2AJVH

Crystal structure of cocaine catalytic antibody 7a1 fab' in complex with cocaine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
EVKLSESGPGLVKPSQSLSLTCTVTGYSITTNYAWTWIRQFPGNKLEWMGYIRSSVITRYNPSLKSRISITQDTSKNQFFLQLNSVTTEDTATYYCARYDYYGNTGDYWGQGTSVTVSSAKTTPPSVYPLAPGTAALKSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antibody 7A1 Fab'
publication title Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
pubmed doi rcsb
total genus 41
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajvH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajvH01
1MQKL 1QHPA 3TH2T 5C8JB 4D0BA 3DTXA 1KUMA 4WV1C 1KIPA 4J7RA 2VZ1A 4HX1B 4JN2B 3QG7H 5GGSY 5KSUA 3WUZA 2LU4A 4OLWH 1IAOB 1NCNA 3CIQA 1ODAA 4WCYH 3PGCB 5EZLA 3TZVB 3MNZA 5EC2B 2E6QA 1QPPA 5HY9A 4Z7NF 3F7VA 3TV3L 3W9EA 1FFPB 3MJ6A 1UH3A 4JG1L 1W72B 4P5MB 3ZKNC 4Q9QL 4X9IA 2W0FA 1VFAB 3QYCA 4PJ9A 5D4QA 8FABB 4KROB 4Q9RL 5T1LB 4LCCC 5JTWA 3T0EB 3SGEI 3JWNC 3C60A 4LPUA 4PIRF 4XB8A 4TUKH 1GZPA 1TZIA 3AVEA 4UT9H 1M1SA 2J6EA 3BVNA 3FFDB 4U2YA 1CFTB 3B2UD 1LEKA 2B0SL 4OB5L 2ZUSA 1CXEA 1NBVH 4QRRA 4M1GH 3V4PH 2UV3A 1J0JA 4NDMB 4GG6B 1NCDL 5LKNA 3NFNB 1IGJA 2PYEA 3MLZH 5GZND 1BZ7A 1B6UA 3UYOD 3NTCH 5E8NB 1G0DA 1HKLH 1CK0L 5ITFB 4ZFFB 1NGXA 4XNZC 4FZEL 1RVFL 1RK0A 5F96L 1BQHB 3MBEA 4RAHA 5LGKA 4GRWB 1BOYA 2DQEH 4M7LT 4AMKH 3T0DA 4K23H 1RJLA 3RVTD 3BZFA 3BMVA 1MEXH 1DP0A 4UDUA 4JM2D 1S5IH 5FF6A 3HFML 5ID1A 3KPLA 3PWJA 5I75B 4NUGL 2AXFA 1HSAB 4HC1H 4OD3H 4P3CL 5CIPB 3Q6FA 5ADOH 3H7BB 2GSIB 1IEBB 1QFPA 1KOAA 3GRWA 2X1PA 3Q3GA 2NLJA 2MSPA 1WK0A 1IKNA 3TIDA 1F90L 4JJ5A 4NZJA 3OR7B 5EZOH 2XI9A 4JZOB 3QDHA 3P77A 5DR5H 4QRUA 4LU5H 1BX2B 1ZTXL 2OQJB 3MUGB 4I18A 4X7SL 4LSSL 2CO6B 4PJDB 2NQCA 2ADIA 3QWRA 1ORQB 5MENA 3BRFA 3MXWH 1X5ZA 3ARYA 3DRQA 3GHEH 2XT1B 4DEPB 3BKML 4OIIL 1DQJB 1E6JH 2Z0BA 4I48B 4NWUL 4I2XE 3S8WA 1XIWA 1IGTB 1ORSA 1ZK9A 2OZ4A 3LH2H 3ZHKA 3SE9L 1SY6A 3RL2B 3MRRA 1ZT7B 4G8EB 4L9LB 4ZXBD 5C0JB 4L3EA 5B38B 5CJ5A 4HQQL 2HAZA 4WGWB 5D1XB 2BNRD 4YFEA 1VKXB 4WO4D 1Q9OA 3WFBL 3TBYB 1OTTD 5GPRA 4K71C 1Q72L 5EWIL 4HEPG 4C58B 3CZFB 1T1WA 1KSRA 4LMQI 3CSYA 5KVGL 4I0KA 1Z3GL 3PP4L 4KJWD 4J2XA 1FGVH 5C2BL 3WMSA 4LEXH 4NBXB 1U6AL 3QUYB 5TDOB 3Q0HA 4U1SA 2MFNA 4QNPE 4HWBL 2R9HC 2CLZB 5MHSD 2BXZA 5BQ7B 1DN0A 7CGTA 2P7TA 1MCLA 2FL5A 1WC7B 2VXQL 1L0YA 1NCWL 3UYRL 3RWHA 2YPLE 3GB7A 3GMPA 1I1AB 3JWOL 3DGGB 4JFHD 4MCYB 4K55A 4RWYH 3TBSA 1QFOA 2CGRH 4MNQB 4EI5C 4OCSH 1TQCB 1CZ8H 1UWGH 3UTSB 3CPLB 1FNFA 4NQXB 2BSRA 3VD4A 2NY3C 1ACYH 2GYSA 5J0BA 3MRHA 1M71B 3O8XD 4LQ1A 2WZPD 3MRPB 3TA3A 1F2XK 4YDJB 4P4KA 3S35L 3R0NA 4U31A 4F8QA 2R2BB 3MNVA 2HKFH 4CVZB 1U2CA 4YAQA 2GSGA 4PRHA 5BZWA 4N0UB 4U6HB 1N5AB 3O6KH 2ARJA 2GFBB 3FOLA 4Q97A 5D2NC 5E5UB 3SCMC 3QEQD 5HHNA 5HYJB 4BH8B 2XN9A 2VLRE 1OAXH 4WGVB 4DWHA 2GJ6D 5TQ2L 2Z35B 4PJIF 15C8L 4ISVB 5T1MA 1LD9A 3BP4A 4IIQA 4OGZA 4Y4FD 3G5XA 1QOKA 1OTUC 2HLAA 2VQTA 4XVUD 1I8IA 2XQYG 4H88L 4GUPA 3A6OA 3IJHA 4KGLA 1ZHLA 3HE6B 1XEDA 1EXUA 3HI1A 1RZ8A 5E56A 4ZS6D 1OL0A 2RBLA 2FECI 4HGWA 1AC6A 3OTTA 2YPKA 1VB9A 3TV3H 4TTGA 4Q9QH 2CRMA 1JNJA 3FMGH 3GMNB 1SJHB 4MSWB 4MJID 4PJEF 4ZPVB 5EPMB 3IDJA 4Q9RH 3ECBB 5BVPL 3VWKD 4JCMA 4P57B 5ALCH 5T5NF 3RVUC 5F89B 4Z5RA 4JVUA 3HAEG 4WI7A 5HDBF 4KKAD 1NJ9B 5D7JD 3T0XA 2B0SH 4OB5H 2I07A 4ZD3L 4RGMB 4P2OD 4WDIB 3UJIL 3UO1L 2RFXB 2IALB 1NCDH 5IGXH 4BELD 5SX4H 4LPWA 2BY1A 1CYGA 1V3JA 1GGCH 2AERT 4FZEH 1INEL 1RVFH 1J0HA 1FFNA 2FYYB 3GSVB 2ITDB 5F96H 4XX1E 1NMAL 2XIDA 1RHFA 3U7YL 3PDOB 5C1MB 3G6JB 1FNSL 5BVJB 4PJ8A 3O3DA 4YR6A 4DVRL 3DUSB 4L4VB 4KQ3L 2ZG2A 1NGZA 1Q9KB 1XH3A 2PTUA 3MLTA 4NUGH 4HMEA 1DQLL 2ARJQ 4YO0B 3TGXA 4P3CH 1PAMA 5GGTH 2BVQB 1B4JH 5A3ID 1OD7A 4PS4L 1NC4A 3T04D 1L7IL 2FO1A 2HLFC 3B5HA 4ZNEA 1LO0L 4ZG1A 4QF1B 1NAMA 1T22B 3OGCB 3N1QC 4GKNA 3SDCB 3J8F7 3HMXL 4ETQB 1IZJA 4X7SH 5IHUL 2XKSA 1CFQB 4LSSH 5H35A 5ICXB 5D93C 2EDQA 1FCCA 3MRFB 5A2IH 1KN4L 5F1OB 1BF8A 2HTLD 3LN5B 3MRGA 3BKMH 2BVTA 4WEUD 2AQ1A 2CKBH 1BVLB 2BY2A 3Q48A 1TTGA 4NWUH 1OARH 5FGCE 5T3ZD 1N64L 4PJ9D 4LVNC 3O6LL 3SE9H 4KTYA 4UV4L 1NFDF 3VFVB 3C60D 4Y2DB 1G7PA 4NT6B 2H26B 3C5ZB 1EVTC 4ZYKA 3IGAA 1XGYH 3WFBH 1EHAA 3WUWG 3B6SA 1Q72H 1FNLA 2GCYB 2Y06L 5EWIH 4TVPD 4QRRD 4HK3J 4LLMA 4IMLB 3AB0B 4PJGB 2FWOB 4HH9B 2ICWI 5KVGH 2AV7A 3THML 5KVFL 4JFQB 1OSZB 5C2BH 3NZHL 4LLYA 4HIHA 43CAA 4YWGL 1JV5B 1CD1A 4NC2B 1DBKL 1E27B 1B0GA 3WXVH 3MBED 4HWBH 2XKNB 3GSNA 5IBUB 4PJ5E 1AE6L 3TNNB 1TDQA 3VXNB 2XA8L 5KVEL 2NXYC 3DV6A 4UT7L 1U0QA 2XTJE 2NW3B 3UYRH 4WWID 5LCVL 2WIMA 3S37H 3JWOH 4P46C 4LAJH 1FZMB 4LLAA 4G9FB 4HX1A 4JN2A 2P5WD 2FX7L 4IOIA 4UZGA 3I6LE 3AY4C 3RTQB 4ZO9A 1QP1A 1XF5A 4V2BA 4AM0A 1JWMB 4MNGB 5DQJB 3GMRB 4OFIA 4XVJL 2NY4B 3QG6A 2BVPB 5EC2A 2NY6D 4MS8C 1BEYH 1FH5L 1U91A 2EKSB 1RZGA 1W72A 3MACH 1I3GL 5J57B 2O93L 4G7YL 5F88B 3TP4A 3GO1L 5GRWA 3UC0H 3T0EA 4UAOB 1TVDA 2ZUQB 3ZYZA 1M05B 5C0AD 2IQ9L 4WHDA 4N8VG 2VLJA 2CMRL 4U3HA 3QWRD 5FYLD 1X5GA 2A6KB 3C8HA 1YJDL 3RIFF 2DM7A 1SMAA 5GRVK 4Q74A 1CDBA 1I9EA 4NDMA 4WI3A 3HC4H 1XIWD 2VDQL 1DEEA 3KPTA 4L3ED 5K9JL 5TQ2H 4IRZL 15C8H 2D7NA 2CJUH 3TZVC 1BQHA 1FYHB 2HT2D 2XY1A 3KGRA 4ZAKA 5F7HA 2BNQB 4QNPF 2FR4B 5IFHH 1OAQL 4KFZC 1Q94A 3LKOA 3UZQA 2BSED 3KYAA 4R2GB 3KJ4B 4FQIH 4YBQD 4NGHL 1OAZL 3I85A 1GOFA 5BRZD 5HGDB 4L3CB 1JRHH 4DKDC 4NQDB 4KROC 1IAIL 1T1YB 3MLXL 3L3GB 3GKWH 3MJ7A 1EUUA 2H1PH 2JELL 2HG5B 4LHQB 1QLEH 4LVHB 5I19H 2GSIA 1IEBA 4YGVB 3OXRB 3VXSB 3M17B 3CVIH 5DJ8B 5MP6L 4X9FA 4G6FD 2HJFA 3NVQA 4X6FB 1TVHB 2WLZA 3K3QA 2K3TA 3OKNA 5DD0L 4NN6B 5CEYB 2YD7A 3CFCH 3ZT7A 2YA1A 2IADB 5KG9A 2OQJA 1SYVA 1I4FA 3IU4L 3CC5B 4WW2F 4ZD3H 1XR8A 3NIDE 5LJYH 4HUKB 1YUHA 4LK4A 5K59E 1Q9WB 3UJIH 1ORQA 2HJLA 1Q8MA 3UO1H 4UNVA 5DFVC 1YECL 2F5BL 2VWEC 1Q9LB 4I8DA 4JDZB 3SN6N 5J1SC 4U1JA 1INEH 5I75C 1I9JH 1IGTA 1K8DB 3C9NB 1NMAH 3I2CL 3TA3D 3U7YH 4G8EA 4L9LA 4P4KD 3MUY1 3MA7B 3E2HC 3ZDXE 2JCCB 3QEUB 4BH7B 3PQYB 1VKXA 2IH1B 4PJ7B 2DQTL 4KQ3H 1LO5A 5I8EB 5IB3B 2ICWA 3QUXD 5IJVB 3BO8B 5K33A 4S0SD 4DKFL 4Q9BA 5F70A 5ACLA 2N7BA 3CZFA 2DLGA 2YZ8A 1DQLH 5HHOA 4BQ6A 3QEHB 3NIGE 1HWGB 2HRLA 3RUGF 3ARXA 4PS4H 1L7IH 2A83B 4HIJB 3WHXA 3QUYA 3FQNA 4EN3C 2FX9L 5TDOA 4LPVA 2APXA 5F1IA 3S36H 2UZIL 1LO0H 1CD9B 1WV7T 4NKMA 4QWWC 2PCPB 5IMMB 2FSEB 2CLZA 4EDXB 4F37F 5SWSA 4PLKD 4DEPC 3RAJH 1UG9A 2MJWA 3CJJA 2MQCA 2Z93A 5E4EC 3QWQB 4MCYA 5FM8A 2EDRA 1KN4H 5D1XC 2ICES 5EZJB 4F9PC 5IMLA 2NXZD 1U42A 1MWAL 4UIKL 1ED3A 2AAVA 4ODVL 1N64H 3UTSA 3WKML 3O6LH 4XH2B 4NQXA 2ZUUA 3CDCA 2H8PB 4F7PA 1QQDA 3ARBC 2ZUVA 4FQ2L 1JTPA 3MRPA 4ZPTB 2Q6WA 4YDJA 5KSBB 5DMJB 3DI3B 2R2BA 5D6CA 2QLVB 3GMMA 1XR9A 4OV5A 1SHMA 2IPUK 2OS7A 4XWGL 2R56L 2A74B 3LKNA 3P0VH 5CJBA 3NZHH 4Z7UB 1LE9A 1X5FA 5J1AB 4NC1C 1DBKH 1I1AC 1Q38A 5K9QI 2V2XA 3RWJB 4XZUB 3WCYA 1JK8B 1AE6H 4UTBH 2XA8H 3LAFA 1IARB 1WFOA 5KVEH 4UT7H 1YDPB 5TDPB 5LCVH 4K3EH 3P9LA 5IVXA 5F9WC 1TQCC 4PP1D 4X6DA 1BJ1H 4LNRA 3TC9A 3SQOL 3NCJL 5BZDA 4JB9H 3DBXB 1LE5B 3CXDL 3HE6A 1NC4D 2V17L 3KHQA 2ZSWB 3D1MC 1JYXA 4XVJH 5EOQH 5L6YL 4Y2OA 1NUFA 5F7YC 4TULH 1FH5H 3GKZA 1FP5A 1I3GH 5ECJE 2OP4L 4PLOB 5T1KD 2UUDH 1ZANL 3LV3B 1MAML 3ECBA 2D9CA 3GO1H 1D6EB 4YHKL 3V0AC 4QGTA 5DD3H 1OF2B 3NGBB 5F89A 2IQ9H 3DARA 3OAYK 1OWRM 1OCWL 2CMRH 5DS8B 5HPMB 5J56B 4YBHA 3L3IB 1YJDH 2CXKA 4M1CD 1GXEA 1I8LA 2WBKA 4JJHA 1I85A 3S5LA 2YD5A 1DVFA 1A6AB 1WT5C 4WDIA 2VDQH 5FUCE 2ADFL 2ZP0T 1XCQB 4JRXA 2JE8A 5DEGA 5C6TL 5DRNB 4PGZA 4TRPL 4IRZH 1MREL 3L3JB 5HHVL 2ITDA 4WVRA 4ONGH 4ZDHA 1ZHBA 1U8KB 2WINA 3ZE1E 2WWMC 5BVJA 4EUPB 3DUSA 3WNKA 1A6PA 5J9PB 1MJ7L 4E5XA 1WVZA 4NGHH 4Y88A 5J6HA 4YDLB 3CK0L 3KJ6L 4FHBD 3BEWB 3AREB 3MLXH 3T4AA 4MVBD 3K2MC 2JELH 2ID5A 2NY1B 1MFEL 3WO4C 5JDJA 4D0CB 1KTDA 1ZSDA 2BVQA 1VEOA 2IF7A 4MAUH 4ZO7A 1OGTB 3MRLB 4UNTA 5CD3B 5JW4N 2D9QB 5MP6H 4QF1A 1T22A 2EECA 3C6SA 3OGCA 3SKJH 1T3FA 2QBWA 4LSUL 5CJXA 4JFOB 2IFGA 1ZKAA 2W9EH 5ALBL 2R1WA 2QTEA 3IU4H 5KS9A 1R5IA 1E4XI 1KCSL 3WJJA 3RDTA 3QDJE 1CFQA 4GO6B 3EDKA 5KSAB 2DWEA 1CR9H 4DJMA 5T3XL 1LO2L 1L6ZA 3I9GL 1YECH 4JFXA 3LN5A 1QLFA 4KHXH 4PTUB 3SOBL 1BVLA 2GK2A 1FFQA 4FMKA 3MLRL 3QT2A 5TPWL 4XCEB 2BVOB 4J3TA 3I2CH 1TLKA 2ZUTA 3VFVA 4Z7VF 5JIPA 2VLJD 1O7VA 2Y07H 3L5IA 4JFEB 1CE6A 1MRCH 4Y5VB 1HH6A 3B2VL 2JK5B 5FYJL 3IYLW 2GCYA 5CSBA 4DKFH 5GGVL 1NPUA 4ZFZB 3EO0A 1K8IA 4IMLA 3RY5A 2FWOA 3WN5C 4HG4K 4HH9A 4R96A 4NM4L 4NKOA 4GRLA 5HD8C 3KLHC 1T6VN 4JFQA 1OSZA 3JUYA 4L8SB 5CEZE 1I3RA 2VR9A 1DQDL 2FX9H 4QGYA 3VXMB 3W0WB 1J1XH 1JWSA 2UZIH 5DO2C 4ZAKD 5C6PB 3REVB 5GS0D 4QTIH 1XF4A 1OP3K 5HYQB 4OD2B 4JFZL 4U1MB 4P9ML 5HHQA 4O51A 4UV7L 3MRNA 5HDOA 1AQDA 1CDGA 4X8XA 2ATKB 1XGQA 4LHJB 5DURD 5J6GB 1OM3L 4NUJB 5CLTA 5AAWA 4Y2DC 4RAVB 3C5ZC 4ZODA 3L3OA 1PY9A 3F12A 1FLRH 3GMRA 4UIKH 2BVPA 2EIZB 2EH7H 1R5WB 2XQBH 2D2OA 3WKMH 3ARZA 4RFOL 1G9NC 2EKSA 5DZNA 4NO0B 4LP5A 4U6VH 5GS1C 3LQMA 4CJ1A 4IBLT 5EOCJ 3MCKB 4OCMC 2EDWA 2Z4QA 4O00A 1Z5LA 4N0RA 1PQZB 2UY7A 2R56H 1F11B 4WI4A 3NCBB 4JY5H 5EO9A 4X5XB 2IBGA 2OZ4H 1I3UA 4WY7L 4OSUH 4GS7B 3IETB 3VRLE 43C9A 3BP6A 2VXVL 4ZOEA 2RQ8A 3IDMB 2ESVD 5D6DA 4AT6B 3RTQC 3U9PH 4Z18A 3IDIB 5D7SL 1YNLL 4HS8L 3AU1B 2VDML 3CLEL 2NY2C 1YEKL 1A6TB 1INDH 4P2QE 5JA9A 4WTZG 4P5TB 3SQOH 5JOPD 3NCJH 5HHOD 3DX7A 5HGDA 3G08A 1MUJB 2HFFB 2FBOJ 4L3CA 3VA6A 1G6RA 1EEQA 4Z9KB 3L3GA 1V8HA 2EXYC 5L6YH 2HG5A 2XTLA 4XXCA 2PR4H 1AGEB 2Q76B 4OZ4A 2BHYA 3VRIB 2NY7H 3OXRA 3VXSA 4PRPE 1S7WB 5IBTL 2OP4H 4JO3H 1WEJL 3QJHB 4QRPB 5SWSD 1ZANH 1JPSL 2VR5A 3BZEB 1MAMH 4YHKH 2E8YA 4X6FA 2RAMA 3T09A 1T1XB 4ONFL 1OCWH 1I7UA 5FCSH 2YBRB 2FECL 1ZHNB 4D8PB 3AAZA 2FB4L 1CN4A 1JF1B 4OLXH 3RGVB 1YY8B 1YC8A 3BHBA 4JVPA 4GG8A 2ADFH 3KJ4C 5TGBB 5ENWA 4LVOB 1W72L 2X05A 1LO3L 4JDZA 5C6TH 1NGWA 2WWKO 4KK9C 4Y8DC 4DZ8B 4TRPH 1MREH 2HFEA 4XPBL 5HHVH 4YDVA 2XZCL 1K8DA 3EYQD 5IROA 5H2BB 3VG0H 1S8DA 3MLYL 4NQEB 5F9DC 1RZJC 3QEUA 1ZT1B 5I0ZA 1MJ7H 5GHWL 2KBGA 2IH1A 4X80L 4YEEA 3RWIA 5J89A 1UB6B 5I8EA 1P1ZB 4JRYB 5JOEA 3DVNB 5IJVA 3S3SA 2D4DA 4PJIB 3CK0H 5IHZB 1BGXL 3QEHA 1MFEH 4P99A 4AIZA 4JFFE 2R15A 5JW4M 4HIJA 2EYRB 3ULVD 3QIUB 2XY2A 3D0VB 1N7ML 5MEQA 4R4ND 2FSEA 1TJHL 1UYWH 3LKRB 2DQDL 1TXKA 3I3BA 5EO1A 3S9DB 2CDEA 5TJWK 4QKXB 1C8PA 4QYOB 5DUPL 5F1NA 4ZTOL 3MLUL 3KYNA 5ALBH 4GW5B 5EBLA 1BFVL 5T5FL 5JXEA 3QFJE 1YEIL 3JWDC 4PJBF 3TBWA 2NY5H 4JGUA 3DRTB 5FIEA 4RBPH 4PJEB 3OKDA 3BKCL 4N8VB 1YN7A 2EDHA 1IGMH 3PV7A 2P5EE 1A1MB 3I9GH 3RGHA 2XQYK 3KPMA 5J3HC 4TUOB 3SOBH 1XT5A 4BZ1L 3MLRH 3ZE0E 5FHAL 3TVMA 2O5ZL 5TPWH 4W4OC 4RMUA 1QSFA 4XBEL 4DTGH 2NY0D 3QDMB 2P46B 1A7BA 4U1GB 3ARFB 1KTRL 4P5KB 3MMEA 4XPAH 1CLOL 4LLWB 2WUBL 1XGPB 3OL2A 5KSBA 4UILL 1FVEA 4CMMB 2CO7B 5GGVH 1G9EA 5M94B 2YHGA 1DVFD 3QI9C 4NM4H 4XB7A 1RV6X 4WU7A 4JRXD 4NC0B 1ND0B 1DQDH 1CGWA 2DIAA 3RWJA 5F7EH 4XZUA 1SEQH 1WWCA 5IB2A 1KPVB 5IVZB 2Y5TB 5FO8B 2VC2H 4JFZH 4JZNB 4P9MH 2BCKA 2X4UB 2X4OA 3P4NB 3LKSA 1YYML 2C4FT 3STLB 1RAMA 4UV7H 2WP3O 4EQ2A 5SV3A 5HYSG 2R8SH 3OKLA 2PW2B 4QTHB 1MCDA 4PGJA 5K9OB 1D9KA 3PGFL 2Q86B 1FAIH 5JW4Q 2IWGA 4YPJA 1LE5A 1MCWW 2XWJB 1DE4A 2BNRE 4EIZC 2ZSWA 5DVKA 3IB4A 4D3CL 2HMID 4QHLA 1NAMH 4WFGD 4FMFA 1NBYB 3HZVB 1JGVL 3EGSB 1UVQB 1QBLH 2CIIB 4R8WH 1A9BA 3EYVA 3FQXB 3UTZA 4OLYL 3LRSA 5C9KA 1KGCD 1U58B 4N9GA 1D6EA 4NBYB 2DTML 3RDTD 3VGEA 1DUYA 4XT1C 2V9TA 1AD0B 5HPMA 5MHSE 4ERSL 1HILB 1MVUA 1NFDB 2VL4A 1J8KA 2IAND 3RWDB 4S1RL 4LHUB 4R26H 3MGOA 4JY6A 1URLA 3MRQA 5ISZD 4JKPL 4WY7H 5FYKE 1XCQA 1VFMA 4UT6L 1A9EB 4K3JL 3G5YB 3L3JA 3Q6GL 4KRPC 3BGMB 4XMPL 4FS0A 5IWLC 4PGDA 4HS8H 4YH6A 5JO5A 2VDMH 3CLEH 2VSCA 4EUPA 5MI0C 3UZVB 3WHE1 4OZFB 4K3DL 4GRLD 3MBXL 1CICC 3BEWA 1PVHA 3CVHB 3L95A 4X0KB 3BJ91 4OZGA 3NGBC 4D0CA 4G8GE 4DN3H 3UTTE 5E7FA 5IBTH 3MRLA 1WEJH 4O2CA 5FAAA 1JE6A 3P3YA 3LKQA 3EO1B 5EN2A 1T5XA 4XNQA 4PJFF 3QEQE 4N5EC 4ONFH 5ESAB 1UM6L 2VXUH 3FB8B 3UJJL 3CUPA 3ARQA 2QQNH 1IGYB 2GJ6E 4HAFA 5JPMB 3P9MB 3SEPA 2FB4H 4AJ0A 4LLUB 4ZSOE 4H8WC 3QHFL 3V5HA 1D5BB 4U3CA 5B3NA 4GH7B 1AXSA 1W72H 1LO3H 2VAAB 4YDLC 35C8L 1S78C 1U95A 2BVOA 5INCA 3AREC 2HVKA 3VXRD 3DSFL 5LXGH 4RMRA 4X5WA 1QFUH 5I15L 3MZTA 4X80H 4DAGH 4Y5VA 1J8HA 3FQTB 5IB5B 1RUAL 3VFWB 5EBMB 1C08A 2V7HB 4MJIE 4Y5XB 4LCUB 5J11B 3VXTB 1EAJA 4LRIA 1GGBL 4ODWA 3NIFF 1V5JA 4X9BA 4PYGA 5AG9A 3LS5L 4XAWH 4NN7C 3VXMA 3GDBA 2Y9RT 3DYMA 5E24E 3FN0L 5DMGD 3O2WL 4I0PD 4Y1AE 2YPLB 4GRWH 4MHHI 5KSAC 4HZLB 1TJHH 5FFLA 5HYQA 2DQDH 2NZ9D 4OD2A 5C0ND 1QACA 4CBPA 5DUPH 1NAKL 1QVOB 4ZTOH 3MLUH 2WBJC 4P59H 3PWVB 1A6WL 3IVKB 4QCIA 2ATKA 1BFVH 3T0AA 5T5FH 5C0CA 5CJQL 1YEIH 1FDLL 1XF1A 4WFFD 5CIPH 3TFKD 2VLLB 4I0CC 3OKYA 3BKCH 5I73B 1F13A 2NX5D 4K2UH 4NYLA 4NZTL 4BZ1H 3JV5A 5FHAH 2O5ZH 5E9DE 3WNOA 4WW2B 3LHPL 4KKLC 4XBEH 2DLFL 4OF0A 3O6ML 4HIEA 4LASL 3KPQA 4FQQA 3RNKA 1AGBA 1N6VA 1RJCA 5BCAA 2R2HA 3U30C 2OTWB 1CLOH 2WUBH 4HS3A 1FLTX 4N8PA 3ROOB 3MCKA 4D9LL 3MV7B 2M2DA 4LPYA 4R4BA 4UILH 1E4KC 5F6IB 1MHPH 4HPYH 1T5WB 4R6UA 3HZKB 5E2UL 3UXFA 3W2DH 2BRRL 1U8MB 1PQZA 4M48L 4M8QA 2DLTA 2D03L 2VLRB 3VGFA 1JTOA 1KT2B 1F42A 5DMIL 4X5XA 5DUMH 1U3HB 4L4TB 1BQUA 4RAUB 2X44D 1NCAL 2KPNA 4GKOA 2OI9B 4Y4HA 4OCRH 5I17B 1FV1B 3EOBB 4FG6C 4JE4B 5I66A 3RUGB 3PNWA 1MNUH 4M3JA 1A6TA 1JPTL 2VABA 5T3ZE 4BZ2L 3PGFH 1BJ1J 5IHLB 4PJXA 2HRPL 1MUJA 4XWOC 3ZSTA 2FHCA 3GJFK 3DNKA 4MB3A 4D3CH 4K7FA 2X9WA 1A1NB 1T2JA 1T2QH 1JGVH 3RHWF 3HNTL 2DDQL 2YD3A 4RMWA 4ELMF 3K4DA 1OW0C 3QUZA 4JM2F 4OLYH 2BOBA 4PJCA 3QDGA 4GMSL 2MPAL 4NQVB 2DTMH 1T1XA 4GS7C 5JXED 2F54D 2JJTA 1BD2E 4LOUC 3RL1B 1HYSC 3MO1B 5GGQL 4ERSH 3CFBA 3ZDYF 4D8PA 4W6WB 1EIBA 2FJGA 5F3HB 3Q5OA 4IEFB 3I75B 4TSCH 3TVMD 3BWUC 1QSFD 4PJHE 2I60L 4UT6H 1R0AL 3D9AH 4P5TC 1VSCA 2P5WE 4K3JH 4YNYB 5IBLD 3LKPA 5HHPA 2X1OA 3BEVA 4PV8A 5EU5B 2VDNL 1WZKA 2IBBA 3HPLB 5I30H 1BECA 2H45A 2NW2B 4E41B 4HKBB 4K8RL 4PJAF 5C07D 1A22B 4GQPH 4X7FC 1CDHA 4KK6C 2ATPB 5IHZA 3L7EB 1C12A 3DVIA 5F93C 3LB6C 2X70B 2PUQT 4IRJA 5C0AE 3BH9A 1CTOA 4NSKB 2AJXH 3HZYA 3U4EB 3BKJL 4JANB 1YQ2A 5B22A 3G04B 3MYJB 3RGVC 2X41A 1S9XA 1UH2A 3L9RB 1PDKA 2V9QA 3LKRA 3CSGA 3OJVC 4LVOC 1D9KD 2D7OA 1UM6H 3UJJH 4PYHA 4NRXB 1EDQA 1RIHL 1P7QB 1DL7L 3DRTA 2X4PA 1RZJL 4YUEL 3QHFH 3VXPB 4LLQA 5AZ2H 4AZ8A 4F80A 3EFFA 4XNUH 3RA7L 1J7VR 2PW1B 4Y19A 5BRZE 4DFIA 3MNWA 3EDJA 4NZRH 3PHOA 2VZTA 3JTSB 1KCRL 3ARFA 1ZA3A 1ZHKB 3W39A 5I15H 2JB6A 1I75A 1UJTA 4W6YB 5E8PB 1XF3B 2FGWL 2A9ML 2HYMA 1ZXQA 2PXYB 3L5WB 2G60H 4GXVH 3O11B 1BVZA 1KIUA 3BQUB 3MV9E 4K9EC 1DR9A 1TETL 5GJSL 1JF5A 4PJ5B 1IAKB 4S1QL 2DL2A 4OZHF 3QZWG 1Z0MA 1A3LL 3D0LA 2PO6A 3LS5H 4JVWA 2V9RA 2XTJB 3SKMB 1MCWM 3JWDL 5GGRY 4Y16B 2Z31B 3OX8B 5DJDB 3O2WH 3T8XB 4DCQA 4LSVL 1EX0A 1KPVA 4GKZB 3PV6A 5E6IC 4U1KB 1QRNB 4OCXL 2V5YA 1G0YR 1QRKA 5ID0A 1XGUA 2DWDB 1BFTA 1GIGL 2PNDA 5CJQH 5K9OA 1FDLH 1JI2A 3RKDC 3BN9C 2Q86A 4YXKL 2V5MA 4G6KL 5C6WH 1U3YA 3P73A 4PG9A 3UBXB 4GMTH 4NZTH 4YHIB 3L5XL 1WIUA 1QR1B 3HZVA 4HW6A 2DLFH 2QADB 4OF8A 4LASH 5MERB 1EBAA 1CQYA 5IMKA 3U4BH 3NCFB 1ZEAH 4D9LH 1X4XA 3EBAA 1MCBA 3BWAB 3GSRB 1AD0A 1N4XL 5E2UH 5JXAL 2BRRH 3H3PL 4M48H 2VDRL 4WHCA 3U0TB 3RWDA 2B4CH 4R3SA 4Z7VB 1ZA6B 3GI8H 5IQ9B 3W5MA 4F37K 2WQRA 3BIBX 5TE6H 3O2DA 2M26A 5CD5D 4GBXB 2R9HD 4RFEA 1JNNL 5SX5H 4JO2H 4PY7B 1A9EA 2IAMA 4N90E 4XGZB 2EYTB 2R1YB 2M1KA 1CS6A 5F8RC 5C0FA 4UTAL 1J8HD 2FATL 4YK4C 1JPTH 1CFSA 4OZFA 3EJZD 1FO0L 2W92A 4BZ2H 3RJQB 2DOCA 4HZAA 1MCJA 2HRPH 4KDTA 4M61B 3OG4B 1DFBH 3L3KA 1JZ3A 4BFGA 4WUUD 1BAFH 5GSVA 3PP3H 4PLNC 1KC5L 1Y6KR 1FZOB 2WUCH 5SWZB 3HNTH 4BKLB 3X17A 1T1ZA 2NY3D 4KK5C 3TJHC 4Y7MA 3U7AA 4FFVD 1X5KA 4F15C 2GY5A 1AGCB 4PG2C 4PD4J 4M5YL 4PRNA 1U8HB 2ZWLT 2YS4A 3KYOB 5C0CD 1NFKA 4NHUA 3FB8A 5GGQH 2G9HA 1ZE3C 5JPMA 4UOW0 4WJ5A 4IMKA 3ARWA 5JNYB 4I2XA 4CN6A 4MAYB 3C6LC 2VKXA 1D5BA 4ONHB 1BWWA 1L6XA 5DJ6B 4E0RB 4HWEL 1R0AH 3VCLB 5JHDE 1E6OL 3NABL 2VAAA 4JN1H 4EN3A 5E6ZA 1LDPL 2VDNH 1UM5L 2LAGB 3OXSA 2ENSA 5HHMB 4Y4KC 5ILTH 4N0CC 1HINL 1ZLUK 4K8RH 2BVUA 2J88L 4ACPA 4M62L 4PY8J 5L2JB 3LEVH 4BQ8A 1FAKT 3WFEL 2V7HA 1SM3L 4UIMA 5SWQB 2A6DB 2PKDA 3HI5L 4FNLL 5IEKA 3VD7A 4Y4HD 3V6OC 4LEOA 2APFA 4QRQA 3X11A 4KJPD 2YPLA 1JPST 4MJ6B 1MPAL 5I8CA 3HC3L 1A1OB 3RVUD 5I71B 5LGHL 4DZBB 1S7UB 2FRGP 2VO5A 5AEAA 4CN1A 4P9HL 1X5LA 5DDHA 5GGUB 2P8LB 3DROB 4Z77B 3VH8B 1G6RH 1IKFH 1RIHH 3V7AG 5DLML 3HB3D 2A6IB 1FL6B 4JLRA 5DHVB 3GBNH 1A4JB 4OTXL 2P47B 3WJLC 4U0RB 3O3EA 3WLWC 1WBZB 2PTTB 2OMBA 4UB0H 2NTSP 3RA7H 1HHGB 5I1DA 4WWKB 3TYFA 1CDCA 3OKOA 2X9XA 3QUZD 1F6AB 4WW2A 3SGDI 3QDGD 4Y5XC 5E2TH 1KCRH 3MREB 5J11C 2ZCLH 2DJSA 5IB1B 3C09C 1RUPL 3MOQA 4R7NB 4UUJB 1HHHA 3NZ8A 1GPOL 1NDGB 5IF0A 3GSQB 1B0WA 1TQBB 2HP4A 4GFTB 4LRNH 5GJSH 1OT2A 2VLRA 4S1QH 2H6PA 1ZGLB 2ZUWA 3BX7C 4MCZA 5GZOC 1A3LH 2MOVA 4FXGB 5EBGA 4B7IA 3H9SE 5T33L 5CHNB 4OZIA 1VERA 1VFUA 5EUOE 4WI6A 2C3HA 4LSVH 5I73C 2AJYH 3TN0B 3SE3C 1JZ5A 4WFHE 2NTFB 1OAKH 5D7KD 4FQHA 5I8OL 3U48A 1JHTB 2XZAL 5DSCA 1HE7A 1GIGH 4XHJC 4YFLI 4RA0C 5DYOA 5FO9B 3QIBB 2C7UB 5E00B 4IRJD 4CNIB 3JXAA 5BMFH 2CIKB 3A6CL 4IRSC 1WT5A 4F33B 1TJIL 5L8JB 1XGTB 4GXUN 3L5XH 2DBLL 5JZ7D 5C3LD 3UBXI 4PJBB 3A6BH 5IJKA 3MRBB 2GJZB 4RDQG 4Z95L 2C3GA 2XPGB 4U6YA 3PE9A 5C9JB 1BQSA 3OR6A 1X4ZA 4YJZL 3CSPA 1U3HC 1R3HB 5TFSL 2EXWD 2QKIB 3MO1A 1N4XH 4ODXB 3H3PH 1S3KH 4QRSA 2VDRH 2B5IC 3O4LA 2GHWB 5F3HA 1EEZB 3I75A 1KPUA 4P2RE 4Y19D 4WHYH 1JNNH 3HCVA 5D8JH 3G9VA 1VGEH 2NXYD 1BPVA 4UTAH 2Q1EA 4I3RL 1J5OL 3HPLA 3UJTL 1P2CB 2E27L 2FATH 3K8KA 5E5MB 5LWYL 1RJZA 3ESVF 4DVBB 1YMMA 3MLSL 5DD5L 2ATPA 5DJ2B 2W59A 3OAUH 4LLDA 4MQSB 4DKAA 1HQRB 2PO6D 1HSBA 3SQBA 3ISWA 4BJLA 1MFBL 3WD5L 4NSKA 1U92B 3RVXC 3T3PF 1I1FA 1P5VA 4KMTH 3T2PA 4RISH 1IGFL 2OL3A 3GSOB 3UTPE 3G04A 4J3UA 4ODHL 3DJ9A 1EUTA 3EIFA 4HLZH 4M5YH 5DFTA 1P4IL 1G7HA 3L5JA 2RHEA 3RX8A 3BSZL 2VDPL 5D5ME 4LGSB 4N0FA 3NMEA 5FGRA 2ESVE 4WU5A 4LFHG 1QZ1A 4RA3A 1P7QA 3WN5A 2DD8L 5E99L 2E7LA 5J12B 1B0RA 1S7TA 1P53A 3QQ4B 4MA3B 2DQJL 3T1FA 1E6OH 1J18A 2Y36H 4LKCB 3T0BA 5IKCB 2PW1A 4NRYB 4JFDD 4TNVF 3NABH 1T4KA 4KY1L 1I9IH 1LDPH 1UM5H 3JTSA 3T77A 3QNXB 3OV6A 5GGVY 3O6FB 1JPGB 3LDBB 4YXLL 4NKIH 5DJZA 2VITB 1HINH 4R4FH 4R7DB 1XF3A 2J88H 2IMMA 4M62H 4MQXD 3RVWC 2D0GA 5E0QA 1KJMB 2DIBA 3L5WA 3SDAB 3FT3B 1RJYB 5L2KE 1Q0XL 2HT4D 1LHZA 3WFEH 1CIUA 5FECB 3O11A 1SM3H 1C16A 5CJ8A 1OY3B 1IAKA 3HI5H 3STZB 2IAMD 3SJVB 2JJSC 3U79A 4O2EB 1EO7A 1MFCL 3VFSB 4Y16A 2Z31A 4GKZA 4EUPH 3G9AB 3HC3H 3NPZB 5LGHH 1F4HA 1AIFB 4P9HH 4OLZH 4O2FA 4ZTPL 1IT9L 4U1LB 3QA3B 4L29A 5DZOA 2GTWB 3E6HB 1H3UA 2J4WL 3TIEB 1UB5A 3WFHB 1S7QA 3CX2A 4PJFB 5HBBA 1JIBA 3UBXA 5J13C 1A3RL 3RZCB 1BOGB 2APBA 1UWXH 3CFEB 4F7MA 2R0WL 5MERA 3B9DA 4K9EL 4YHZH 5EFIA 3BQUC 3DXAE 1ES0B 3X14B 3CSBA 2FIKB 3ULVE 2QR0A 4YHYB 4EXKA 4C56B 3LPWA 5TE4L 3RU8H 4F9LA 1KEGH 1F4YH 3D5OF 4X6DE 5IQ9A 2DYPA 5E2WH 5E94B 4KZEH 4EN3D 1GGYA 4F7CB 4NWTL 5T33H 4GBXA 4QWWD 3S3JA 2OK0L 4HD9A 4PY7A 2CKBB 5F7MC 4LPCA 4P2QB 3MFFA 1FJ1A 5ANME 2WQ8A 2C4XA 1K4DB 1P4BL 3G5ZB 1AKJB 1T20A 3TF7C 2XZAH 2DLIA 3GIZL 2DL9A 3VD3A 1T21B 1FL5B 2QADC 2V2WA 2YKLL 4B5EA 3MRDB 2E3VA 3CDFA 1S7RB 2ZOKA 1GAFH 4GXUM 3VXOA 2KUTA 4IDJL 2DBLH 3D25B 5E6YA 4HK0A 4XCYA 2EDLA 1I7ZB 1T7WA 2EE2A 4JAMB 4MX7A 5J06A 1WBYB 4Z95H 1DBAL 1MLCB 2QSQA 3ARBD 4JRXE 3LRGA 2RR3A 5CSZB 1A5FL 3GBLA 4OFDA 4HUVA 3VFMB 1AGCA 1PYWA 1ZOXA 4MD4B 4XVTL 1RUKL 4QY8B 5GIRB 4GQ9L 1YPZE 1CVRA 4YIQB 1S7SB 4L8DA 4BQ9A 3OQ3B 1SJXA 3G5VB 2GITA 4MB5A 3I6GA 4DGYL 2R2EB 1VGKA 4MAYA 3DO7B 3GUTA 3X3GH 2P44B 5GS3A 3IRZA 4M9PA 5DJ6A 1FNAA 4HJ0D 1C1EL 4OLUH 2G2RB 4U0QB 5IG7B 5BXFA 5I2IA 4MQ7B 1W0VB 4YHLH 4I13B 1J5OH 5EUOF 5FKPA 4ORGB 3VE0B 3UJTH 5IHBA 2VDLL 2E27H 3BDYL 1BWMA 1KF9B 5IW1A 5D70L 2AVGA 4WFGE 2APTA 5FK9B 4LSTH 1AHWC 4HCRA 1YEGH 2OBGA 5H37H 5DD5H 1T80A 1AR1D 5DJYA 3TJEL 4ZUWB 1AO7E 1H3VA 5JDSB 2A6DA 3SO3B 2F19L 4FFWC 1MFBH 3O9WA 1IGFH 1CU4L 1BLNB 4AK1A 2IANE 4ODHH 3P30L 5HJ3A 1BMGA 1JGUH 4MJ6A 1P4IH 5DK0B 5EO0B 3FZUC 5ISZE 3BSZH 1S7UA 4Q2ZA 4P23C 4DK3A 1OHQA 2P8LA 4NP4H 1DTUA 4M7KL 5HI3C 3CVHL 2VQ1A 4ELMB 2B8OT 2DD8H 1I7TA 3QUMA 5E99H 4JM2B 4YZFE 2BFVH 1UJ3A 4AQ1B 5TH2B 4POZD 1HHGA 4G6ML 4WWKA 5JIKA 3E0GA 2B1HL 2YA0A 3HTLX 4KY1H 1F6AA 1G7LB 5DVMA 3CFDB 2KZ1B 2AKRB 4XMLL 3L7FB 2JTDA 2MQ3A 4UUJA 4PGBB 1NMBL 3O4LD 1T03H 1BZ9B 3VJ6B 1IC1A 2P43B 1Q0XH 2AJ3B 1EEYA 3P11H 1NEZB 3UPCA 4Z7QE 2G5BB 3SDDC 2AABH 2ADJB 3AM8C 1IFHH 1KJ3L 4Y5YB 3VXUD 1VCAA 3KLAA 4PJAB 2NPLX 1H0DB 3KS0H 3FQRA 1H8SA 1NMCB 2EH8L 4U2ZA 1D5XB 4F7TA 1CT8B 5D1QC 3TN0A 1CWVA 3FRUB 4U0RC 4QHKJ 1YMMD 4MWFA 2O5XL 4ZXBB 3RWCB 3W11C 2V6HA 3VI3E 4V2CB 5LAXB 1T89C 3O0RL 4ZTPH 4F58L 1Y6MR 1IT9H 3QFDB 2BNRB 5DQDL 2E9WA 3K81A 1N0LA 5CP7B 1R3JA 4WO4B 2J5LB 1SEBA 1U93B 2J2ZA 3VXRE 3TCLB 4RGNC 5D5MF 5E00A 2J4WH 2Z92A 4FFZL 4X98A 1F58H 1KB5B 5EC1B 4X9HA 4FQXC 4F33A 4XP4H 4BFEA 1RIUH 1UXWA 3RPIB 5IEHB 3QAZB 3OKMB 3TYGL 1T04A 1IRAY 4AEIL 5A2FA 3ZKMC 2GJZA 2XPGA 2I27N 2Y1VA 1CXIA 1MCNA 3U6RB 4O9HL 5JHLL 2X4NA 3EO9L 5EIQA 3FB7A 2LV4A 1R3HA 2EDTA 3R1GL 1R3KA 1P7QD 3M1BB 1IJ9A 3TBTA 1XMWA 3MOBH 5B8CB 1QO3B 3KLHD 5TE4H 5JOFA 3AS3A 3LPFA 1P7KB 3DPBA 2BY3A 1FE8L 1HHKB 1TCRA 5KTEL 4TSBL 3NAAL 1TNMA 4KMQA 3DIFA 5FM5M 2OK0H 1M6OB 3VFGH 1F6FB 2XA3A 1FIGL 3BFOA 2X9YA 4JFYB 2NX5E 1P4BH 4X7TB 4OZHB 3H7LA 1CXHA 4QXTB 2VZ3A 3GIZH 4OF5A 3O8XB 4LDLB 5E5MA 3VGGA 4DQOH 5IV2B 1A7PL 4KTEL 25C8H 2YKLH 3TPUB 4Z7WE 4KRLB 1HK6A 2FEDC 3LSOA 1CXFA 2Q7YA 3RNQA 4JKMA 1IL1A 2R0LL 4IDJH 1EHLL 3K8LA 5DRXA 3QXWA 4Y16D 2OR8A 1RZ7L 1U92A 2VNCA 1S9VB 4KI5C 3QEQB 3TWCL 1DBAH 1R3LB 3I6LD 4UOJA 4K94H 2HVJA 4NQUA 2GJ6B 4MDIB 3LIZL 1P7HL 3QDJA 1CDUA 3SBWA 4ZFOA 3QP3A 4M6ML 3QXAB 4QHNA 1LNUA 3FB5A 4XVTH 4ZSOB 3M8OL 4GQ9H 4Y4FB 1K5NA 3AS2A 5FA4A 3VD5A 5C08E 3V7AE 3ULVF 1W0WA 1AY1L 5DUBA 4I9WE 4DGYH 6FABL 1KXTB 5IVXF 3T65B 3LN4A 1QBML 4NZUL 1BQHG 2IH3A 4MZ2A 1DBBL 4XRCA 1C1EH 4X6DF 4LKCA 1T7VA 4NQSB 4LKXB 2L7UA 3G6AA 5BW7C 4HKXB 2NY2D 3QNXA 5C0EA 5MEPA 3QPXH 2VZUA 4MJIB 1JUFB 1EHXA 5IUSA 5A16B 5FV2A 5GGSA 2EDJA 1KNOA 4DOHB 4FA8A 1WCBB 1KJMA 2DYPD 5KAQF 2PN5A 1FNGA 3O2DH 5LG1A 3TJEH 1U8QB 2Y25A 4FZ8H 3K2UL 4KUCD 1G7MA 2EXYD 2XICA 5D7JB 3QCVL 3DX9A 2F19H 4GBXD 3STZA 4ZFGL 4P2OB 2Q7NA 2F54E 3ZTNL 1CU4H 4TVSa 1K3ZA 5ESVB 5CWSB 5JQHC 1J05A 5CP3A 2UWEE 3P30H 4JPIB 4EVNA 3WS6C 1P6FA 4OZFH 1MI5E 4FQJL 1QSFE 1BBJA 2C3VA 3OGOE 2QL1A 1HI6A 3BIKB 4KKNA 4W70A 5FKAA 1G7QA 1E4KA 1KLGA 5A1AA 3CVHH 4O4YL 3E6HA 2SEBB 5F71A 3VGDA 4A6YB 4KK9D 5C07E 4G6MH 1SBBA 4O02L 1BOGA 2B1HH 2Y7QA 3FONB 4OAWA 4ZOAA 3SDAC 2R4SL 4XMLH 4UQ2A 3EYFB 3MRCB 4P3DA 5GXBB 4D0BB 3DTXB 4H26A 1NMBH 2FIKA 1KIPB 2L0DA 1TITA 4OJFL 2BX5A 4XP1L 3T2QA 4MAYD 3P0YH 4L1DA 3QUKB 1IZKA 4TNWK 1CD0A 2CLRB 1KJ3H 4QHUA 3QQ9C 3ARDA 5HY9B 3F7VB 2E9BA 3DX8A 4M1DL 4LDEB 3EJYC 1SBSL 2AEQL 3W9EB 4J6RL 5LGJA 5KS9F 2EH8H 5DD6A 3OZ9H 2W0FB 4P2QA 3U1SL 1P84J 1OW0A 1F4WL 4CKVX 1OT1A 2O5XH 1K4DA 3G5ZA 3C60B 1AKJA 2FD6L 3O0RH 4JQVA 1TZIB 4XNMA 3RZCC 4D0DA 3BVNB 4KHTL 2ARWA 3NPSB 2N1KA 3SGKC 1CBVH 3UTQB 5ERWB 1EPFA 3JV6B 2FEEL 4QRRB 4FFZH 5HI5C 1HXMA 5J3HD 3DETC 4PRPA 3O9WD 3VFUB 5D71H 1IGJB 1QSED 1EMTL 1BZ7B 4YHYC 3D25A 3TYGH 2AQ2A 5E8DL 4KKCC 1RK0B 3MBEB 2IC2A 5CSZA 1AXIB 5JHLH 3VFMA 3EO9H 3MC0A 4MD4A 3WFCL 3R1GH 1IM9A 1YEJL 4BYHA 1RZIA 3BZFB 4QY8A 3P4OB 5FF6B 1WBXA 1UFUA 2HH0L 5ID1B 4Q6IB 2JJWA 3KPLB 3PWJB 3G5VA 2P5WB 1CE1L 4I5BB 5KN5A 2R2EA 3Q6FB 5HGBA 1KBGL 3C5JA 5KTEH 4TSBH 3NAAH 5D7LE 4Z7QF 2G2RA 4RZCA 3Q3GB 2NLJB 4OI8A 2NY6B 4OZGE 4PRID 4HBCL 4OCLC 4JJ5B 4MQ7A 1FIGH 3WUWA 3FQWB 2FNBA 3P77B 4CJ0A 1A7PH 5FK9A 4I18B 3B9KA 4JRWA 5IFAL 2FLBT 3EYUL 3DWTA 4ODBD 5C0AB 4JFFA 1S9WA 2ADIB 1ZAGA 3MJ8A 5DC0A 5E8EB 1QFWI 4LIQE 3KPRD 1JJUA 2R0LH 4Q58C 5L88H 4E42B 2D0HA 3DRQB 1R3IL 2N56A 5JDSA 5MEOA 3QQNA 3D18A 1EHLH 1O0VA 2QQKL 1RZ7H 1CGTA 1VADB 4NNPL 5TF1H 1X5YA 3N50A 1XIWB 5DD1H 3P2TA 1DSFL 3MRRB 2JLLA 2X89A 2VLKA 3LIZH 3BH8A 1RUQL 5EO0A 3QFJA 4M6MH 5EH1A 2AK1L 4I1NB 1Q9OB 3M8OH 2P5EA 4Z78A 5CZKA 1D3CA 4MXWL 3MCG1 1T1WB 2W65B 3CSYB 4IOFD 1X5JA 5BRZB 4OUUB 3BW9A 3ZTJH 2OTUA 2R69L 1QBMH 4NZUH 1ZMYA 1DBBH 3ETBF 3PUCA 3VW3L 4MNHA 1NGPL 4U1SB 4WI5A 4KRPD 4P2CG 3RIAK 2DQGL 1RZFH 4CGTA 3B2UC 4NQTA 4PB9L 1F8TL 4YXHH 2B2XL 1J9CT 3L1OL 4WUUE 3SO3C 4G5ZL 5IQ7L 3ESUF 2DLHA 3MYZA 3RWHB 1EJOL 1YEHL 3KDMB 4G6FB 5FGBA 5HVWA 3GB7B 4C4KO 3GMPB 4LAQL 1OQXA 5GZNC 1RSFA 5FUZL 1CICD 3DUHA 1A2YA 1ETZB 3TBSB 3K2UH 4QXUL 1UEMA 1NEZA 3KPNB 1VEMA 4ZFGH 5C0CE 3ZTNH 1UCBH 5GISL 1J1OL 3V5DB 1M7IB 4DUXA 5HSFA 4HUWB 3CGTA 2BSRB 4XP9L 4JM2C 1CT8A 4KJQD 3ZE2F 1HYRC 1NEUA 4MD5B 4X4XA 5D2NE 3MRHB 2CDFB 4L5FL 5DMYA 2R0ZL 3TA3B 4P4KB 1OSPL 5AUMB 1KXQE 5LAXA 3MNVB 3K4AA 4EQ3A 5FA3A 1C5DA 1NUGA 4YAQB 2GSGB 3QQ3A 4JQXA 5BZWB 5CUSH 3H9ZA 4JPKL 3BKYL 1PEWA 4KK8D 3QUXB 2E7CA 2IEPA 3S37X 3QSKB 2ARJB 1KB5A 3FOLB 5EC1A 4Z7OF 3RVVD 3RX7A 1U8PB 4QHMA 5TF0A 3MLZL 4CRPA 4FABL 3RPIA 1G6VK 3RRQA 4JREB 1HKLL 4RMVA 3WV0A 3BOVA 4G3YH 1FYTD 3QDJD 3FOMA 4ZQKA 5T1MB 3BDXA 3BP4B 4IIQB 3TO4A 3FKUS 4Y5YC 5L7XL 3MRIA 2DQEL 4JCLA 2HLAB 1I8IB 3CX5J 1T0MB 3X3FH 1OWWA 5CZVL 4OJFH 5K9QG 4XP1H 4GUPB 1QO3A 1UKTA 3ILQD 1SJVA 2ICEA 5FM4A 1ZHLB 1EXUB 4HC1L 3HI1B 4G43A 3VRJA 3HR5B 4XXDA 4ZXBC 5IBUG 3NOIA 4TOYH 4HGWB 3VWJC 1AJ7H 1SBSH 2AEQH 4R97B 4J6RH 4WO4C 5AWNL 2NXZB 2J5LC 3MV11 2YUVA 3ZSSA 1H5BC 4NOFA 2BDNL 4XI5C 3FN3A 3GJFA 2JIXA 1F4WH 2WBJD 3QJFA 1O7SA 1MSPA 3S98A 2FD6H 4KJWC 5DR5L 4Z5RB 3O8XA 4AH2B 4PJCE 2EIDA 1QPXA 2I07B 4M93B 3CH1B 1JYNA 3OHXA 3ZKXB 4NO5A 5T3XE 4G8GA 1WSST 5HGAA 5C70A 1QFWM 3UTTA 4GAJH 4OGYL 1EMTH 2I26N 2X5PA 4YFDB 1E6JL 4HKZA 4KKLD 4TPRH 5B8CC 3MRMA 4F2MA 4MXVE 5J7CC 1FFNB 3QEQA 3WIHA 2HKHL 5A2JH 2DI8A 3MLWL 3DOSA 2F53E 3REWA 1DBML 3A67H 3BUYB 1YN6A 5CFHA 3O3DB 4YR6B 3WFCH 4EBQL 1YEJH 5FYJE 4LCWA 1RPQA 4F8TA 1OOAA 3PABA 1NGZB 1XH3B 5DMKA 2HH0H 2C4FU 4PGCA 3MLTB 4BK5A 3NN8B 4NKDB 1LVEA 1CE1H 1V7MH 1WAAE 5D7KE 3EYOA 3FAXA 3VFNA 1S5HA 2YK1H 5I76A 1NC4B 3MCLL 3T65A 2XFXB 3SKUD 3HS0A 3ZHDA 1NAMB 5GQBA 5EOTB 3KWWA 5T1KB 2EZ0C 2F9BT 4S1SH 1QA9A 4MJIA 5A16A 1R5VA 2D0FA 5H35B 1WCBA 3FFCA 4HSQA 3ARDD 1U8QA 3TBVB 3IFPA 1R3IH 3R06A 1X5AA 4Y1AA 3MRGB 2F58L 2QQKH 1GGIH 4AEEA 2QSCL 4P2OA 1RULH 4Y4FC 4NNPH 4OCSL 5CCKL 5ESVA 2Y5EA 2Y4SA 1DLHB 2LABA 3KR3H 2AS5M 3KPPA 2PETA 1D5ZA 1IAMA 2YR3A 4ZYKB 3IGAB 2AK1H 4S2SA 4LOUD 3S36X 3NBNA 4PD4K 2O5YL 2HKFL 1GZQA 3OKEA 4LLMB 4MXWH 5HI4D 2AV7B 4PRPD 5C0BE 4PR5B 1T66D 5E9DA 3GGWA 4JO1L 2R69H 3V5KB 2AJSL 3HR6A 3VWKC 3VW3H 1B0GB 1NGPH 2QHLA 1J11A 3GSNB 1CL7I 5CSGA 2DQGH 4KKAC 4U1NA 4PB9H 1F8TH 2DBJA 1YJDC 2B2XH 3EYFA 3L1OH 1IM9D 3MRCA 3DV6B 4Z76A 3VFOA 4OZGF 1EJOH 1YEHH 4K7PX 3MRKB 4LAQH 4O5LL 3ELAT 4KK6D 5L0QB 2Z91A 4HWUA 3ROLB 1EA9C 5FUZH 4IOIB 1RHHB 2Y23A 3QUKA 4QXUH 1XF5B 4U05A 5EUOB 4AM0B 1BBDL 1VFBA 2CLRA 3KXFE 3QG6B 5GISH 4LCYB 4APQA 1J1OH 3PJSB 2CR6A 1U91B 2R29L 1RZGB 4XP9H 1ADQL 4N1HB 2OSLB 1X6NA 3FMGL 1E0OB 4L5FH 2W0PA 5JUEL 2R0ZH 3B9KD 1OSPH 5ALCL 3VU2A 4JFFD 4JFDE 4W81A 2VLJB 3CXHJ 4TNVK 2R0KH 4JPKH 3BKYH 2EDEA 2UZXB 3UTQA 3GEWB 3K0WA 5ERWA 1IM3A 3JV6A 2X6MA 4X6EA 3VFUA 1T7XA 4TQEL 4WHYG 3T08A 5IGXL 4RBPK 2E7BA 2EC8A 1DEEB 2J12B 2YD9A 4FABH 1U3ZA 1BIHA 2X89D 2VLKD 1GGCL 2YSSA 3QFJD 1KJVA 1BD2A 1CTNA 4ZAKB 4HXBL 3PWPD 4R0LC 4OM1L 3U36A 5L7XH 1Q94B 2P5ED 3LKOB 1NGQL 5CZVH 5DHVH 3P4OA 1J1PH 4Q6IA 4PJHA 4GG6E 4PJ9C 1LEIA 5DURB 4OD1L 1SYSB 4MA1B 2V7NB 2P5WA 3MJ7B 4I5BA 3C60C 5GGTL 1B4JL 5D7IE 1GYAA 5AWNH 3NPSC 3QHZL 2BDNH 4GRWE 3S34L 4HLZG 4V1DD 2VWEE 2HJFB 2IGFL 2YWYA 3FQWA 5I1AA 4N0YH 2W0LA 3OKNB 4G42A 5C7XL 3KPSD 1FVDB 4J4PA 3ZZ1A 5KG9B 1SYVB 3RKDD 3BN9D 1I4FB 4NJAH 5CLWA 1PLGL 3FO9A 3GI9L 2RGSA 3LEXB 1XR8B 5C0AA 1A6VH 5E8EA 1YUHB 3P4MA 2PYFB 5IOPA 2HJLB 3RQ3A 2VXSL 2ZPKH 4E42A 4OGYH 3EYSL 3WS3B 1VADA 2R23A 4OF3A 2CKBL 2GAZB 1OARL 4U1JB 3MGTA 1KJ2A 2CDGB 2HKHH 5D5MB 3MLWH 4YE4L 5E7BA 1DBMH 3QXVA 1N8ZA 2ESVB 4EBQH 4JHWH 1XGYL 1LO5B 4PJDE 3TT3H 2ICWB 1DDHA 3NH7L 3DVFA 3S97C 2W65A 4IS6A 3LQAC 5HHOB 4HHAA 3LQZA 4G9DB 3S6CA 5BRZA 1ZVYA 4OUUA 1MY7A 4BFBD 5I1KL 1QKZL 5JPNB 3MCLH 4XNXL 3HRZA 3WHXB 1HIML 3AS1A 2EE9A 3FQNB 4I18C 2X09A 1R24A 3WXVL 1A7NH 5F1IB 1NC2A 4NKMB 3U4AA 1N2RB 4EUPG 3TO4D 4PJXF 2E7MA 1VENA 1EGJL 5HGGS 5SWSB 2H32B 5E1AB 2WIIB 3D39E 3KDMA 3S37L 3MV9A 5FYKD 3IU3B 1XIWC 2Z93B 2X4TA 3N9GH 2ZKHH 5DQ9B 3VDCA 1ETZA 1P4LA 2DQCL 5I1JH 4PJCF 3KPNA 4DK6A 5DGQA 2HT2C 2F58H 5IMLB 2QSCH 3O41A 1ED3B 1KG0A 4KK5D 4Y8AA 3HE7B 5EZIL 5C3TA 1M7IA 3V5DA 5CCKH 4HUWA 2JIXD 3TJHD 1BEYL 1FC2D 4AIXA 3MACL 2EDBA 4MDJA 2DJUA 1IQDA 1UZ8A 2Z9TA 1JZ6A 4MD5A 1QQDB 4NC1E 4F7PB 2AXJA 4WTZA 3I02A 2CDFA 4MXVF 2Q6WB 3UC0L 4HBQA 5I6XB 5AUMA 2O5YH 3FQUA 1GHFH 3HUJA 5D6CB 9CGTA 3GMMB 1XR9B 1EVUA 1HEZA 4G8GD 4N1EA 3IDXL 4MNQE 4OV5B 3UTTD 3C6LD 3QUXA 3LKNB 4H0GA 4QEGA 2J8HA 4JO1H 2EO9A 4KI1A 1T83A 1LE9B 1WICA 3HC4L 2AJSH 3S96A 2EYSB 3FN9A 3IAGC 2VDKL 1U8PA 2V2XB 2WM0A 2EC9T 3ARPA 1AXTL 4I4WB 3T1WA 1WWAX 3GFUA 3UYPA 2CJUL 4Y4KD 4LCWD 1NLDL 1U8IB 4OZIE 2X4RB 5IFHL 3P9LB 5IVXB 4UBDD 2A73A 3RY6A 4N0UE 3FRPG 4X6DB 2ERJB 4O5LH 2G75A 4LNRB 1T0MA 4FQIL 2YUXA 5ETUA 1YNTA 5BZDB 2CR3A 1IBGH 3QBTB 2XXMB 1JRHL 1BBDH 5HYJE 3TA3C 3HR5A 3GKWL 4P4KC 2H1PL 3C8DA 1TZGL 1Y6NR 1D5MA 1QLEL 5ANMB 3RWFB 5I19L 1PGRB 2R29H 2R4RL 3DUUA 1ADQH 1T2XA 3CVIL 3BPLC 4DKEL 3MX0A 1KIQA 2NY0B 2GKIA 3BPOB 5DHXB 5HVGB 5JUEH 2ZCKL 3QNZA 2J3SA 5CEZH 2VE6A 3FFCD 3CFCL 4JREC 4AH2A 4POUB 4U33A 1WGOA 5B4MD 1T7YA 1ONQA 3H9HA 3S5LB 3CH1A 4Y1AD 1YMHA 4IIQC 1DVFB 1UKSA 3Q1SH 3EKCA 3BAEL 1ZVHA 4TQEH 2IG2H 4JRXB 3O4LE 4R90L 5DEGB 4BZYA 2NNAA 3U0WL 5F7LB 1FG9C 1I9JL 3WBDA 1I1CA 4M6NH 1YPZB 4ZDHB 1ZHBB 4YQXL 4HXBH 2NY5C 4OM1H 4JKKA 2WINB 3ARTA 3BUYA 4QLRA 3VXUE 2KQNA 5AZEL 3CFJA 1NGQH 5JLZB 1FPTH 4E5XB 4R97C 4KC3B 4MB4A 5J6HB 5E9DD 5HGHB 2N4IA 1J88A 1KB5L 3NN8A 4NKDA 5JHDA 4OD1H 4OQTL 3T4AB 1YMME 2IFFL 4HMDA 1KTDB 1ZSDB 2CUMA 2XRAL 3G6DL 1NUDA 1Z9OA 4NO3B 2XFXA 4C59B 3QHZH 5KANI 3S34H 4OF6A 3S36L 1A6ZA 4CU6A 4WTWA 3ZKXC 5FUOH 3C6SB 2IGFH 1T3FB 5EOTA 4L4VE 3F58H 5C7XH 5T1KA 2WW8A 3RAJL 1JN6A 4XHJD 2R1WB 4P23A 1A02N 5KS9B 1R5IB 3RDTB 1PLGH 3GI9H 3OJDA 1MCPH 2DWEB 4IRSD 4APQD 2VXSH 3TBVA 4PJ8C 4PP2B 5DRWB 4JFXB 2IANB 3EYSH 1QLFB 4FP8L 3SE4A 1WJ3A 4IJ3B 5DJAA 5ISZB 4PP1C 1CFVL 3PDDA 4K7PL 4XCFH 4YE4H 1DLHA 5BV7B 1BJ8A 5C0GB 1YZZA 1TTFA 2VUOA 1CE6B 1HH6B 4TTDD 1NCBL 3FJTA 3NH7H 3SDXE 3EO0B 1K8IB 4R96B 4NKOB 4GRLB 2V2TB 5GS2D 4JQIL 1JPFA 1KCUL 1TVBA 2P8PA 2QSVA 4PR5A 3IDNB 5DK2A 5KZCD 3EHBC 3MQIA 3P0VL 4KJYA 1KCLA 4J8RB 5I1KH 1QKZH 3SDDA 3V5KA 4XNXH 3C5SA 1HIMH 1I3RB 4BUHA 1JWSB 1BD2D 1CLZH 2KL6A 1DEDA 3D85A 1XF4B 3UMTA 4M1CC 5D7IF 4UTBL 5HHQB 2Z8WC 3GNML 1EGJH 4O51B 3BT2L 3MRNB 4PJGE 4K3EL 2D3VA 5IIEA 1AQDB 3EOTL 3MRKA 1XGQB 5IB4A 2FH6A 4QO1A 3ROLA 3D2UA 4PREA 4JB9L 1OVZA 4YEFA 3W5NA 4D9RE 3H9SA 2J8UA 3GSXA 1RHHA 4AY0A 2DQCH 1H8NA 2BSSB 4MHHG 5ABDE 5EUOA 3L3OB 5B39A 3F12B 4PFEA 3B9VA 1I7RB 5EOQL 4CW1A 3WFDL 4LCYA 4FQXA 4NNXA 4X83A 4GW1A 5EZIH 3PJSA 4TULL 1XCTA 1LK2B 2OSLA 5DT1L 4MLIA 4J4PD 4G9FE 3VXRB 4MXQD 4MVBC 4RWHA 5M7QA 5DD3L 1ZT4A 2Z4QB 3LOWA 1Z5LB 3IDXH 5T5NG 3ARGA 4MNGE 4FOMA 1NGYA 3ARRA 1IVLA 1F3RB 3RWGA 5SX4I 4CADA 5EO9B 3W81A 5F7WC 2Y6SD 2VDKH 5L0QC 43C9B 3BP6B 3EZ8A 4CL7A 3ARSA 1AXTH 4J1UB 5HXMA 5A40E 4HH8A 3IXTB 3EAKA 2BRQA 3HMWL 4ONGL 1NLDH 4I0PB 4NRZA 4OFKA 4ZOCA 2GW5A 2H3NB 1QLRB 3B9AA 3H0TB 3RVWD 3V2AR 4X99A 5CGMA 3DX7B 5EDXA 4P2RA 2WV3A 4S1DD 4XP5L 3G08B 3IXAB 1MCOL 2GUOA 1G6RB 4M6OH 1SYSA 2V7NA 5F9OL 4A6YL 3T0EC 3HNVL 1TZGH 1NC2D 4OZ4B 2RB8A 2NX5B 4RFNB 5FGSA 2R4RH 4MAUL 3P9WB 4HLJA 2OR9L 1MCEA 1F2QA 4DKEH 3MRJA 3SKJL 1NBZA 3MV9D 4Z7WB 2ZCKH 1VEPA 5I16B 3GSUA 4CDGC 1HNFA 1U3JA 2W9EL 1FVDA 3HPJA 3P40A 1I7UB 4NQDE 5GRYA 3QRFM 3AAZB 1K2DA 3LEXA 4ZAKC 3OJ2C 1CR9L 2PYFA 3QISA 1T7ZA 3BHBB 3BAEH 4GG8B 2X10A 3MLPA 2DTSA 1JBJA 2EEDA 5ENWB 4R90H 2XV6B 4KHXL 3WS3A 3D87B 1NGWB 1EFXA 3U0WH 2GAZA 5T3ZL 4S10A 3HLAA 2HFEB 3AGVA 4YDVB 2CDGA 1N59B 2AJZA 5D5MA 1S8DB 3TCXA 4YQXH 4P2YA 2ESVA 5BW7A 1JCKA 3J7HA 5AZEH 2J6EL 3ILPB 2Y07L 3D48R 1MFAH 3KNBA 1MRCL 3RWIB 2FJFA 4LHUG 1W8OA 4TVPL 4QOKD 4OZIF 4JKLA 5IW3A 4HT1L 5EU7C 1KN2L 1KB5H 2FZ3A 4OQTH 4TN9A 2IFFH 4G9DA 3O45B 4AIZB 2XRAH 3G6DH 5JPNA 3DMMA 1VFOA 2EO1A 4H25B 4KAQL 5MEQB 1J1XL 2I9TB 2JCCE 2NYYD 4O58H 3UCRA 1N2RA 3WL9A 4QTIL 3PQYE 4OZFG 5EO1B 2KDGA 4PJ7E 2OJZL 2CDEB 2AV1B 4NBZB 4DN4H 2H32A 4PBXA 5E1AA 5F1NB 1QSEE 5L2KA 5D96B 3KYNB 2WIIA 3VXQB 5EBLB 3IU3A 1J10A 5DQ9A 3FT2A 2F54B 1GC1L 3TBWB 4N90D 4L9LC 1JF6A 1JYWA 3OKDB 4J3XA 1YN7B 2KKQA 4HIIA 3H8NA 3GRWL 3KPMB 1FLRL 4FP8H 5HPOA 1F3DH 2EH7L 1U2HA 3TVMB 3GJFH 2XQBL 3HE7A 4JR9L 1CFVH 1QSFB 4RMTA 3LQAL 4K7PH 5DVOA 4JHZA 4U6VL 1JNHA 3MMEB 4HFWA 3QUYC 3ULUD 1QSVA 1NCBH 1FVEB 1TZHA 1TFHA 4GJTB 4HJJL 5FYLL 4PRIE 3DYOA 4JDVA 5AD0A 5J4MA 4AQOA 5C07B 4JQIH 1KCUH 5CEXA 4WU7B 5DK3A 3BXNB 3DX6A 4JY5L 1MJJB 3JZ7A 2EYSA 1ERNA 2OZ4L 3DXAA 3IRPX 4OSUL 1Q1JL 1SY6L 2R1XA 3GHBL 4JM4H 4B53A 5C92A 5IB2B 4I4WA 4XPGL 3N1PC 3KPRE 3U9PL 2BCKB 3GNMH 4LP4A 2X4OB 4GW4A 3WIFA 4M5ZL 3LKSB 4YDKH 1U8IA 3BT2H 2X4RA 3VA2C 2E9IA 2R39A 3EOTH 4KDWA 3DYPA 3EFDL 1INDL 3OKLB 1MF2L 3PWLA 5JHDD 1D9KB 4Z7UE 4CVXB 2DI7A 4X6BA 3BESR 3EYQC 4FFWD 1DE4B 1GGUA 4URTB 2HWZH 2DKUA 4M7LH 4U1HA 5I6XC 3WFDH 4HAGA 2PR4L 1VA9A 3HNSH 4QHLB 5ANMA 3DVGA 4NO2A 3RWFA 2NY7L 4KKBD 4NHCL 3ZYOA 4AL8H 2GY7B 4XNZB 2FJHB 4JO3L 1A9BB 3EYVB 5DT1H 1LEGA 1LQSR 2Z8RA 3FZUD 5TQ0L 3UTZB 1MCIA 2CQVA 1OTSC 3LRSB 1PBYA 4N9GB 4P23D 5CMAA 4HKJA 4JZJA 4UMGA 4C83A 3UDWA 4HUNB 1DUYB 4NQCA 2BC4A 3QPQD 3IKKA 1P9MA 1NFIB 3T4YA 1EAPA 5K93A 1MVUB 1FZJB 2HN7B 4RQQB 3SGJA 4OLXL 4R4NC 3MGOB 4JY6B 3SDXF 5F6HJ 1UXSB 1Y0LA 2HJKB 2BMKA 2EICA 3MRQB 4XPTL 1HXYA 2GT9A 5DJXA 2Q20A 1AGDA 3ZDZE 4PGEA 1KXVC 1WLHA 3HE6C 3CMOL 3HMWH 1IEAA 1YPZA 4PGDB 3SPVB 3VG0L 3IJSA 1CDYA 4LVEA 4GLRI 5CJOL 5JO5B 1CVSC 1OP5H 4OCWL 3ZKSD 5JLZA 2OXGA 2NR6C 3WYRA 4XP5H 5HGHA 3MV8D 1MCOH 4NIKB 3S4SB 3SDDD 4BUGA 2APWA 3L95B 1WISA 5F9OH 4HWBA 4A6YH 2CKNA 4WUKH 4OZGB 3HNVH 2XYCA 5I9QB 1S9KC 3JUZA 4OFYA 4YFLF 1ZGLP 3D85D 4NO3A 5JW4R 4GOSA 3C87A 5D1QD 1TCMA 2OR9H 3SDYL 1I8LC 1VACA 4ODSL 4O2CB 1I85C 1Q0YL 4RGMC 4DUVA 1B4RA 3NCMA 3TLRA 1E28A 1PD6A 1UYWL 2I9LA 3LKQB 3U46A 3W11D 5EN2B 1KLFA 1T5XB 1KEML 4XNQB 4QRTB 1P84K 5GRJL 3D2UD 4NZDA 3MJ9A 2YEZB 3CUPB 3EDDA 1AO7A 3H9SD 3QWOA 4RGND 1FYTE 3QZWA 2NY5L 2X4SA 3ZT6A 4AENB 1MHHA 4ZUTA 3VGAB 4FQXD 1IGML 1EO8H 3V5HB 4WFHD 4PP2A 5CGYC 2ZG3A 5DRWA 2QHRH 2IANA 2X7LB 4G8IB 1AXSB 8CGTA 3EJJX 2ITCA 4JPWL 4LQFH 1J87A 5IVOA 5T3ZH 5ISZA 1K3IA 1U95B 1FRGH 4DTGL 1QR4A 5INCB 2YA2A 4LLVA 2HVKB 2EDNA 2OJEA 1IC7L 2XG4A 5C0GA 1X5XA 2J6EH 1AQKL 3GMOB 1C7TA 4X5WB 4XPAL 4CU7A 4KUCF 5CBAA 4F3FB 3ARGD 1J8HB 4TVPH 4HT1H 1KN2H 1C08B 3OAZH 5DJCB 2V2TA 3SDCC 3IDNA 4PLJC 5I0DA 4ODWB 2QQQA 4J8RA 2ZG1A 5D1ZA 4WUUB 3TO2B 4FTVD 3WJJC 4U7MA 1FG2B 4KAQH 1CGVA 3RDTC 5F7EL 1SEQL 5EIIA 3F5WA 3IJYB 3V8CA 2VC2L 2NY3B 3U82B 4ZUUA 1PKQA 2OJZH 3B8YA 2F8OA 2B4CC 3WXWH 3CD4A 2C3WA 4P2RD 1RFDH 4QCIB 3OJMB 5E2VL 2R8SL 3WEXA 4K07A 2FEDD 1J0IA 5C0CB 2IBZX 1GC1H 1FAIL 1M7DA 2BSSA 3GMLA 3GRWH 3W0WE 3PXHA 3WKNA 4NYLB 3D3VA 1I7RA 3NIDF 5D2NB 3K74B 1X3DA 4KI5D 5K59F 2CPCA 4JR9H 2HTKC 1NAML 3AB0C 3QIWA 3LQAH 3L3DA 4HIEB 3KPQB 4FQQB 3RNKB 1AGBB 1QBLL 3TT1L 2O26U 1LK2A 4R8WL 1IC5L 1PX3A 2R2HB 5F7FA 3E3QC 4HS3B 1ZV5A 3VXRA 1MHEA 4R4BB 2ZOLA 4HJJH 5FYLH 2DAVA 5GRZA 3ZDXF 3K1DA 3GMQB 3UTPD 2DQFA 1D6VL 2EDFA 4M8QB 1FHGA 1HZHH 3BYTA 4UOW1 4R26L 2A77H 1EFXD 1KJ2H 3IDGB 3B3IB 5HDQH 1Q1JH 1SY6H 2VISA 3GHBH 5IW6A 3NIGF 5CAYB 4Y4HB 4XPGH 4J1UA 3IXTA 1G7JB 5I1CL 5I66B 2LAAA 4M5ZH 4CUCA 4I0PA 3PNWB 3GIVA 2NY4C 2H2SC 5E2JA 1VPOL 3EFDH 2H3NA 2D7QA 1QLRA 2VABB 1MF2H 3H0TA 3PL6A 1IAII 1N26A 3MROA 4PJXB 1BVKA 3BIAX 3IXAA 4YX2L 3DMMD 2GQHA 5INDB 2Y72A 4U3XA 4UAOC 2ZUQC 4K7FB 1MCHA 3GSNL 4NHCH 4XBPA 2NX5A 3HMXA 4FXLA 1U8NB 4WW1B 4DN3L 4K8RC 3QUZB 4AYFA 5IMOA 5L2KD 5TQ0H 4BQCA 2BOBB 4PJCB 2BNUA 3QDGB 4Z7WA 5I16A 4KDVA 1F5WA 2VXUL 1KTLB 3TM6A 3CFBB 2QQNL 5D6DC 5F7NC 3RI5K 5C09A 3UBXG 3F7YB 2FJGB 4PRAA 1ZLVH 2H2PD 1EJ6A 2IPUG 2NZ9C 4H0HB 5C0NC 3HE7D 4R2GC 3CFKA 4XPTH 3MXVL 2AEIT 4QRPE 5DJ0A 3SGEH 3LKPB 1EZVX 1QUNA 5HHPB 3BEVB 4PV8B 3CMOH 1N59A 3FO2A 1FL3B 3DHJA 2X1XR 4X4ME 3TFKC 1S7VA 2CRZA 3V0VA 5CJOH 4Z6AT 5LXGL 4XXCC 2F15A 4OCWH 3ILPA 4LVHC 5C08A 1QFUL 1WF5A 1XGRA 4RFNC 4DAGL 2X4QA 4KVNH 4EDWL 1IILE 1YA5A 3CX5K 5EU3A 4LF3A 4HIXH 4GAYB 4QT5A 1C12B 3DXAD 5F7DB 4IRJB 2YC1A 4EOWH 4NN6C 3O45A 2BJML 3BH9B 3CLFH 3HZYB 4ZO8A 4XAWL 5GGRA 3JBG7 4H25A 4L8CB 1PZ5B 2VZOA 3SDYH 3FAWA 4ODSH 4NQEE 1NDMA 1Q0YH 4LVNB 2I9TA 5GS0L 4H1LA 1S9XB 4KZDH 2X2YA 3EOAA 1KEMH 2AV1A 4JRYE 5GRJH 1OGAA 2WLYA 4P59L 2I5YH 3K7UA 3VXQA 5IR1B 4ELKA 2VLKE 5IROC 5IFJB 2F54A 1X5IA 2X4PB 3PWPE 2FIRT 4LLQB 5BS0A 3JTTB 2UWEA 3EFFB 4K2UL 1K4CB 4JPWH 3U2SA 4KKCD 4Y19B 1MI5A 1CGUA 3MNWB 3QRGH 1JYVA 3PHOB 1ZA3B 1IC7H 3ZDZF 4NQCD 2NXYB 1AQKH 3W39B 3GBML 5C0BB 2JB6B 1MIEL 4Y0GA 4JO4L 4OM0L 4PJEE 4WV1A 2YXFA 1MHPL 4HPYL 3ZE1F 4XAKE 4NFBA 3LZFH 4V1DE 5C07A 3W2DL 4MJ4A 5HDBE 3BXNA 4HWZA 4NNYA 5K9KA 5D96C 3KPSE 5DUML 1MJJA 3D0LB 2PO6B 3QDME 1B2WL 5B3JE 1BZQK 5JXEC 4OCYL 4DCQB 4OCRL 4UU9A 3PV6B 3SHSA 3X12A 4AG4L 3PHQB 4BFIB 1A0QL 1BF2A 4ZMAT 5ID0B 1MNUL 4LCCA 5CKGA 5E2VH 1XGUB 3TVMC 2FLRT 4P4RA 4CVXA 4X7CC 1IAIM 5IBLC 1YEDA 4OFYD 3P73B 4PG9B 2GK0A 3V4VL 1LO4L 5AAMA 4FN0A 1T2QL 2AQ3A 5HYIA 4FQCL 4YC2B 4JFDB 3TT1H 1IC5H 2FJHA 5IMKB 4OKVA 3U9UA 3VH8G 1AO7D 3BP7A 4R0LA 1JL8A 2X42A 2AK4A 4L9DA 1B90A 4PTTA 3RBGA 4KTDH 2C1PA 5DEFA 2YN5A 4FFYL 1NFIA 1D6VH 1NSNH 1FZJA 1O5DT 2HN7A 4R3SB 4RQQA 4NOBA 1UXSA 3UPAA 2HJKA 1I8KA 4TSCL 1HQ4A 1WTLA 2P8MB 3D9AL 4HPOL 4RFEB 5F97E 1D9KC 2DJ4A 2IAMB 2W60B 2OXHA 4YHPB 5ACZA 1P6AB 5C0FB 3PWNB 5I1CH 1ZLWH 3SPVA 4PY8I 2IPTL 5I30L 5H94A 1VPOH 3S7GA 1EBPA 1Y18B 3ZMRA 1CFSB 1NFDE 2O61B 3SKNB 2NMSA 3UAJD 2P4AB 5D7IB 1BM3L 4YX2H 5D7LA 3KHOA 3S4SA 4XC1H 3L3KB 5D1ZD 4CMHB 5GSVB 3GSNH 5HYEA 2YMXH 3RX5A 3ULVL 1KCVH 2AJXL 1DLFL 4PPTA 1MIML 1T1ZB 2AJVL 2DB8A 2XWTA 5DVNA 4FQ1H 2FDBP 12E8L 4YHML 1WZ1H 1I8MB 4MJ5B 1JHKL 3E2HB 4PRNB 4RMQA 4QRTA 2VB5A 4NHUB 4X4ZA 2G9HB 1IC4L 2YEZA 3QH3B 1AGFA 3ULSA 1MWAA 3CXHK 4WJ5B 3D3VD 4LCWE 4I2XB 4AENA 2A38A 5AZ2L 3QIWD 1CD8A 1MLBB 2X7LA 3MXVH 4G8IA 4LSPH 4OBSA 3AXLA 4XNUL 4P9HC 4EN3B 4ETYA 2ZUXA 4Q6YA 4NZRL 1NCUA 3OXSB 3N06B 3VRLF 1HWHB 3H3BC 3V6OE 1OAUL 1Z9MA 2NY1C 5HHXL 5I9QC 3BMWA 1NBQA 2MKWA 4DGIH 2Q3ZA 3GMOA 1JFQL 4IHOB 3Q5YA 4F3FA 3ZHLA 1UGNA 4EDWH 2D4FA 3EDFA 1WIPA 4MGXA 5E4EB 4GAGL 5ESQA 2G60L 5DJCA 1GRWA 4GXVL 4UIMB 3VWJD 5EORH 1SVZA 2BJMH 5IEKB 2YD4A 4EI5A 4LEOB 3FFCE 4WUUA 4QRQB 3TO2A 4XI5D 1FG2A 3X11B 4G6JL 1MHCA 1AD9A 1QEWA 3D39B 2BP3A 5GS0H 1X4YA 2E5EA 3KPOA 3IJYA 3VGAC 5I8CB 2MCG1 3PWUA 3OBAA 3ARBB 3PL6D 1I1YA 4KXZI 3QHTC 3UEZA 5DDHB 2C1OA 3V6FA 5CD5C 1SVCP 4OIBA 4UI2A 5E1HB 4JLRB 1ULVA 4XBGB 2CSPA 1TNNA 3O3EB 4KVCL 4JY4A 1N3NA 4Y5VC 5I1DB 4GMTL 5D2NA 3TYFB 3SCMA 3OKOB 2LQRA 1F3DJ 3FTGB 4OI9A 3EJZC 1AFVH 5IESL 2COQA 2V5SA 4LRIC 3DV4A 3MJ9L 3U4BL 3GBMH 4L8SC 1MIEH 1ZEAL 4R9HA 1DJSA 1HHHB 1H3PL 3NZ8B 4JO4H 5F9WB 5C09D 2P45B 4OM0H 4WI8A 5IF0B 3B4NA 1DQQA 3GMQA 4KRNA 4KV5E 1ITBB 4HV8B 2B4CL 4PRBB 5EOCH 5DVLA 2H6PB 3GI8L 4FFVC 1XF2A 5I1EL 5TE6L 4MCZB 4DUWA 2JB5L 4RRPG 5D72L 5B21A 1B2WH 3IDGA 4WHTA 3B3IA 2YRZA 5I18L 4OZIB 4OCYH 4JO2L 5BV7L 1UT9A 4L3AA 1G1CA 1G7JA 5C08D 3MV7E 2EZ0D 4AG4H 2C3XA 4I9WD 4D2NA 2CUHA 5CKAA 4FQHB 1A0QH 3GJEB 5DSCB 3VFPA 1FVCB 3LPGA 5DYOB 4MD0A 3PGDA 4HF5L 3SE8L 1N0XH 1SMOA 4L4TE 1DFBL 1MQKH 4EJ1C 1DUZA 1BAFL 5INDA 3RJDA 3V4VH 3LD8B 1LO4H 2WUCL 4WW1A 1U8NA 4FQCH 3RUGE 2EDOA 2H9GA 4U6YB 2MKLC 2H32H 1OGAD 3ZE0F 1QFHA 3OR6B 1CQKA 2L4OA 1MFDL 4ZUSA 4OIAA 1ZVSB 4GAFB 4Y4HC 1KTLA 1MQ8A 4FFYH 3LCYA 4JG1H 5BS0D 4QRSB 3O4LB 3F7YA 3H3KA 4KJPC 3QO0A 2Q3AA 1BQLL 4M00A 1KPUB 1FCGA 5A2LH 3VD9A 1L9NA 1LK3L 1MI5D 3WO4B 2F53A 3IFOA 4HPOH 3HCVB 3TESA 4KQ4L 3VXUB 4JN1L 3O3AA 1Z9LA 3QCUL 1FL3A 5B3JF 3HB3C 2IPTH 2K7QA 1KLUA 4KPHL 5ILTL 1RJZB 1WAAA 1YMMB 2IPKB 3MZGB 1CK0H 5F8QC 1BM3H 3QUZC 3LEVL 4GAYA 4LLDB 5GSRA 3U0PA 5HDLA 1HSBB 4YPGA 5F7DA 2XWBA 4WENB 2JJTC 4XCNA 3ULVH 1I1FB 1DLFH 4G6AC 3ZKND 1MIMH 2XNAA 2OL3B 2AJVH 3HFMH 4L8CA 1PZ5A 12E8H 2VH5L 4YHMH 1RZKC 3RIFK 1CG9A 3BPNB 4E41E 1JHKH 1G7HB 2WAHA 1V3MA 4W68A 4N0FB 1IC4H 3IT8D 5IR1A 1G6RL 4WU5B 1IKFL 4PBVC 1F90H 5IFJA 1KIRA 3R4DA 3WN5B 5FGCB 3GBNL 4NJ9L 1JMZA 1B9ZA 1MJUL 32C2A 4OFPA 1B0RB 4K7PY 1S7TB 4W6XB 3JTTA 4XMKL 4NPYB 3T1FB 4UB0L 5EA0L 1ZTXH 1K4CA 1T4KB 3DURA 3T77B 5E2TL 2ZCLL 3SDXB 1JWUB 5FEBA 2AK4D 1OAUH 2UY6A 3CDGB 3CNKA 1E4XL 3O81A 4IRJC 5HHXH 5DJZB 5IM7B 1UCTA 1AP2A 4OIIH 1JFQH 5C0BA 5M95B 3QIUC 5F9AC 3HN3A 4HDIA 3V6ZB 4P46A 2BHZA 4GAGH 5JZ7C 1RK1B 1FIEA 3IS0X 3LVEA 2OX5A 3O3UN 1C16B 1CGYA 2AXGA 3AY4A 1FGNL 4LRNL 1VHPA 2VL5A 4HQQH 5DWUL 3V4UL 5LBSL 4BSWA 1PJ9A 2G5RA 3R8BB 2DQHL 3JV4A 4G6JH 2RCSL 3QO1A 2EXWC 4LFHD 1Z3GH 2AJYL 1ZWIB 2ILLA 4MMXC 3ZO0A 5IK3A 4BSJA 2PYED 5GS1B 3PP4H 3PHQA 4KU1A 1OAKL 4BFIA 1SJEB 1U6AH 4O2FB 3ES6A 5D7LD 3KXF