A 5T3ZL 3JTTA 5IFHH 3HS0A 2YZ1A 2OJZH 4JRWA 5I30L 3L3DB 1CFTB 3V4PH 2XFXA 4U1LB 4LPUA 4QRRE 4Z0XA 1FL5A 4JFQA 1UYWH 2GY5A 5EU6D 3GMLB 4ALAL 1EIBA 2C1OA 4O5LH 4OZHF 3OR7B 1RK1A 5F1IA 3CMOH 3PGCB 4KHXL 2JB6B 3GFUA 2CLZA 3EIFA 5KJRL 5J3HD 5HDOA 4P2RD 5F6HI 3HE6B 4FQIH 3F6LA 2NY1D 4P9HC 5IB1A 2H8PB 3HE7A 5AYUL 4X7EC 4OM1L 5IESH 1MCWW 3UJTL 5EU5B 3FTGB 2XQBH 3KLSA 1YNKH 1GHFH 5E00A 3MXVL 4MA8H 5IGXH 3B5TA 2YXFA 1S7VA 2UWEB 3BSZH 2QSCH 1B4JL 4K3HA 1M7XA 3L5HA 5F1KC 2KQMA 5GZOC 4DTGH 2X4TB 1ORSB 4FQ2L 3CXDH 1DQDL 3WFBL 3QA3B 4MXWL 3B5HA 1C5BL 2FGZA 4G8GB 2A6DB 2F5BL 3IRZA 4TUKH 4R7DA 1U95B 1T1WB 2JJTC 5E70A 1T7XA 2X40A 3OHXA 1X5AA 1AHWC 1QFWL 4HBCH 4QTHA 5BO1H 1J1OL 3G9VA 1CE6B 3MUJA 2K7PA 2BVOB 3BYTA 3WJLC 5C0JA 3F58L 3ILQC 4I48A 3IFOB 3RWDA 3SCMB 3V5KA 1XGTB 3QIUD 3WUZA 5L8JB 4XC3L 1E4JA 5DQDH 4L3EA 1CLCA 3ZYIA 2EDBA 2L7UA 3EBAA 3P0GB 5CUSL 3H9HA 4FQJL 3SE8L 4J3WA 3B2UC 2Z4QB 4WI2A 4OCLC 2Y6SC 2NW3A 4OIAA 1N0XL 4LVHC 4PJHB 4HUVA 3MNWB 2XZAH 4QTIL 1UWEH 5K9KA 4FQXD 5DZNA 2YEZA 2ARJB 3STZA 4D0BA 3C9NA 1CDHA 4JQVC 4KUCF 3KPRA 4OAWB 1R5VA 2IALB 2VR4A 5HYJA 4BA8A 3G6DL 1AD9A 2VLRB 4WUUB 4XT1C 1I7ZB 5DC0A 3IDUA 4ORGB 3HCVA 4KKAC 3FB8B 5I1DB 4OUUA 3PIQB 5DTFA 2NW2B 5KSBF 1EV2E 4PTUA 2BVQB 2AJZB 3HPLB 5IF0A 4PP1C 4EQ3A 3OKKA 5CWSB 5DLMH 4K3EL 4BYHA 1CIUA 5KSVA 3SDAD 3IDGA 4J3OC 3VDBA 5FCUL 1T1ZB 3BN9C 5CGTA 5IP4A 2P46B 4MS8C 4Y1AE 2AJXH 2J88H 3PV6B 3QHZH 3ET9F 4QHMA 3V0AC 4HF5H 3H9SA 2VDQH 4FXGA 4JFFE 1PBYA 2ZSVB 1F4XL 3QJHB 2MHAA 1RUQL 4I4WB 4X9HA 3SGEI 1VACB 1X5ZA 4GRLB 3DX6A 3AGVA 5E0QA 3G6AA 3PE9A 4JFEA 3MXWH 5H37G 1XCTB 1IZKA 5FA4A 3WKNA 3NAAH 4M7LH 4ZUTA 3CDYA 2P5WE 1RMFH 1V7MH 4PRBB 1ZLVH 3FZUC 4PJGB 4Y5VC 1MHHA 1NL0H 4RQQA 4HLZG 5EOCH 4KUZH 1LEIA 1NMBL 1FLRL 4D9QE 5DJDB 5DD1L 1NAKL 1UA6L 3IF1B 4YFLI 1U6AH 3QO0B 4JFHE 1R3JB 1XGPA 2YUVA 4MB3A 4D3CL 5DRNB 4WTWA 1DBJH 2FGWL 1WITA 3H3PH 2AJSH 4D9RE 3ARVA 4QLRA 25C8H 1BREA 3CVIL 3VI4E 1E4XH 1N3NB 3QUMB 4YIQB 5FF6B 4PV9B 4HZLA 3RWGB 1UEYA 4N90D 1YMMB 5T1LB 3MV01 1NAMH 2AEPH 1O7VA 3AU1A 2YHGA 4L9DA 1INQA 4ETQB 4P4KB 5KVFH 3VGFA 4KKLC 2YD8A 4C56B 4Y89A 3VFPB 3D39E 5DR5L 2CLVA 5C71A 5C9JA 1YUHA 4IMLB 1T66C 5T1MB 3C6SA 4PYHA 4PJFA 1MCRA 2AI0L 4QCIB 5I76A 2Q3ZA 1WCBB 3H7BA 1HHJA 4JPIA 3MCLH 1RHHB 2IMNA 1R5WB 5FFLA 5ICZA 2DQCL 1KBGH 1P4BH 1AY1H 4CVWA 3MACL 3BVNA 3TYFB 5C92A 1OQXA 4IS6A 4PRPD 1GGTA 1B0GB 3SJVB 5HVHC 3ZZ1A 2O5XH 4OFDA 5EC1B 4OCRL 4AENB 3WE6A 3C60A 2AJVH 2HFGL 2CMRL 4HUNB 2ZP0T 5ABDE 5F89B 5ITFB 2XZCH 4YDVA 1BJ1H 1PX3A 2ARJQ 4TNVF 5C8JB 1N5AA 2R0KH 3C87A 5IIEB 2B2XL 3CFIC 2VXSH 3E0GA 1JGUH 1Q1JH 3STBA 4R90H 5FO9B 5C0GA 4BH7A 3SO3B 3MLXL 4W6YB 4R96A 3CSYB 3T0BA 3BKJH 4P5TD 2WBWB 4RMSA 4HWBH 3DMMD 3NFPB 1SEQH 3U7YH 1A2YA 3B5GA 5JW3L 5FYKH 1XGQA 3TBWA 1CLZH 2DQHL 3C6LA 1ZT7B 4G7VH 3RWCB 5E1AB 4QRTB 1UM6L 4RMWA 3U9PL 4JZJB 3PXHA 3HE7C 1J05A 4I0PA 3PGDA 3GSVB 3QCTL 4D9LH 1JPGA 4KXZH 5GGVL 2OZ4H 4ONFL 3H3BC 1G7QA 3ROLB 5ESQA 1EGJH 1K8IB 3GIZH 1A7BA 2BVPA 3B43A 2EYTB 1MJ7L 1HNFA 1NGWB 4M8QB 4JCLA 3B9VA 2N7AA 5FGBA 3MRFA 5T3ZH 5ALBL 3RUGF 2DL9A 4UT9H 4NDMB 4GAFB 1XR8B 1S5IH 2MTPA 1A3LL 4K2UL 4K7PY 4JM2F 2X10A 4GG6B 4MXQC 1MWAB 5HYQB 4LCYB 4KHXH 2FSEB 3RL2A 2IANA 2PN5A 3D6GA 2F53B 5DVLA 2PTUA 4A6YB 2AQ2A 2BCKB 1A02N 3FB6A 3MRRB 3H3KA 2NNAB 3MLZH 5J9PB 2COQA 2EYRB 1M71A 4MNQE 3HC0B 4AMKH 5MEQB 2AEQL 3FFCD 1OLZA 5DJCB 3QI9A 3QEQA 3ARDB 4JKPL 4L1HA 1CLOL 4NKMB 4Z95L 1DQDH 4MSWA 1FQ9C 3BP4B 3Q48A 3OR6A 3WS3B 3UTSD 3N85L 2PTTB 3UC0H 1EJOL 1IM9B 1J1OH 2GSGA 2ZG2A 4PB0L 1HHKB 2R29H 4XWOD 4Y19B 3F58H 5FO7B 1B6UA 3MV7E 1GGCH 1W0WA 2Z31A 4P2QA 35C8L 4XC3H 4NBXB 3K80A 1H5BB 4X6BA 1NDMA 4OD1H 4ZOCA 4KRPD 3NIFF 5EZOL 4OGXH 1TENA 2NZ9C 1G7MB 4FQJH 1JZ6A 1OTTC 2WUCL 2NY6B 3ARFA 4FZEL 3WXWL 4U1MB 4Q97A 4MD5A 2CGRL 1KTLA 1TZIA 1BD2D 2ED7A 1YEDA 5M95B 2R0ZL 4ZFFB 1IKNA 1GAFH 2QQLL 4KI5E 3KJ4C 4RX4D 2CO7B 1RJYA 3NCBB 4HIHA 4HS6B 3NIDE 4Y2DD 5DGRA 4CAGA 3C08H 2DLHA 3GNML 4HGMA 1M7DB 1VSCA 1NCCL 3IJSA 3MYJB 1WBZA 5I16A 5FB8A 2FEEL 1EXUB 1YN6B 4MJ4A 3VRIA 1A6ZB 3OG4B 2QHLA 3ARGA 3QPXH 5HYSA 3JTSA 4DUXA 1KJVA 3TF7C 3MNVA 3MRCA 4JFDE 4K3EH 1FPTL 4U1HA 5J0BA 1U3HA 3U36A 5MEND 5I75C 2OSLA 4LLWB 2XA3A 3MLYL 1KYOK 2E7BA 1VGEL 1YPZE 2A6IA 1EFXA 5E8OA 3D3VD 3QEUA 4M5ZH 4PJIB 3NPSC 2NX5D 3UJJH 5EN2A 1MFDH 5C09D 5F71A 1RUQH 1CICD 1RUPL 2ADFL 5KTEL 1X5XA 3CVHA 5D5MF 5D70H 5DGQA 1IT9L 4Z8FL 3ZKSD 3VG9B 2M8XA 4PGCA 2YUWA 4YPGB 1N8ZA 1V5JA 2EEBA 2DI9A 1FN4B 1KELL 4ZTOH 4KY1L 4Z7WA 2Z91A 4H88L 4APQA 4TPRH 3GEWB 2PCPB 3LEYL 2FX8L 1I3GL 4H1LA 3BDXA 1MCSA 3MJ9L 4L4TD 1CXFA 4E9LA 5F44A 4P3CL 1NAKH 4WCYL 1UA6H 1RZKC 2VLLB 2PO6A 4OZHB 4D3CH 5DJ2B 2V2TB 1XF1A 2AXFB 1JGEA 5IW1B 3KPOA 4KTDH 2VABA 2BK8A 3VXTA 4YR6A 1YA5A 3NA4A 5GZOD 1JJUA 4DGYH 3C60C 3GUTB 1J0YA 1GYAA 2WM0A 4NRYA 4AEFA 4YC2B 2XV6B 4H0HB 4NHCL 3LPGA 5HGGS 3ULSA 1NBYA 4O2CA 4WFED 1EHXA 3SDCB 5DR5H 4MCZA 2FX9L 4G7YH 5IFJA 5CD3A 2OTUB 2VITA 3FO2B 3QZWA 4RISL 2IMMA 4HFUL 1QVOB 2J12B 1CDIA 1MJJA 4RGMB 5AWNH 5LVEA 1F4AA 3EYUL 3ILQD 1UB6B 4NQVA 1HHGA 3W2DH 1FZMA 4X8XA 2ENYA 3ARED 4YGVA 3IDJA 5JXAH 4U7KA 4CVZA 2DQCH 5C86A 3OKMB 5F7KC 4DZBB 3QXTA 5IVXE 1G7PB 4NKOB 4FXKB 3ZKXC 1N7ML 5CSGA 1OPGH 3B2UD 3C6LC 3VXSE 3UTTD 5TF1H 4KROB 1N2RA 1FH5L 4MB5A 1MCOH 3U46A 4BSVB 4WU7B 4CMHB 4Z7VF 1V8HA 2HFGH 2CMRH 4I0PC 3VMPA 1TVHA 5C70A 1NH6A 4KJYB 4MQ7B 3TJEL 3IVKB 5LCVL 1EH9A 4QYOB 3U7WH 3PJSA 2A73B 2C9AA 5FGBC 3RZCA 3KXFA 2DD8L 1J88A 1FNFA 4ELME 1YEGL 3PHQA 1HH9B 4LHUB 4X6FB 2HG5A 2VDRL 3GBMH 4HSQA 1E6JL 4YE4L 3D87B 3LZFL 4I13B 4DAGH 5E8NB 3WFDL 5D2NE 1RK0B 4JGMA 4XBEL 5JW3H 2ZUQB 3DX9B 3O9WA 4AEEA 3OGCB 3BEWA 2FZ3B 4MS8D 3FL7A 2NY2B 1QRND 3R8BB 5JW4Q 3VXNB 3GM0A 5DI8B 1UM6H 2XN9D 3U9PH 5KSBB 2AXGA 3U7AA 1E4WH 4XH2A 1KN2L 3VA6A 4Z7NF 5KSUB 5HYSG 5T5NF 1G6VK 3ZL4H 5JXEA 4WGVB 4K71C 3WHXA 4OB5L 1HKFA 1TJIH 3CH8A 1HH6A 3QIWB 5DDHA 2JE8A 3DYMA 1MCBA 4LKCB 3UPRA 4WW1B 3QI9C 1GGYA 3FOMA 1QFOA 3HNTH 2BNQD 2YS4A 3PHOA 2WBJB 2VQUA 3P77B 3VI3F 1A3LH 4K2UH 3ARBD 4M61A 2PR4L 5IKCB 2VLKA 3C5ZA 4FQQA 3GMQB 5DUBB 2VZ1A 3S36L 1T7VA 1Y6KR 3EYFB 3FONB 3I3EA 3P40A 5JOPE 4QRRA 1HSBA 5LWYH 3V79C 3H0TA 3LN4A 2Q87A 4RZCB 5H2BB 2G9HB 3FRUB 1Q0YH 1V3MA 1IQWL 4H1LG 4HPYH 2WW8A 4Y4HB 2B0SH 3DSFH 3AFLA 5LGJA 4I3RL 1CFBA 1AIFB 2CRIA 3HPJA 5IEHB 2BY3A 3MX0A 4RRPA 1KJ2H 4OZFB 2G75A 2AEQH 4CMMB 4WHTB 3ARFC 4DN4L 1LP9F 5ANMB 5F9JB 1CLOH 1KV3A 2DL2A 4Z95H 2Z93A 3P4OA 2A0LC 3ZHKA 1IKNC 1MHCB 4G43A 3N85H 2IBZY 4MNHB 3QDMD 3W0WE 4JHAH 4XRCA 1PJ9A 2DLGA 4XP9L 5ACLA 3QIBD 2WV3A 4PB0H 1NC2A 1LGVA 3BZDA 3EYVB 1OP5H 3CFEB 1KACB 3HG1D 2X09A 4NN7B 4X5XA 3TCLA 2XTJB 1UZ6F 5DHXB 3BPLC 2BOBA 2VDMH 3ARGC 2XKNB 1RULH 1K3ZA 1GZPA 4JY4B 35C8H 3NOIA 3MCKB 3ZE0E 2PXYA 1U3HC 1LK2A 5EZOH 4AT6B 2Z0BA 3FQTA 4HG4K 2CKBB 2QTEA 3VMNA 4Y4FB 2VISB 2YKLH 4IRJA 3ZDXE 4UQ3A 3WXWH 1A3RL 5CIPB 4P49A 5SWQA 3BWAB 1ZE3C 4X80H 3BP7B 2NY5L 3OX8B 4CVXA 2R0ZH 3RTQD 3N50A 1FFPA 4WIQA 3UMTA 4YUEH 1RUAL 5JLZA 1AKJA 2V5SA 5C0EA 1OSPL 4A2LA 1FVDA 1KC5H 4XZUB 2LABA 3L5WB 3EOBB 4HLJA 5HGAA 4DW2H 3DUSA 2CR6A 1CDJA 4JO2L 3ULUE 3DGGB 4PJHE 4APQC 4BQ9A 5DHVA 5J4MA 4PLJD 3DRQA 5D93C 2OP4H 3GKZA 1CLYH 3MBEA 1IAKA 4LFHG 3QFDA 2PO6C 2Y07L 1R24B 2VLRE 2CJUL 4WUUE 3LV3A 1KXVC 2J6EH 4F7EB 4J2XA 4TVSa 4NZRL 4XNQA 4PD4K 3UBXI 4YDJA 3WL9B 4K94L 1UXSB 3L7EB 1RUPH 5EOCJ 3CPLA 4Y1AA 1QKZH 1GH7A 1NANI 4Z8FH 5ERWB 3MLVL 4K9EL 1MHPH 2ZNWA 3PWVA 2ATPA 2P4AB 4P5KA 4JFFA 5GGTA 3WN5A 1XF3A 5JDJA 4KY1H 3GMNB 3RUGB 4H88H 3I02A 3VWKB 3QUYD 1I3GH 1CD8A 4YHKL 1C08A 4MD0A 4JM2B 4LAQL 4WWKA 3TC9A 4QOKD 3RGVB 2P5WA 3I6KB 4DUVA 5TDPB 2HFTA 4L3ED 3HHRB 3RA7H 1SJHA 1UCTA 5H94A 1HIML 1CVRA 3BP5A 4L1DA 4EI5B 1S3KH 3ARXA 3LKRB 5IM7B 1F11B 3CSPA 2CRYA 4PJGE 4XX1E 5ADPL 2M1KA 4JLRA 1FFNB 1KPUA 4ZS7H 4U1JB 1MFEH 2OX5A 4MMXC 2MQ0A 2A9ML 5F70A 4NHCH 3G5VB 4D8PA 2FH8A 2FX9H 4RRPG 4K3JL 4NJ9L 4HFUH 4U1KA 4LRIA 3REVB 1JPSH 5I74B 3RZCC 5EZJA 1YMME 1E4XI 1JN6B 3RWEB 4DGIH 1I8IB 1PQZB 3D39A 3QH3B 4TN9A 2Y9RT 9CGTA 1QSED 4C56E 3F7YA 4LEXL 2EKSB 4LHJB 1OHQA 1BJ1J 3T2NL 2ADJB 5HHQA 4HXBL 2VZ3A 3O9WC 5HPMA 1WICA 4KK8C 3IDIA 4MA3A 2R9HD 1N7MH 2BY1A 3T4AB 1UXWA 1P7HL 2VSDA 1C5CH 1FG9C