2AJXH

Crystal structure of cocaine catalytic antibody 7a1 fab' in complex with transition state analog
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
b'EVKLSESGPGLVKPSQSLSLTCTVTGYSITTNYAWTWIRQFPGNKLEWMGYIRSSVITRYNPSLKSRISITQDTSKNQFFLQLNSVTTEDTATYYCARYDYYGNTGDYWGQGTSVTVSSAKTTPPSVYPLAPGTAALKSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody 7A1 Fab'
molecule tags Immune system
publication title Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
pubmed doi rcsb
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajxH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajxH01
4K7PX 4U1KB 3PQYE 3RWIA 2FO4A 5M94B 5DK0A 1LMKA 1I75A 4UU9B 4X4YA 1S9YB 2C9AA 1SEBA 3TH4T 4IIQA 5CWSB 3D18A 2E27H 4UZGA 5E2JA 2M2DA 3GIVB 2QQKL 1T0MA 1H0DB 3VFGH 4HJJH 5T1DL 2BRRH 2L4OA 5CP7B 5J89A 3MV01 2Q86B 1GJIA 1BQHG 4M1GL 4Z5RA 4EI5A 2FL5A 1GH7A 2WLZA 3DROA 3NA9L 2PYEE 1D6EA 4OTXH 1D5ZB 5EUOB 3ZKQD 3LQAC 4F15B 3PGCA 1YEHL 3AM8A 3H9ZA 1I3GH 4OLZH 2FLBT 3ZYZA 3VRIA 3PQYD 3SCMD 4HX1A 5F71A 3RKDD 1R3LB 5I71B 4XVUC 5GGTH 4DGVL 1MCDA 3WO3B 4LSQH 3MGAA 2YEZA 2ED9A 3NCEB 4PRIE 1WIOA 4G6JL 5F21B 4LARL 3D0LA 4XNXL 2BY2A 2MCG1 2JJTC 3ULUH 2G5BA 1QPXA 4HT1H 3HCVA 4QWWC 1RZGA 5DJ0A 4GKOA 4U1NB 5ISZA 3U6RA 1BQHA 2YD3A 5I73C 1AP2A 2EYSA 3TF7C 1IT9L 1SEQL 5GGVH 2WWMD 4Y4HC 1EH9A 3IJYB 3S88H 3VXTA 3PWPE 5HJ3B 4DKEH 1LP9B 1CIDA 1W0WA 2VABA 2WBJD 5DZOA 1EUTA 5MEPA 2VE6A 3L3OB 2IALB 3MODH 5I74B 4UTAH 4F3FA 2R56H 3QWQB 2X1OA 2J88L 2W59A 5ACMA 4LEXL 4HUNB 1R5WB 5IBUB 2EIEA 2QADC 4LAQH 3GSXA 4ZAKD 5E5UB 3MXWL 3BPCB 4HWZB 1BMGA 1KCKA 1WFUA 4XRCA 4ERSL 3QFJD 2N7AA 2UWEF 4F8QA 1J10A 1MHCB 2AQ1A 3HLAA 2Y5TB 4NZTH 4PRDA 4Y16A 3CH1B 4UB0H 3RY6C 1BWWA 1Z9OA 4ZNCD 4WUKL 4HLZH 2HFEA 1NEUA 2JJUA 2OZ4H 1T7XA 4LF3A 4PY8I 3CZFB 1U8KA 5DR5H 5GGTL 4TSCL 3CXDH 3TA3A 4JZJC 1Q72L 4YHYB 4ZG1A 4ERSH 5CJBA 1YEDB 2D9CA 1QSFA 1DSFH 2EDFA 5KVGL 1Y6NR 4HC1A 3S96A 5DD1H 1JZ3A 3RIFF 1WBYB 2R69L 8FABB 2O61A 2QHRL 4CMHB 4F7TB 2LU3A 1D9KC 3GI9L 4ZSOB 3F7QA 2FIKB 4XNQB 5ETUA 2YD9A 4PJEB 3L3HA 3MRMB 5GGVL 1XGPA 1M71A 3G6JF 3B3IB 3SBWC 3GBMH 1V7NH 1QBLL 3O6KH 1MJ8H 1ZT1B 1T6VN 4N9GB 4QHMA 5L88L 5KG9A 4HIXH 4LHQB 5JZ7D 3TBSB 3VFRB 2W9DL 4KKLD 4ONGH 2GKIA 5IROA 1UM6L 4TTGA 4ZD3H 2CSPA 3FO2A 4EBQH 4H1LA 2X4NA 1KJMA 4NKMB 15C8H 1UM5L 3MJ9H 3EYVB 2OJEB 2UVEA 4EDXA 5F7UA 1A14L 2Y9RT 3ARDC 3CSPA 3KYOB 3MUJA 1MCPH 3MRNA 3RVWD 4CVZB 5J9PA 3UJIL 5CEZH 2ICEA 2XN9B 2IANB 4QRQB 1CXEA 4PRHD 2VC2L 3LOWA 3DURA 5A3IC 1FVEA 3ES6A 4JFZL 4G7YL 3PWPB 1I3GL 3ILQC 4OLZL 3GMNA 4XC1L 1MAML 1OAYL 5JPNB 3LB6C 1QYGH 3TVMD 1R24A 1DFBL 4GBXD 3WHXB 4G8GA 4XPFH 5IT2L 2B5IB 1XF4B 3DHMA 4HJJL 4MA1C 4OFVA 1J0KA 4X6DA 5DZNA 1QEWA 2C3VB 5JXAH 1F2QA 3HC3H 1HOCA 1BFVL 2GW5A 1U8NA 4JQIH 4N90D 3G5VA 4HIHA 2V9QA 2VC2H 2EYRB 2PUQT 1MY7A 3FO9B 9CGTA 2YPKB 1UACH 4G8EA 1PG7L 2PR4H 1GOGA 4PJ9B 1JN6A 4LFHG 3QSKB 1VFAA 3JWNC 3D2UD 3MO1A 1BVKB 1OAKL 4OB5H 1UFUA 5E1HB 4GRWF 1SYVB 4HKXB 4ZDHB 3ROOA 2XA8H 3QUXA 3W39B 1YN7A 1MCEA 2Q76A 1FNAA 2FCBA 2NY6D 5EC2A 4WIQA 1ZGLA 2VDQH 5C08A 1AGCB 4LPCA 2PO6C 5I66A 1WK0A 2HLAB 5F3HB 5EN2A 1JPFA 4WV1C 3BPOB 4WNQB 3WJJC 5IOPA 4KTDL 4IMKA 1F4XH 1D3CA 1N64L 2D7TH 1FCGA 1OAUH 4OZIA 1HNFA 4LSRL 2HMIC 4JHBA 2R4SL 1RZJH 2IFFH 4D0DB 4I8DA 5DD3L 1REIA 2ED8A 3C60B 4PJXF 3ULUC 2BNUA 5CILL 3BZEB 3GMPB 4XPAL 2Z8VC 3D87B 3O9WC 4TUKH 5HHXH 3QEUB 1A9EB 1I8MA 3QCTH 1KEGH 3B9EA 2P5EA 4HX1B 5IW6B 3NIDF 4XTRD 5CBAA 5GRXG 5KS9F 1F11A 4PJBF 1IEAA 1QKZH 3PWJA 5I8EA 2A9NL 1NQBA 1HKFA 1R5VA 4R7NB 3MJ9A 4ELMA 5MEOA 4NQCA 1MFDH 2NY3D 3V2AR 2JJSC 4WY7H 1PX4A 2DD8L 3FT4A 3O3AB 4CAGA 3DX6B 3WIIH 1JTOA 4OUUA 3W5MA 2P8PB 4PY8J 1IAOA 5BV7H 1YNLH 5EBGA 5LAXA 3BHBA 1VKXA 2IMNA 1LQSR 1BJ1J 1MCHA 5C07A 5BVJA 4MAUH 3BGMA 5FA4B 3U1SL 2FSEA 3ZKND 3TBVA 1A5FL 2E6QA 5E8EA 4P2OB 2YD7A 4YO0B 3FQUA 5IMKB 1IM9B 4D9QE 2L7JA 1BOGA 5HGAB 1SMAA 2H8PB 4LF3B 5FECA 1QFWI 1EAPB 5HVWA 3AY4A 4JKKA 3RVXC 1HDMA 4NUGL 4D9LL 1X5HA 1LO5A 5BV7L 2CR3A 5FO9A 2LVCA 3MLVH 1UQSA 3GSXB 4Y5XB 3IDUA 3WFEH 1FFOA 4BKLA 1JF6A 3MPCA 4JFPB 3LEXA 2XTJE 4PGJA 1EXUA 4WO4C 4PRPA 4AQOA 1CI5A 5C0FB 4RGOL 1M05A 5ENWA 5J12C 1BD2B 1BEYL 3IFNL 3PL6D 1FZJA 5EU7C 5AZ2H 5DO2D 3C6LB 5MEQB 3EOTH 3VXPA 3JTSA 2YHGA 5FKAA 3WIHH 3PWLB 4GKNB 3CC5A 1YUHB 4U6XB 4P4KA 5KG9B 4QXUH 4KJWD 1FBIH 3IDNB 3FB7A 5JW4N 1D5IH 3BP4A 3OAUH 4FXKB 2YRLA 1KJVB 1YMHB 1LGVA 2FX8H 2QSTA 2ZOLB 3PGFH 4H1LB 5I17A 1F5WA 4JFZH 3MV9D 2WWKT 4AEIH 4M6OL 3WJLC 4RFEB 1FGVL 2CKNA 1L6ZA 4WWID 3FZUC 1IGMH 2A1WH 3I6LE 5ETUB 5E8PA 1H8SA 4HWBH 4JQXA 2C26A 5ID0A 5JW5A 1IMHC 1EUUA 4PS4L 3GM8A 4Z7QF 3QBTB 3T0WA 5IV2A 4PRNA 2H2PC 4APQB 3HUJB 1ROWA 3RVVD 4CU8A 4OLUL 4M3JA 4X99A 4G8GB 4L1HA 5F1IB 1NAMH 1A6AA 3X3FL 3DMMD 5K33A 5C7XH 2UY7A 4X5WA 3GJEA 4PRHA 3DX7A 3CVHA 4R4FL 4Z9KB 3REWB 5A2KH 4HCRA 4BQ9A 4WCYL 1R3JB 2E9JA 4QRPE 1BBJB 2A6JB 5ALBL 3HNSH 4AENA 3U7YH 3GZKA 1S8DA 1KN4H 1NUNB 4JFYA 1INQA 5HHNB 1DL7L 4X6FB 3U2SA 4EN3C 3H6JA 2VAJA 5HGHA 2UWEE 3C8HA 3GSVA 4XGZB 3T1FB 2IBZX 5IR1B 4QXGH 4GG6F 1A9BA 4QRSA 4U2YA 2DI7A 4P23B 2W0LA 3PUCA 1PZUB 3MBEA 5J6GB 1QEWB 1G6RB 1C16B 1D7FA 4BZ2L 1EERB 1HI6A 1XIWD 4P2QB 1HOCB 1TTGA 1I8LC 2AEQL 2R8SH 4GXUM 2IQ9L 2ZG3A 3LZFH 1HH6A 1DUYB 2Z31D 2HG5A 4J8RB 2NY5H 1T5WB 4FN0A 2DF3A 3T08A 4FXLA 4X7FC 2WP3T 4XCNA 5E24E 1KIPA 5C07E 4AM0A 2UY6A 2R4RH 2DTML 5DC4B 4XZUA 1KG0B 3LQAL 1OTSD 1SYVA 3FO0L 4MSWA 4P3WA 3WBDA 1KB5L 5T1LD 1JHKL 2CRZA 2MPAL 3IDYC 4HK3N 3ZHLA 2ID5A 1IBGH 1KIQB 2QL1A 1BQSA 1AGCA 1MJUH 2V2WB 1OSZA 3NFNA 5F70A 4NJ9H 2BSRA 3GNMH 1OGTA 3VD7A 3OTTA 4ZPTA 5E5MA 2IG2L 32C2B 1UXSA 3VFOB 3BWAB 4FXGA 2ADJA 4YXLL 1ZK9A 4Z77B 1KC5H 4YFLF 3QO0B 4LLMA 3L9RB 4N8VB 2O26U 4DKEL 3Q5TA 5D7JB 3FT4B 3Q5YA 4PBWD 4F58L 5CBEA 4A6YH 4DGIL 5ILTH 1KN2H 3WNOA 1KGCE 5FGRA 5HYJD 4GQ9H 2R1XA 3UPAA 4BSWA 4MQ7B 1I1AC 4B0MM 1FN4B 1V7MH 5D8JH 4XWOD 2P5EE 3MRHA 5DMGD 1S9XB 3HE7A 2VQ1B 4XWGH 4R4ND 1FGNL 1IFHH 2EIBA 1FV1B 1GSMA 3F65A 1IGYB 4U1SA 4PJDA 4WU7A 1IBGL 4EZMA 5FECB 4TVPL 1KNOA 3KVQA 4FQ2H 1OAXL 4ELMB 4R7DB 2IQ9H 1P4IH 1ZTXH 3UROR 3ZDZE 4IRJC 5EZJB 2HTKD 1U36A 4HWBL 3FCTA 4V1DB 3VXUB 4DZBA 1S9VA 4MJIE 5F97E 1SYSA 3FKUS 5LAXB 2FIRT 3O4LB 4WENB 3X14B 4X7SH 2DLIA 4H20L 3RX5A 3FQNB 3DXAB 1W8NA 2ZCLL 4WWKC 4XMPL 1AGFA 1AR1D 1RZ8B 1WQVT 2B4CL 1OP3H 3TT1L 1ZA3B 2D03L 3VGHA 4WCYH 1JZ4A 3EOTL 3V52H 5DHVB 2PTVA 1FG9C 2BVQA 1X7QB 4UIMA 2G75A 3VDBA 1Z9SA 1F90L 5CFHA 5IEHB 3GKZA 4LARH 2HVJA 4OV6F 4PG2C 4NCC2 2Q8AL 3CFCH 4ZFZB 3HE6C 1GGUA 2ZUVA 1HE7A 3U9PH 1C12A 2AJZB 2FJHA 3HS0B 1CFBA 3MXWH 4NPYA 5EU7E 5EBWB 2N56A 4M1DH 1U3HD 4OFKA 4I3SH 5CIPH 2DMCA 1EEYB 3WUWB 4E41D 3FTGA 3AS3A 4ZO7A 1ZGLP 4K9EH 4O2FA 3OF6D 2E9WA 5FUZH 2O5ZL 3LIZL 5F8RC 2WWKO 1HXYA 5IESL 3TFKD 4JAMA 4L4TD 3N1PC 4KJYA 4M7LL 3RWDA 3L3JB 5CCKL 3EFFB 2UZIL 5C0BB 2OTUA 2W9LA 3MXVL 2IJ0C 1WWBX 2HFFA 2NY0B 5DMKA 3L3DB 5E99L 1V3MA 1HHKB 4KI5D 4LCUB 4K3EL 4P59L 4JB9H 4FFVC 3KPOB 3S34L 2XZAL 3EYUL 1CDCA 1FIEA 5LCVH 4PGBB 5B4MC 4NQVB 2W9EH 4LLDA 3KNBB 2FR4A 1NEZA 2WBJB 3I50H 4DKFH 4Z7NE 4J6RH 4R90H 2AK4B 1LO4L 3HLAB 2Y7QA 4M1CC 3TYFA 4Q9RH 5JMRA 4Y1AA 3EW3B 4OF6A 4XNUH 1CFTB 1RJZA 2AJXL 1U8IA 3ARXA 4WO4A 3WS3A 3VD9A 3KYNB 3O4OC 1B2WL 1UXWA 4H1LG 2JELH 4PLJC 5EG6C 3MRQB 2XTJD 3RA7H 3BVNB 5J13C 3AS2A 3UTOA 4W70A 4NZTL 1T89C 3DYMA 3CFBA 1I9IL 4KJPD 5ACZA 4NQEE 1U58A 1OL0A 4JRYE 5ERWB 3GSWA 2MWCA 3E8UH 4F57L 5EU3B 1W0VA 5F7FA 4MNQB 4Z78A 5FYJD 3D39A 3WE6A 5J8OA 3KPPB 5ITFA 5D71H 2I07A 2ERJC 4WDIB 1AD0A 5TE4H 1DJSA 4N9GA 5EFIB 3H9SB 1K6QH 2PYFB 3QA3A 4WY7L 5DD6B 4ELKB 5GGTA 2YRZA 1HHIB 1NJ9A 2IFGA 1M7DA 1QRNE 1DUYA 1AO7A 2CUMA 5B21A 5KSBB 4Z7WB 2FBJL 2FB4H 1YNLL 4KKAD 1EJ6A 2JIXA 4ODVH 4OBSA 3RUGF 2IEPA 4Y19E 1H3TA 3BQUD 4LLYB 5IMOA 5JOPD 4Z6AT 4XZUB 1UM4H 2UZYB 4NM8L 3RQ3A 4KMQA 3S3JA 4BH8A 4WUUB 1S7WB 4PD4J 2JTDA 2DYPA 4Z7QE 4JN2A 5E6IB 3PWPA 2VKWA 3L1OL 1R3HB 1VSCA 1I1FB 1N59A 1FV1A 5D1ZA 1UZ6E 3LAFA 4JFED 2LTQB 5IB4B 2P45B 4G6AC 3BT2L 3BDYH 3MRGA 4K3GA 1GVIA 1MRCH 5DRXB 4AEIL 4D0CB 1T89A 2F15A 1CVSC 1P9MC 3ZL4H 2EH7H 4RMVA 3U0PB 3JTTB 3AU1B 2X9XA 4UINL 4QEGA 2D3VA 1U6AH 4PJ9A 1RQ5A 2DLFL 1XR8A 3BKJL 5D1QA 1EO7A 3FJTA 4LOUD 1JUFA 2P43B 3S3PA 3MRRB 2OYPA 1A4JA 2EKSA 4NN7B 4HZLB 2Q87A 3SKNA 3VFNA 5I1DB 3CFEB 3EO9H 5EPMA 4ZS6D 1YQ2A 2Q8AH 2OR9H 4UDUA 1ZHKA 5CMAB 1D5BA 4RGOH 4AMKL 2GJ6E 5IFHL 1AQKH 2X4PA 4QOKD 4X5XB 1FSKC 3I6GB 1YECH 1G7QA 3EYUH 2FBJH 3D0VA 2OQJA 4HJGA 1B6DA 1HYSC 2IG2H 4D94A 5BCAA 2CDEA 4QO1A 5GIRB 3I6KA 3E6FB 4N0CD 4RZCA 1RUPL 3HB3D 5HDQH 2FZ3A 2VYRE 3AS1A 3VMOA 4HS6B 3PQYA 3SCMA 4YLQT 4OGXL 5HVHC 4P2RA 4Z7VA 2VXTH 4NQDA 1EJOH 5BOZG 3HAEA 1OAUL 3CK0H 1CFVL 2EEBA 4P2QE 4MLIA 1CE6A 1T7ZA 3QUMB 4PJIA 4M1DL 5HI4D 1IQWL 1A6VH 2AEWA 3QUML 2G75B 5DJ6A 4GG8B 1JBJA 3OKKA 4JQXC 4ODUA 2X4SB 3MLYL 1ITBB 5I1CL 1TJGL 3BXNB 4P3DA 5ISZD 3OG4B 3H3PL 1V8HA 3NN8A 3WFHA 4FQ2L 2QBWA 1PQZA 3LPWA 4LRNH 3N06B 2X9WA 2VL4A 4XVTL 2I9TA 5JW4M 4KK5C 4OQTH 1LDPH 2FH8A 2VDKH 5CINL 1N0LA 4TUOA 2C7UB 1CQKA 1H3VA 1A6ZB 4L4VE 3GSNA 2GQHA 1E6JH 2FYYA 5ACLA 1ZHBA 3NH7H 4Q2ZA 2IPTL 2LAGB 4U2ZA 4JN1H 4OGXH 4LSPH 3V7MA 1DANU 2LFGA 1KN4L 4DJMA 5CJQH 3RWEB 5DTFB 2AV7B 3WNPA 3WEXA 5HHPB 5DQJB 3CMOL 3DNKA 1A7OH 2A6DB 4XB8A 1OF2A 2XQYG 3BDBA 4NQSB 3QHZH 5FYKH 4M4RA 5C0DA 3Q1SL 5HVGB 2CJUL 1TXKA 5D6CA 5D2NB 2JJTA 5BJTB 4MA8H 4LLQA 2BERA 1EFXA 2CIKA 2GSIB 3AY4C 3WS6A 1AE6H 4MGXA 4NNPL 3QCUL 3TIEB 3TWCH 3QNYA 3VDCA 4PJDF 2W07A 4F37K 5AZEL 4Y5VC 3ORJA 4MQXC 5B38A 1N6QH 2V17L 4I3RL 4JKPH 3L5XH 4GSDH 1M6OA 4HS8H 4UT7H 3SGJA 4BJLA 4U6XA 1ZAGA 2HT4D 5I9QC 4GW1A 4NN6C 5BRZA 4P48A 5GZNC 4E0RA 4FXKA 1WCBB 1TQBB 4GAGH 4JPIB 3QWOA 2NY0C 3SKJH 5B3NA 3RJDA 1JZ6A 1L7IH 5C0CD 2EDRA 2UYLA 3QXAB 3VCLA 3L5IA 3X12B 4LPYA 4NFBA 1BGXL 2R29H 1IGML 2A1WL 4L29A 2C1OA 3BO8A 4FMFA 4KZDH 3O3DA 2DQJL 3MTRA 5ANMA 1Q38A 3UTZB 5EU6E 4JREC 3L3IB 2QADD 3MX0A 4ORZC 1HSBB 2VLRB 3T2NL 4GUPA 1D9KB 1F4YL 1TIUA 4ZTOL 3K4AA 5DJZA 3MCLL 2XQBH 2D0HA 2BNRA 5D7IF 5I1GH 2AI0H 2ADGA 2ESVB 1RVFL 3QUYC 3FN0H 1R3KA 3MLVL 2VDPH 4LL9A 1U8QB 5BS0E 5ID1B 2V17H 3DX7B 8CGTA 3ZTJG 2GAZA 1RFDH 2WANA 1JIBA 3S97C 4C56A 1AGDA 2H2SD 4TVPH 3RVUD 5J6HA 5T1KB 4EIZC 1G7JB 4ZOAA 2GJZB 1S7QA 4ONGL 3MLZL 3MA9H 2GIYA 3DJ9A 3HZVA 2XZQH 2NYYD 2EH7L 1FLRL 2X4UB 4JZNB 3VXSD 1CDHA 1J11A 1EGJA 4L9LA 5FEBA 3MV9E 4ZUVA 5MP6H 2IGFH 3VI4E 4MJ5A 3OZ9H 3V95A 1N5AB 3ROLA 4O2EB 3RJQB 1NFDF 4JPVH 3OB8A 3LEVH 4MXQD 4N1EA 3O2DL 3BKCH 5ICXA 1C16A 2X4RA 4Z76B 1U3ZA 2WMPA 3ZHDA 1MOEA 1SJEA 1DQJB 3MA9L 3U48A 4C57C 5SWSB 3N9GH 3JV0A 3MV9A 3A6CH 4LSRH 3EDDA 3U0PA 1JYWA 1HKLL 1VDGA 5IG7A 1FCCA 1F6AB 2Z8RA 3CVHH 3PJSA 1XR8B 1GCFA 1MHHB 4KJQD 1PSKH 1Q72H 3EKCA 2AJSL 4M5YL 3FHQA 3MSPA 3SDAD 4AK1A 1CE1H 2CLRA 2Q3AA 4KVCL 2EKSB 4IRJA 4R9HA 4ZTPL 1WTLA 4NRYA 4NHCL 2VZOA 5F3BA 2X09A 5GXBB 1T7VA 1JNNH 4P5TC 5JIKA 2HJLA 5EO9B 1K4CA 2FBOJ 3U4EB 1S7UB 1S9WA 1I7RB 4DGVH 2FECI 1AGEB 3QDJB 4G6MH 1OAKH 1VACA 2BDNH 4HZAA 4GAYA 5T1LB 4S10A 1Q9WA 3IVKA 3BAEH 1YEJH 1PLGL 4JGUA 2GY5A 3FOLA 3NPZB 4JN1L 5CP3A 4XNMB 5IK3B 3CD4A 5HHVH 2QR0A 2PYEB 3PQYB 4PJAB 4NWUH 3SCMB 4X0KA 3T0XA 1T83A 4NRZB 1JWMA 1U95A 4LCCB 1A1NA 4WHTA 4FQHA 3QG7H 4P4RA 3DX8B 3KJ6H 3IDGB 1LDSA 1M7XA 2V5MA 1CE6B 4HS8L 1UWEL 1VFBA 5D5ME 4OT1L 1VA9A 1UB6A 5GS2H 2IANE 1QFPA 1RK0A 1NANI 1OWWA 5E9DB 3V4UL 1TPXB 2VL5B 3IKCA 5FYKE 1B9ZA 1R0AH 3PP4H 4IM8A 3O8XC 4WW1B 5L8KB 4MXWH 4OLYH 5DHYB 4RCAA 2PO6D 4HPYL 4JRYA 3TNMB 5D6CB 3TPKA 4ETQB 2EIZA 1TCRB 4Y5YB 1UYWH 1GGCL 4NQCE 2X6MA 3S35H 5F6HI 2F54E 2Z4QA 1I1YA 4G8FB 1IZJA 3KXFD 3FQRA 4ZFOL 1ZHBB 1CL7L 1L7TL 3NCJL 2C4XA 3CH1A 4NFCA 2ATPB 5SX5H 3LRGA 4Z7UB 1MQKH 4HIJB 4M9PA 5CHNA 3GBML 3S4SA 1LK2B 1MCRA 1T22B 4U6YA 4UV7H 4XX1G 5IHBA 3ZDZF 1KJ2H 3QH3A 3VXUD 3L6FB 4QY8A 2O5ZH 4E0RB 1UYWL 4XVUD 3L5XL 4GSDL 5E2WH 4RA3A 3QI9C 5DJ2B 2F53D 2FX8L 3T4AB 5E4IA 3NABH 1C5BL 1WZLA 3MR9B 4XVTH 1AJ7L 2BHUA 1XFPA 1MIEH 1NSNL 2VLJD 1FYTA 3VFUB 1CGVA 4MDJA 4XWGL 3RRQA 5BXFA 4OZGA 4EKXA 2A83A 3PF2A 4QTHB 1VGKA 2CDGB 5F7WC 1MH5B 4YHZH 2P5WD 2NY1C 4Y4HD 2HT2C 4YXHL 1MCOL 3QUXC 3LN5A 4KKNA 2ICEB 1KN2L 5KSAB 5HHXL 1DE4A 2A73A 4OF7A 4POZC 4GW4B 4TVPE 3O6LH 2VOTA 4KXZI 5FDWA 4YDKH 4RMTA 3TVMC 1WTGT 5MENA 4C56B 1NC2A 5HDQL 1FIGL 1XF4A 2YD5A 2J8HA 5I2IA 3PNWA 2ZG2A 2YR3A 3ZDXF 3WXVH 1H3GA 5IIEB 1CXLA 3P73B 5TDPA 3DUUA 1F3DH 3TZVB 3RKPA 4HIHB 1JMXA 1UJ3A 4KTEH 3BESR 2AK4A 1JNNL 3MV7E 5AZEH 1E4XI 2CKBA 1MIEL 1NSNH 3L5JA 1N5AA 1F3JA 4O2EA 2AKRB 4PJCE 4IOIB 4RRPG 4X6DB 3WFCL 3QFJE 4NN6B 1UCBL 1KLUB 4QHLA 1ND0A 1FGNH 3ME0A 3B6SA 5JORB 1MREL 2R0ZH 4PP2A 3W39A 1LD9A 2NY5L 3CUPB 1PG7H 3F12B 3LZFL 5T1KA 3KLHD 3FO9A 5HHOE 3J7HA 5IP4A 2R29L 1S7VA 1VFAB 3S35X 1LE5A 3LV3A 3PDGA 3PWJB 2NR6D 3KR3L 5I30L 5JXAL 4Q7DA 4M5ZH 3HI5H 2JCCA 3JXAA 4HPOH 4KRPD 2IPTH 4L4VD 1SM3H 2BHZA 2XTJB 3SGDI 4PJDE 5I0ZA 4M93C 5IMLB 3GBNH 4PR5B 1TPXC 3O6ML 3QHTC 3DX6A 4FFZL 3HRZB 5EN2B 2ITDB 4LFHD 1T0PB 3CXHJ 4IMLB 4YZFE 1NMBH 4NCDA 5T3XD 1WV7T 4I2XA 2F54B 1H5BC 2NW3A 1CT8A 3O45B 1JGDB 1DLFL 1TJIL 2YKLH 3NCYS 4XAKE 1MFDL 2XA8L 4ODWA 4QRRB 1UJTA 5IROC 1K4DA 3KPRD 1TLKA 4MVBD 3EYFB 1A6UL 5CD3B 1N26A 3QB7C 4MB4A 4NC2B 5JUEL 3ZDXE 5H35A 5C9JB 4JDVB 4HUMB 3RY4A 3DOSA 4Y1AD 3W2DH 4F7EA 5A3ID 5KSUA 1S9WB 1MCBA 1XGUA 2EZ0C 2DBLL 1YZZA 4I0PD 4UQ2B 1JV5B 4K3DL 5I76B 5HD8C 4KDTC 2FX9L 5SX4H 3EOAB 4JY5L 3E2HB 5E8EB 1FFNB 1KPVA 1C7SA 4WFED 4P2CG 1XZ0B 2AABL 4ENEC 3MA7A 1X4XA 4LHUB 4PJEE 5B8CA 2DQEL 3WNMA 2JELL 5C09A 4BK4A 1JUFB 3VXMB 5D7JC 2AXFB 3A6OA 4CN4A 1UA6H 4RRPA 4CNIB 5C6WH 4DVRH 2ZPKL 3W82A 3ECBB 2AJUL 5GS0H 1G7LA 4Q0XH 2GTWB 2WUBH 3MC0A 1I8LA 4FQIL 5E8PB 4PGCA 5KAQF 5EO1B 3D3VE 1U6AL 5JLZA 2LV4A 3GHBL 1X5GA 2H3NA 1NLBL 3WFEL 2YD4A 3I6GA 1NGXB 2PKDA 4XH2B 1B88A 4TULH 4JDZA 3BAEL 3C2SA 5HYIA 5MERA 2Y06H 2VXVH 1EXUB 4NJAH 3STZB 1FL3A 4QOKA 1L7IL 4H1LH 1NEZG 4K71B 3VFUA 4DEPC 3O9WD 1MLBB 4PJXE 1ACZA 4OZHF 1OPGH 4O4YH 4RFEA 1ZWIB 3DTXA 1CLOH 1GGYA 2F58L 5C0IA 1WSST 2HJFA 3AAZA 3FB7B 3B8YA 3IDNA 5TE6L 4PJIB 1ED3A 4MA7H 5JDSB 2VLJA 3BUTA 3JWOL 43CAB 3ZDYE 3GRWA 3HUJA 2B4CC 4ODUB 4WJ5B 1MJUL 1MI5D 4OLWH 4OGYL 4P3DB 4YR6B 4ORGA 3LKNA 2EDEA 4NC1E 2APVA 3MNWA 4YHKL 4BQ8A 5L2JA 2ADFL 3IFLH 2GCYA 1YDPB 4NFDA 5L2KE 2W9EL 4HC1H 1Q9LB 1JK8A 1S9YA 5E4EC 4FTVE 2VDMH 2V2XA 3BW9A 3BH9A 4YPJA 3RZCD 5J3HD 4J2XA 2XTJC 1X5ZA 4LASL 5FKPA 2VLKA 3RPIB 3WL9A 3U79A 4JFYB 4X6FA 4FRWA 4AEEA 4AIZA 1E28B 4XCNB 5EBMA 2VSCA 4MB3A 2NY7H 4S1SL 5D9SA 5TFSH 1YYML 4OLXL 4H88H 5GS0D 3CFKB 3DX9B 5C0BE 2FL5B 4PV9A 1RZKH 3ARBA 1TVHB 2P7TB 3VE0B 5D6DC 1DVFA 1JTTA 4K8RC 4S0SD 1BVLA 2XRAL 4P23A 1Q0XH 4APQD 2IADB 4C59B 3DSNA 5E03A 3QUKA 3MJ6A 4U6TA 1V5JA 3RWHB 3P0YH 3UZQA 1XIWC 5EU6A 2B2XL 4W4OA 4YXKL 1MJJA 3L95B 1AQDB 1JWSB 4HW6A 3VWJA 1ZSDB 4CL7A 3F7VA 1JHLL 4RX4A 2DJSA 4JFXB 4CU6A 4YAQB 1T3FB 4P2RD 4YEFA 4JPWL 4TYUA 4K8RL 1ZLUH 3ZTNL 4F8TA 4G80A 2JB6A 4O02H 2DAVA 4OT1H 5CP7A 3PL6C 2X4OA 5DVKA 1A6VL 3MBEB 4FQXA 5T3ZE 3B9KC 3EJYC 4PRID 5CZKA 1Z5LB 4HH8A 3NACH 4P2QA 5SV3A 1U3HC 3QEQA 1LEKA 2WZPD 3I2CH 3MUHL 3O3EB 4KRLB 4K2UH 3PWUA 1T2XA 1YEEL 4HXBL 3IS0X 4MQ7A 4QF1A 1RIUL 3BP7A 4U1LB 4J7RA 4ZYKA 5DSCB 3LKSA 2R9HD 2XG4A 3NTCH 4PJ8D 4Q74A 1RUML 1KV3A 5DC9B 4QRRA 3FFCA 4L29B 4MJ2A 4NQXA 4WU7B 5KVDL 3OX8A 3NH7L 3UTZA 3CLFL 2DS4A 1GYAA 3B9DA 3D0LB 1AFVH 2Z31B 2QQKH 1OP5H 2BOCB 3IDIA 4V1DA 1ZT7A 4H0GA 2GJ6A 5DJ0B 4S0TD 1FNGB 2VDKL 2DMKA 1TJHL 4U1IA 3DPBA 4L9DA 5DD0H 1EZVY 2KZWA 1QO3B 4PJ7A 5FYKU 4OAWB 5H8DA 3BQUA 5SWZE 5C0RL 3KPSD 4I2XB 2Z92A 4XX1E 1Q1JL 4JFDA 1CU4H 3X3GH 1R3KB 3DMMC 2AAVA 4CMMB 1FO0A 1Y18A 2PW1A 4PJHF 1WLHA 2R4RL 5FM5M 4X7TA 4GMSH 5E6ZA 3NACL 4MXVF 1T21B 2QADB 1UWEH 2VLRD 1FQ9C 3WD5L 1B4RA 1K4DB 2OSLB 4MXWL 4ZS6C 2VQUA 1BD2E 3RNKB 1KB5A 4M7JL 5H35B 2X4QA 1IKFL 1IL1A 3P0VL 1NGWA 4R2GC 1WFNA 5C09B 1BIIB 4L8BB 3HNVL 3M8OH 3E0GA 2ZCLH 3CAFA 2DQEH 1P6AB 1XGUB 5EH1A 4HHAB 5TE7L 1IGJB 1VCAA 2Z8WC 1I3RB 3RUGE 4JZJB 1R3IL 1CLZH 1E4JA 4A2LA 2EDBA 3VWKD 2AXGB 1Z3GL 2R69H 5EIIA 3RTQD 1XGPB 2H3NB 1IEHA 4OCSL 1RJCA 1HHHA 5FB8B 4LEOA 1ZE3C 1KCUH 1FVDB 3T2QA 3VFMA 1MCQA 2V9TA 4LASH 3ZKXB 4FQLH 4OM0L 3GSOA 4DQOL 4ODTL 2NX5E 3VI3E 1T7YA 3NCMA 3D1MC 3IFNH 2MKWA 4OB5L 5CKGA 2W1NA 5KZCB 5I1HL 4DK3A 3HE6D 4LHJB 1RJLB 1F02I 5FM5O 3ESVF 3TT3L 3KPOA 4IDJH 2VN7A 4L3CA 5GGRY 3T0AA 3RIFK 1BWMA 4XMKH 2YRPA 5M95B 1FZOB 1NGXA 1O5DT 4Y4KA 2B2XH 1KXTB 2ZUWA 5HGDA 3O9WA 1I9RL 4JM4L 3Q0HA 5TE6H 1IAKB 3ULVL 3TYFB 1W2KT 3B2UC 3ZSTA 1V3KA 1IQDA 1FSKB 3OKLB 4X6CB 3SKJL 5T3ZH 2CH8A 3IDJA 3QDGB 1HH9A 1N64H 1P69B 2UWEB 4X0KB 4WV1A 2R4SH 3VU2A 2GTZA 3PGDA 1UXWB 4OLVL 3QG6A 5M7QA 2Z91A 2EYRA 4YPGA 2SEBB 3LEVL 5JHDD 3BE1L 4DUVA 2MQCA 1I1AD 2VMFA 1YEEH 3FONB 4AIZB 4X6CE 2AJ3B 4DN4L 3O4LE 5BO1H 4C58B 2XZQL 3T0ED 3B43A 3O2VL 3TT3H 5I1GL 1LNUB 5DJAB 1AKJA 5EC2B 4CBPA 1RHHB 4LCUA 2VN4A 1ZHNA 5FUOL 3Q1SH 3WS3B 3TNMA 5D1QC 2EE6A 4I48A 3V4UH 4OM0H 2BVPA 1NEZB 2HT3C 2WBJA 4LQFH 2E8ZA 5EZOL 5C09E 2H9GA 2YOCA 4G8FA 4OCLC 4HMEA 3TEUA 3A6CL 3N9GL 3ISWA 3VI3F 1A6TB 5CCKH 5JW4Q 2YXMA 1BVKA 1GPOH 4U7MA 2PO6B 5DA0B 4E5XA 1U8MA 3RUGB 4OKVA 1QPPA 1CL7I 5TE4L 5JXEC 5TH2A 5ITBH 3MOBL 1U8PB 3QEUA 1OSPH 5KBNC 3BEVB 2E7LA 1HWHB 1AXSA 2FO1A 2FATL 5I8KL 1NMAH 3T04D 1L9MA 1WEJH 4WDIA 3VH8B 4B7IA 1A47A 1IT9H 3BOVA 1U8HA 1MJJB 3L95A 4ODVL 4G8IA 3VRLE 1F6LL 1U58B 5D7LA 4AJ0A 4RIRB 1HHIA 1NJ9B 1PW3A 5CGTA 4XAKD 4NKDB 2ADFH 5BRZD 2JIXB 1IFHL 3MNZA 5DK3A 3RA7L 3VFPB 2F53A 5DRXA 2NXYB 1LEGA 1AXTL 3QEHA 3BDXA 1I8IA 4GMSL 4PTUB 1DEEB 4P46C 4KVCH 4RFNC 4ZUTB 1HEZB 5GGSA 3TYGL 1RULL 3TN0D 1LEKB 3QIUD 3QQ4A 3OV6A 1AI1L 1G7IB 4Y5VB 2IH1B 3HG1E 4Y19B 5KVMC 3ZE2F 1MJ8L 3S37L 5IJKC 1TITA 2X1QA 2E7LC 3KLAA 4MD5B 1DBKL 3VXUE 2CD0A 3I9GL 1WBZB 1P9MA 2APBA 2CK0H 4XP6L 3SE3C 2V5YA 2XN9D 3CPLB 3MLXH 5E94B 3ZKXC 1SHMA 4TSAH 1SVCP 5DK0B 1QSEB 2W92A 4LQFL 4KV5E 3TO4B 1WWAX 1LP9F 5FO7A 2JLLA 3ARFD 3D0VB 2EDQA 1ZT7B 5DWUH 5A2IH 1FLRH 4R3SB 4AT6B 1MCPL 4B41A 1DQQB 5AWNL 4M7JH 4IDJL 1J12A 1E6JL 1GGCH 4IOFC 1QSEE 5E2WL 3NZHL 4BK5A 3EO1A 3QJFA 3W9DB 3QXTA 4YIQA 4MQXD 3X3FH 1YEGL 2AJUH 4LVHC 5GS0L 5EUOA 3K2MC 3TZVD 1WZ1L 3C5SB 1CFNA 2CDFB 3EJZC 1BOGB 5DQ9B 1DBJL 1NUFA 5K9OB 5DWUL 1BVZA 3RNKA 3T0VA 3VW3L 3HZKA 4EI5D 1H3WM 1ES0B 1QBAA 4LQ1A 1KJVA 4QXTA 4X5XA 2ENYA 2GUOB 4PJ5D 5DJ6B 5D7KD 5D7IE 2YUWA 1YY8A 3D48R 4YXLH 5J11B 1A4JB 1J88A 1A0QH 2PW2A 3LIZH 4TSAL 5DUPH 3WKMH 3GMMB 2FD6H 3IFOB 4PRPB 5D7SL 4KZEL 4P4KD 3ULVH 1CF8H 1QA9B 3VG0L 1AIFA 4UT6H 3X11B 1MFCL 2YMXH 4XHJC 5E2TH 1CD0A 4KDVA 3FL7A 3EAKA 2YK1L 5EZIL 1NGYB 2VDQL 4DN3L 1H9VA 5D5MA 5LXGH 3LKPA 4Q2ZB 2C1PB 3T0BA 4YDLC 5BW7C 2PETA 3EBAA 3LSOA 4YK4C 1LO3L 1J1PL 3CH8A 1MJ7H 2HRLA 3PV6A 1UJ3C 5KS9E 4OFPA 4QYOA 5E8DH 3PGDB 4F3FB 3HPLA 1ZOXA 2R1YA 3C87A 4JJHA 2CPCA 2GFBA 3EO0A 1DDHB 1YN6B 4O51A 5AWNH 2IQAB 3O0RH 3L3KA 4JHWH 2HAZA 1CXFA 1INQB 5HHNA 4CU7A 4TUOB 3LD8B 5I1AB 5I1LA 5F9WB 4RISH 1RUPH 3MNVA 3GSNB 3OJMB 4UQ2A 4CW1B 2GSIA 2V6HA 2YC1A 3RDTD 1V3JA 4DFIA 5JHLH 5LGKA 5IJVA 4K7PY 3R4DA 4X6CA 3QP3A 3OGCA 1P4BL 2NY7L 4S1SH 1FNSL 5D2LB 5F9JA 3MRFB 1QSFB 2Q7YA 4KVNH 3VXRB 2NLJA 3QEGL 3FFDB 2D31B 4RGMB 4K2UL 1UT9A 1HZHL 3JV6A 4Y8DC 3TYGH 1CK0H 2YUXA 3Q5OA 1EVUA 5HHOD 3H42H 5E8DL 3FT2A 4M8VA 3GGWB 2EDWA 4QGYA 3ULSA 3T2OA 3RWEA 1LVEA 2XA3A 3BPLC 2XOTA 4KWUA 2DQCH 1EK3A 5H94A 3SY0B 1CU4L 5I75B 3O6FD 5ANMB 4U6VL 4PJFA 3JWOH 3FO0H 3BDYL 3DI3B 1XT5A 1KSRA 3F7YA 5DJZB 4X9HA 1DP0A 4YC2B 4JM2B 1J0HA 5BJTA 4D9LH 4HQQH 4RIRA 3KLDA 4XPHL 4IHOB 3QWRD 2UZIH 3NFSH 1NPUA 3PV7A 1MNUH 2ZCKL 1UVQB 1TVDA 1FFPB 4OZFG 4P5TA 4PBXA 3S37H 4PJ5E 1MHPL 2W0KA 3BO8B 3O0RL 1JGLH 2NXZC 1CTNA 4XNYL 2I27N 3OJDB 3RL2A 2GHWB 3BYYA 5CAYB 1FZMA 2APFA 2CLZA 2MNUA 1F4WH 3QXVA 5HDBF 3QNZA 3HMXA 3BD5A 4DCQA 3H9YA 4LVHB 3WIIL 3GDBA 3P9MB 3MV8B 1FH5H 3WJLA 3QUZC 5DS8A 4O2CA 5D2NE 3SGJC 2FB4L 1U8HB 4KROD 2OTPA 1CS6A 3S9DB 1WBZA 3CJJA 32C2A 5ADOH 5GISL 3KPLB 3O8XD 2EDYA 4U6HB 3VRJB 4QHKJ 4OUOA 1KJ3H 3L9RA 3L3IA 5EUKB 3MLTB 1KCSH 5DVNA 5E2TL 5SWSA 5CBEB 5GGSB 1QNZL 3MRNB 5C0CB 3U7AA 4FFYH 5EZIH 1ADQH 2A9ML 3MQIA 4ZUUA 1AJ7H 2GJZA 2IBGA 1NBYB 1OLZA 2IH1A 1BAFH 1WBXB 4OTXL 3QXWA 1VFUA 2NY1B 3OXSA 1KTKE 4HLJA 4IRJB 2XRAH 4GLRI 2E7BA 3QUXB 3EOBA 3S7GA 4AY0A 1A0QL 1HQ4B 5KSAC 4U1SB 2K9UA 1EGJH 3S4SG 4U1MA 1HHJB 3BWUC 4JZOB 3NGBB 1S7QB 1A3RH 4HF5L 1I85C 3P4MA 3IF1A 4X8XA 1ZA6A 1U8NB 3H7BB 1DQJA 3F7RA 3GSQA 2GUOA 4IDLA 4JFXA 4WWKB 4ZUSB 3DI2B 1NUGA 5IBLC 3S35L 3OR7A 4R90L 4P46B 4PJCB 5C6PB 1FBIL 4ZFZA 3LD8C 4ZS7H 3RIAK 2HFGH 3EO1B 3SO5A 2ZPKH 3RX8A 4NNPH 3AS0A 4KUCF 1WFTA 2XQYK 3K74B 4PJGA 5F72S 4K8RH 1MVUA 2KQNA 3OKEA 4MZ3A 4KUCD 1C5CH 3E6HA 1RIVH 3UTPE 3DYPA 3ARGD 3G6DH 1UKTA 4JG0L 5CBAB 1QFUH 1EZVX 2I60L 3BIAX 3FRUA 3MBED 1T2QL 1YY8B 1T4KB 3QIWB 3LRSA 5K9KA 1KTRL 5FUZL 1PGRB 3WSQH 1UADC 4N8CL 3TH2T 2LVEA 4GAYB 1EO8H 1E27A 1S3KH 1MEXL 5HD8D 4NKIH 1EJOL 2F8VA 3MGOA 4P2YA 3SN6N 2EDNA 4RDQF 2OBGA 4JVWA 5JOFB 4EEEA 4K7PL 2P5WE 1QG3A 3C5ZC 3ARBC 1U95B 3QQ3A 3RNQB 3RGVB 5HHMB 2BRQA 3TBTA 1VACB 1NGQH 4JFDB 3IDMA 1MCOH 1G7MB 3EOYG 2NTFB 2FJFB 4FZEL 3MLRH 3Q6FA 3QUYD 4M03A 4XT1C 2AERT 3T0EE 3IVKB 3OPZH 1OTTD 1T0NA 3CU7A 4F7MB 2EDKA 4E42A 2XWJB 3H42L 4XPGL 3L3JA 4OLWL 4Z7VE 4AMKH 4PBVC 1I1CA 3FN0L 3FQXB 1T5XB 3QH3B 5L0QB 3MRQA 2Z8SA 2NY6C 5FO9B 5J11C 4N0YH 3S6CA 4U6VH 3BVNA 5K9QI 5ITBL 2QSCL 1H3XA 5D7IA 3RVTC 4O51B 4HWUA 3WYRA 4NO3A 3ZT5A 1WJ3A 2D0GA 1SJHB 2A77L 5DZLA 1W72L 4OCXL 3T4YA 5FF6B 1H3PL 1VKXB 4MD4A 3VI4F 5K59E 2MSPA 2HMID 4D3CL 4RGND 4OLXH 3GMLB 3QFJB 3BKCL 3U9UA 4TULL 4I5BA 5FB8A 3HZYA 2GI7A 5BV7B 1HDMB 3LN5B 5DHVH 4JKMA 3SHSA 3DXAD 3TIDA 1TZIA 4LSVH 5E56A 2A73B 4KJQC 2C3HA 3FQRB 4GW4A 4QTIL 1JPSH 4GMTH 4K94C 3F62A 4U7SA 2J6EA 3NAAL 5EO0B 4IRZH 3ZE0E 5B3JE 3HTLX 4S1QL 3CLEH 4NT6A 2LQRA 2BSSB 4NRXA 4JHWL 4I4WA 4WVRA 2XY1A 1N3NB 1X5LA 4N0YL 4MNQA 1OM3L 1NBZB 3TESA 3HAEG 2MCPL 3VXRE 4EIGB 4MDJB 2CLZB 5BXFB 2D7PA 2Y25A 1ZLWH 5F6HJ 3VDAA 1XR9A 2RR3A 2YZ8A 2HT2D 4ZFGH 5SV4A 3ARPA 5JQHC 3MR9A 1X5YA 5T3XE 3V52L 4ZXBA 3UYRL 4XBGA 3RL1B 1DUZA 4XPFL 1AO7B 5IT2H 5FHBL 3GJEB 2Q6WA 3NTCL 4H25A 5GHWL 3RWJA 1OW0A 4M7KH 1VGKB 2CDGA 4AEHL 1T1WB 4X5LA 4CVXB 1P1ZA 3M1BB 3F12A 5TQ0H 1URLA 4UT6L 3AU1A 1S8DB 3BIKA 1CGWA 4JFFE 1X5IA 3FONA 3BPLB 3E8UL 3L5WA 1TQCC 2MJWA 2LTQC 2F19H 2ZSWB 3RTQA 4JG0H 1FNLA 1TFHA 1N6QL 3VJ6B 1MREH 2E7HA 4LLVB 5C0EA 3HZMA 4DKAA 3N0PB 1A2YA 1XF3B 4UT7L 4UNVA 4JM2C 4DQOH 3P2TA 1HI6B 2QSQA 2WK2A 5D96C 5IIEA 5CWSA 5T1MB 3ZYIA 1LD9B 3UO1L 3VFWA 3PGCB 3ULVD 4KKBD 3HMXH 4NKIL 3PG2A 4GMTL 4X4MA 2HRPL 5DGRA 2RAMA 4YHIB 3I6KB 3UYOD 3DVIA 1KCVH 5I19L 2R9HC 2Q86A 2EDTA 5HVFB 3RGVC 2JJVA 3NBNA 5IQ7L 3M8OL 4AM0B 5F88B 5LKNA 1ZGLM 1G9EA 4MQSB 3ZE1E 3V6FA 2J8UF 3BRGC 4Z7VB 4KRPC 3SE4A 3QUZB 3IRZA 1RIUH 4ZMAT 4OI9A 1CGTA 2FX7H 4L3EA 3I85A 3ARTA 3ARUA 2FO4B 4Z7OF 2CO6B 2V5RA 5JR1L 3NFNB 4UU9A 4Y0GA 4EUPH 3D9AL 5F7YC 4NZUH 3PWVB 1G9MC 2EC8A 5D7LB 2QHLA 3MOQA 1XF2A 1HH6B 2X1XR 2NY6B 4WWKA 4ZUSA 2OMBA 3BWAA 3WFHB 3WFCH 2NW3B 3DRTA 5T3XL 3PXHA 1JNHA 5EOQL 3VXNB 5JHDA 3PHOB 1I1AA 5BO1L 4DN4H 5D7JA 5I1CH 4C4KT 5L9DL 2GITA 2B8OT 4XNUL 1QD0A 5C0RH 3RDTA 4NKOA 1P84K 5GS3A 3T3PF 2F58H 4TN9A 1EHLH 1OPGL 3DVNB 4NO5A 4O4YL 4ZNEA 5IFJA 4POZD 1AKJD 4F80A 5FYJE 2N7BA 1KENH 3O45A 4X4ME 3UBXA 4HUVA 4TQEH 5I15L 2DQTH 5I1EL 2J8UA 3F5WB 4LCYA 1DEDA 1NAMA 4HH9B 4I0PC 4KDWA 5JW3H 3KS0J 3L3OA 1MHCA 2ORBH 4PGEA 1KNOB 4MZ2A 1RUQH 2EEAA 4APQC 1TETH 3JVGA 5DJDB 3R1GH 4YHOL 5FO7B 1X5JA 4JDZB 4KK8D 1QACA 3HC4H 5KSUB 1SJHA 4YDIH 3DETC 1DQQA 4HJ0D 4RQQA 4ZOEA 3IJHB 1QOKA 3M07A 2DI9A 3GUTB 1MSPA 3D69B 4J3OC 4DGYH 4LNRB 4MD4B 1G0XA 1A6UH 1FORL 4HKJA 4HQQL 3HE7B 4FHBD 4XPHH 4NHCH 3NIGE 3D6GA 1WBYA 2NY4B 3EOAA 3WIHL 4X6EB 4JE4B 4XP9H 4LSSH 2ZG1A 2VDPL 1CK0L 3IXAB 3J8F7 1IGYA 1YNTA 3MROA 4KV5F 4XBPB 1A21A 2DI8A 2HJFB 2OI9C 3TA3B 3KLHC 3OG6B 3T65A 2E7CA 2R0KH 3QIWC 1WCBA 3QDME 1OGAB 3P0YL 5D7IB 4KQ4L 5I6XB 1RZIA 1CICA 1BZ9A 4UV4L 4C83B 1PLGH 4DFHA 3B9KA 5D1XC 3HAEH 3HC0B 1KT2A 1EFXB 3N1FC 3VFGL 1YDPA 2Q3ZA 5EBWA 3OGOE 3IAPA 4XPAH 1IKNA 2RFXA 1Q9OB 1D9KA 1YJDL 4PJAE 3T3PE 1JHTA 4H8WL 5IQ9A 4DUWA 1RZ7H 3F7PC 2DN7A 4YZFF 1FRGH 3VFRA 4RBPK 1P7HL 1G6VK 1N5YL 2XN9A 4NO2B 4JRXB 1VADA 5JDSA 4L3AA 4FFYL 5GRUL 3HMXL 1U8QA 3IFLL 3ALPA 2VXUL 1ORSA 4MA3A 3QIBB 5ESAA 1OCWL 1DVFB 3LKNB 4M8QB 1RVFH 2GSGB 3H9HB 1KGCD 3WLBB 4L4TA 2BNQD 2IBZY 3HS0A 2BJMH 2QLVB 4AEFA 4JKLA 1NC4A 1KPRB 1AQDA 1JWSA 4CGTA 3DMMA 4Y4FA 5C2BH 3GBNL 2WV3A 3RZCC 4B50A 4HFWB 3D9AH 5D7LE 2OTWA 5DC0A 2X4UA 3QO1B 1X4ZA 1YPZE 1I7ZA 4MJ5B 4FS0A 3WFBH 5C3TA 1T66C 1U8IB 3O3BA 3FO2B 4JG1H 3BP5A 1T04A 5FUCC 2P8LA 5GGSY 5DI8A 2NPLX 4ENED 3VFWB 1NCAL 7FABH 1BLNA 4ONHB 1IGCH 4RWYL 3NFSL 1S78D 4NQVA 1G7PA 5C0AD 1I7UA 1IE5A 1XF1A 4FABL 3OKDA 2DL9A 3U82B 4ZDHA 5LXGL 1TVHA 2P7TA 3MYJB 4CDHA 1PSKL 2AW2A 5FOBA 1EPFA 5F7NC 5KVEH 2QQNL 3C9NB 4ZQKB 5T3XH 4KK6D 3TJHD 3EJYD 4HUWB 1MLCB 1CE1L 2EDJA 2DKSA 1MFCH 1XGQA 3V5DA 4WNQA 3U0WH 1I8MB 4ISVA 1U3YA 4X4XA 3BPNB 1XCQA 1RMFL 3WNLA 1RZKL 1HN1A 4G8EB 5T1LA 2P8MA 1N0XL 4W4OC 4HPOL 3AREB 2OL3L 4KI5E 4A6YL 5GHWH 1CVRA 1RIHL 1QFWH 2EECA 1KBGH 2VZ3A 4TUKL 3RZWA 1OVZA 4G6FB 4QHUB 4LSPL 1G1CA 1A1OB 2FHCA 5F6IB 1S3KL 4PRHE 3C08L 3Q48A 5D7SH 3BSZL 1FGVH 4N8CH 1OT1A 3FQTA 4TVPD 4L4TE 2Y5EA 3V6ZB 4KXZH 1QQDA 4KI5C 3U4EA 3KPRA 5I18H 3UTSD 3WO4C 2C4FU 1N59B 2OI9B 1YMMD 2YKLL 2J7LA 2OXGA 3BGFC 3ZDYF 1WWWX 2R0KL 4EUPG 5BS0D 4PRIB 4HHAA 4O02L 1JGUH 5FA4A 4IRSD 1CFQA 4U6HA 5FGCE 4LCCC 2XWTB 3UO1H 4M1CD 1FL5B 1P4LA 2X89A 4M3KB 5IMKA 2VLJE 1MRFL 4LSSL 1DQLH 1QVOA 4UAOB 4PJAA 5DUMH 1NFDB 4H5SB 2EIZB 5C86A 2JB5L 2W0FB 3LKQB 4URTB 3VGBA 4R2GD 4OAWA 1U0QA 1I1YB 1WAAF 2Q20A 3IXTB 4M5ZL 4XCEA 5GS0C 1IRAY 3GM0A 2CLVB 1INDL 4Z7UA 4JY5H 2AJVH 3EOBB 1IM9A 3IKCB 1NFDE 1QNZH 4Y5YC 1EHAA 2D03H 3QAZB 5IGXH 1R5VB 1BGXH 2BSTB 2XY2A 3RTQC 2XIDA 3U83A 1JF1B 3OAZH 2X4PB 1DQTA 3JV5A 4G6ML 3OXRB 2HKHH 1ZLSH 2P49B 2WUCL 3CC5B 1A64A 1CICB 4LEOB 5F1NB 3P4OA 4MCZA 2BJML 3DV4A 1U8LB 4NM4L 4KI5F 1JHLH 1U41A 2EDDA 1BD2A 2AXGA 2BVYA 4EVNA 5J13B 1F4HA 2NCMA 5J1SC 4OSUH 3M45A 3S4SB 1JVKA 3NAAH 1RJLA 4O9HL 3G5XB 3MOBH 3NVQA 1EAPA 4I18C 1RUAL 5INDB 3BH8A 3HN3A 3T2NH 3LMJL 1KPUB 1QR1A 1MWAL 3KHQA 1KULA 4PJ8C 4X8JA 3K7UA 2OQJB 2FX9H 4HWBA 2DBJA 4A2MA 3T2PA 3CGTA 3UJTL 1XGRB 3VFTB 3EYOA 1IQDB 3MACH 1B0WA 4R26L 2IGFL 1ZHNB 1CLOL 3QI9A 4PRHB 4ETYA 3RFZC 3CVHB 2GTZB 2RB8A 1MUJA 3BUYB 3TCXA 3C6LA 3MLUL 1FZOA 4PP1D 5IV2B 5IM7B 4Y4KB 2I5YH 1A6ZA 3PWLA 4KUZH 1IAMA 5B38G 4D0BA 3K2UL 1C08A 3IDMB 3DUSA 2UV3A 4F7PB 2VLMD 5D5MF 4N5EC 4NNXB 3OMZA 3QJHB 1OP9A 2BY0A 5HY9A 5GS1B 2Y36H 2ZOLA 3BP5B 3K46A 3FQXA 4XMKL 4KVNL 3MRIB 4E41B 4QRSB 5H37H 25C8H 3UJJL 3H9HA 2BCKA 3DVFA 4I77L 2CXKA 2YA2A 4L4TB 3P77A 1JZ8A 4LCWB 3Q3GA 3QR2A 2DM7A 2HT3D 3FB8B 4WW2F 5F6IC 1J1PH 4Y4FB 1A3RL 3AGVA 4U3XA 1X5KA 3MLWH 1J18A 1T1ZA 4W6YB 2ICWB 1T0MB 5IR1A 3N50A 4QCIA 5CGYC 4Y8AA 5E08L 1N8ZA 3QXDB 3T0DA 4RX4D 3I84A 4LSDA 5GRZA 1IM3B 5LWYL 1ND0B 5DRZA 2P8LB 2VB5A 4I48B 4JY4A 5HHOA 2Q1EA 1B0RB 3BEVA 4ISVB 3SE3A 4NZRL 3ZTJH 5FHAL 4ONHA 1CN4A 3C60C 4PRAB 1IKNC 2X5PA 3RY6A 5CINH 1R3LA 4QRUB 3WCYA 5E00A 7CGTA 2Y72A 4M43L 4TUJB 4PJHE 2DQGH 3K8LA 2AJXH 3IS1X 3CPLA 5E7FA 5CKAA 2WSKA 3BRDA 1LO0L 1OWRM 4Z77A 1ZHLA 1PEZA 5IW1B 1KYOK 4J3SA 3FAXA 1NBQA 2R0LH 3DO7A 5IBUG 4HIEB 1BQHB 5GZOD 3QIUC 5CSGA 4PJHB 1T2JA 1EBAA 1NFKA 3BISA 2V2TA 4Z7WE 4HK0B 4PYHA 4FZ8L 1T5WA 2HFTA 4EUPB 2D4FA 2ATKA 3GSRB 3L3GB 4M7KL 3RWGB 2DQTL 2VXQL 3X12A 5D93B 4K07A 3NCJH 4CVXA 1QHOA 4OGAC 4UOW1 1A4KA 1CLZL 5HGGS 3QDMD 2LU7A 1ZVSA 3MA7B 5A40E 2FEDC 2XZCL 4P2OC 2NZ9C 3ARFC 2H1PH 3EGSB 1OSZB 2PNDA 4ZFOA 4CNIA 3VXUA 3ECBA 1EO5A 4U4BA 1D5XA 3P30L 1WIUA 1WC7B 4Y89A 2VXUH 3MRCB 5E6ID 2HVKA 4G7VH 3ZHKA 2V7NB 4V2CB 5C7XL 5EBLA 3B5GA 3WHE1 2F8XC 1HKLH 2WWMC 3HFMH 4R26H 4OJFH 2F53E 4G9DB 3X17A 1FVCA 4EI5C 4QLRA 4G5ZL 3HG1A 1QSFE 3O6KL 1PG7X 4UIMB 4GG6A 1LHZA 4M7LT 1RIHH 3PHSA 3S96B 3BT2H 3E1F1 4J1UB 5BZWA 5TFSL 4NQED 3LQMA 2VXVL 1XF5A 3DV6A 4NRYB 1B6UA 1ETZB 3VGAC 1ZA3A 4X6DE 1FNEB 3DTXB 3FB5B 5F7MC 3WO4B 4QXGL 1YNKH 2Z35B 5CEYA 1FO0H 3BGFB 4DTGL 1P5VA 5GS1C 3KYKH 1FIGH 2P48B 4LCWE 4UQ3A 5EZLB 5JXEA 2EDXA 1I4FA 1WWCA 2G9HB 4TSBH 1PEWA 3HPJA 3SKOA 5HSFA 1MY5A 3UMTA 4X6CF 25C8L 1EA9C 3UJJH 1B3JA 1YJDC 3QHFH 1ZV5A 2EDOA 4DZBB 1JNLH 3CFCL 1Q8MA 2HVJB 5MERB 1F6AA 1SJXA 3IFOA 3ZE1F 5DUBB 4GRWH 1DN2A 3REVA 3QULA 4FABH 3D3VB 1BF8A 4CADA 4FQ1L 3TGXA 3WXWL 1AGFB 1CD1B 2EXYC 3ALWA 3BZFA 2OJEA 4PJ5B 1CZ8H 2H2SC 2DQJH 5IHZA 2D31A 4G8GD 3X13A 3BFOA 4WTZG 4M6MH 1S7UA 3QCTL 5IHUH 2V7HA 1JPTH 3MLUH 1U93A 3ARRA 4OGZA 3NCCB 1RK0B 5LBSL 3GIZL 4GLRH 3C6SA 4JFFD 5IGXL 4PY7B 5BZDB 5CJQL 5GS2D 1I85A 2K7QA 2HFFB 2GFBB 4Y1AB 1PZ5B 5I19H 2W91A 2WM0A 4MXQC 4G42B 4XVSL 4PJGE 5IQ7H 2JCCE 1RD6A 4XNXH 1DLHA 1VFMA 5CLTA 4LCCA 3G5VB 5I1AA 2Q7YB 3VXRA 2Z4QB 2BRRL 1T3FA 4KKLC 3WFZA 2RCSL 2OM5A 3ZYJA 1FLTX 5BMFL 5ACZB 4QCIB 2JK5A 1HXYB 4P5MB 5D9SB 1RK1B 5B39G 3F58L 3KAAA 3MJ7B 1JYNA 1T22A 4U6YB 3O6FC 4Y2DA 3ARDD 3VE0A 4XMLH 5F9JB 5TDNA 1B0RA 1KTDB 3WE6B 1NBVL 2IADA 5E95B 5IB1A 3O6MH 3OAYK 1BECA 4TRPH 4U1LA 3MBXL 1RZIB 3PL6B 5J7CC 3MV7A 1TCRA 4Y5YA 2BVUA 3VGDA 4HV8A 4OCYH 4IHOA 4XC3L 3NIGF 3CMOH 4EQ2A 2EE3A 3D85B 2AJYH 2E7MA 3I9GH 1CD9B 1GZPB 5E2UH 1S9KC 5I15H 1OGAD 2OL3A 1ERNA 5BS0A 4NWTH 3KYMA 4TRPL 3C5ZD 3VG0H 5C0CA 1R3IH 4PJHA 4GW5A 5F9OH 1FYTD 2NZIA 3U36B 2HWZH 4NC1C 2RQ8A 1EV2E 5DR5L 4XC3H 5LGJA 1RHFA 1F58H 3L7FA 3QPQC 3V6OA 1ORSB 4MA3B 5ISZE 5I73B 5B22A 4P5TB 3NCFB 4PIRF 4ZOBA 1GHFL 1TJGH 5EU4A 1CGXA 4LVNC 2BFVH 1QLRB 4GQPH 1S7XA 5I1HH 4XXDA 1N5YH 3MFGB 4RAVB 1KPRA 4WUUA 3I75A 3GK8H 3H7BA 1WZMA 1IAIH 1DBBH 1BJ8A 4K7PH 1GL4B 3VGAB 3UC0H 1V7ML 2OJZL 3DO7B 4B7LA 1QR4A 1R3HA 4HUKB 5I74C 4NUGH 1V7NL 1M7IA 3GMQB 3O2DH 2KBGA 4KAQL 2Z92B 4JG1L 1UEYA 1MHPH 5IVOA 4NBYB 1P7QB 3LEYH 3MUZ1 2ZSVB 5CUSL 4ZAKB 5DJCB 5SWQA 4UILL 1LWRA 3DHJA 1L4IA 3VGGA 5IMOB 2BVEA 4U31A 3HA0A 1JGVH 3PNWB 4PJGB 1KOAA 4PJFE 1BM3H 4RDQG 4ZFGL 2QTEA 3O3UN 2HRPH 3LQZA 4JZOA 5SWZB 5LGHH 2JKXA 4JHZA 1NBYA 1T83C 3BMVA 2YSSA 1I7UB 1QUNA 5E6IA 3OKDB 3S36L 4M5YH 5CEZL 3MRRA 2E27L 4OCRH 1FFOB 3TH3T 2HYMA 4K55A 5KVEL 1I1FA 2OR7A 1XGTA 3DV6B 5T1KD 1SY6H 3MYJA 1W0YT 2IF7A 1SY6A 1JNLL 1LO4H 2NMSA 1I1RA 4OF5A 3WJJA 4HUWA 5HI3C 4PR5A 5IB4A 1IGTB 3MRJB 2VXSL 4GO6B 2HP4A 4LCIH 2Q8BH 1I4FB 2G9HA 5C0AB 4CMHC 3X3GL 1YY9D 4QGTA 3JUYA 1RY7B 2W9DH 2KL6A 2NY1D 1YJDH 4Y2DC 3IAQA 3Q6FB 4RZCB 3LRHA 4EN3D 4KK9C 1KBGL 3AB0C 4HCRH 2AEQH 1MEXH 4JO1H 4JRXE 3TO4C 4IJ3B 3L7EB 4WFGE 1EGJL 1SJVA 4Z0XA 2YXFA 3MRDA 3BXNA 2YMXL 3K4ZA 3OF6A 3SO3B 3CVIL 3O2DA 4H0IA 3V4PL 3V6ZA 5IBTL 5LVEA 3WXWH 2NNAB 2J1KA 2I60H 3IB4A 3ARBD 1ZVHA 3KPTA 5BOPA 3SJVA 1C1EH 2A6IA 5T3ZD 4NNYA 4JO1L 3SKOB 5FF6A 3GKWH 2VLRE 4HXBH 2GT9A 4TNVF 3CMGA 3EYQD 5I1IL 3MCLH 3VA2C 1OAQH 1TZHA 5DO2C 3FN9A 4YDIL 3V0VB 4PJIF 1YMMA 3MRPB 5I18L 4P3CL 1OQXA 1E4XL 4HEPG 2DQDL 1CXIA 5AD0B 1NGQL 5KJRL 1UACL 3RGVA 3TBTB 3JV4B 3SDXE 3CX5K 4MB5A 3KPMA 4BQCA 3GKWL 3TVMB 3IXTA 1BBJA 1FYHB 1N2RB 2VUOA 4QT5B 1GGTA 3UTSE 4LAQL 4YDJA 1UENA 4E42B 1FO0L 4OM1H 4D8PB 4P9HC 5DT1H 5L2KA 1LNUA 5DJAA 5E2VL 1CDBA 3JZ7A 1QSVA 4NDMA 1AXSB 4OI7A 4DKDC 1A02N 2CMRH 3GJFK 3N1MC 1F4AA 1G6RA 2R2BA 5IMMA 5E9DD 5HDBE 3VH8A 4HBQA 5SX5K 2H2PD 4PJXA 4YGVA 4JGMA 4MJID 2IBBA 1IKFH 3P0VH 4JHAH 2CIIB 3P40A 1U8LA 2HG5B 1AHWA 2VDLH 5SWSE 2AXFA 4QKXB 2X4NB 3EFDH 4NKMA 4QXWA 2VLLA 4M4PA 3UTTE 5B38B 2O61B 4YE4H 4F7TA 4N0UB 2AV7A 4HUUB 3WEXB 4EDXB 1FRGL 3T77A 1G0DA 3G5XA 5FYJH 5IHLB 2DLTA 3U46B 3B5HA 5TPWH 2C3XA 1QHPA 2H6PA 2F74A 4WW2C 3TNNB 1QFHA 3EHBD 5F1KC 3TT1H 5KZCD 4D9QD 2FX7L 5BVPL 4OZHA 2BSRB 1DN0A 3QXAA 1C8PA 1O7SA 4GBXC 5MI0B 4OD2B 4CDGC 1KCLA 2AVGA 1F13A 1FNSH 2O5XH 1N3NA 3KXFE 3QIUA 3BIBX 4RGMC 4KRNA 5DFVC 4RAVA 3PABB 1IILE 3VFPA 1U2CA 43C9B 5T1MA 3CFDB 2M26A 2QSVA 1AGDB 1T1WA 5DURD 1QRNA 1GXEA 1P4IL 3VWKA 5T5FH 4U05A 3QDGD 3PHQB 4HEME 4JFEB 4RSVA 1GZQA 4S1QH 5F96L 1QLFA 4J3UA 3K3QA 2IAND 3G6JB 3SOBL 5DJCA 3VJ6A 4DK6A 4LLVA 3GO1H 1BVLB 1R5IB 4I77H 4Y4KD 5IFHH 3ARSA 1FL6B 4ODBD 5T33H 1K6QL 1Y0LB 6CGTA 5I66B 1OAZL 5F3HA 3VMNA 4NQEA 1CQYA 2JCCF 3PWVA 4LDOB 1MRDH 3TO4A 4Q9CA 3G5ZB 2P47B 2DKUA 4NO0A 3S34H 1TETL 5E0QA 5D4QA 5D70L 3ESUF 1YPZA 5IVZA 1RZJL 2IFFL 3BD4A 2HKFL 1N8ZB 1K2DB 3X14A 2PXYB 4FP8H 4FMKA 4BZYA 1T2QH 3C60A 4RGNC 3BZEA 1VEMA 3V5KB 3W9EA 5ID1A 3QJFB 3ROOB 1T1XA 5JO5A 4Y1AE 1DFBH 3G9AB 1A9EA 5C0AA 2PF6A 5FGSA 1RSFA 5DQ9A 3MACL 1AI1H 2VITB 4PRAA 1RUMH 5EOCJ 4XTRC 1MHHA 4DOHB 4I2XE 4NQDD 5JA8B 2CO7B 3ZZ1A 1PYWB 3C6LD 1K3IA 4YHPB 3Q6GH 5F7KC 3DBXB 2Y23A 3OPZL 4I18A 4MA8L 3K1KC 5D2LF 1H3UA 2E6PA 1DDHA 1GGIH 4HDIA 4HXAH 4X6BB 3FOLB 2ARJQ 2X4RB 4Z76A 3PWNB 2QQQA 1K4CB 1JWMB 2DDQL 2KZ1B 3F6LA 2DLEA 2O5YH 3SJVB 2EEDA 3ULUE 1DQMH 2QQLH 4LKXA 4YHLL 3KPNB 1NMAL 3BGMB 4HK0A 3VXOA 3VXQA 6FABH 3U0TA 5IFJB 1FO0B 2PW1B 4KUZL 4UOJA 5GRJL 3LKSB 5C3LD 3UBXB 4HUVB 4XCCH 3W0WE 5F44A 3FQUB 4M6ML 4F7CB 5DF0A 3P0GB 3HI6H 4Z95H 2DRUA 2OSLA 1FZKA 1WIPA 2X7LB 4OM1L 4X9FA 4RBPH 3L3DA 5C0ND 4MS8D 2LE9A 5EWIH 4LPWA 1MCWM 4R0LA 5KANI 5CEXB 4RQQB 2VDML 1F00I 1ITCA 4WO4D 1FPTL 3F5WA 4PFEA 4MQTB 2HFGL 1JPST 3D69A 5ENWB 4LGRB 4GG6E 4HS3B 2DOCA 2YC1B 2E8YA 4E9LA 3MLPA 5J0BA 3PDOA 2J12B 3SDYH 4JRYB 1WCQA 4JO4L 3ULVC 2CJUH 4GKNA 4JDTH 3V7AE 2IWGA 2D4DA 1LO5B 1AXIB 3G04A 1OGAA 2YWZA 3WSQL 5I1EH 4WI7A 4NOBA 4UAOC 3TN0A 3S36X 2VLLB 1UB6B 3MRKA 1X3DA 4K94L 4HIJA 1DBAH 3FB6A 3RHWK 3IXAA 3QQ9C 1OP5K 4S11A 4MJIA 4LRIC 4J4PC 1KTLA 4P5KB 5EIIB 2MQ0A 4LDLB 3HI5L 4OZGB 3GNML 3SGKA 1J5OH 4DZ8B 3VXPB 2I07B 3O41B 5GSRA 6FABL 1IC7H 4ETQA 5KOVC 1WAAE 3QAZC 3ELAT 3B9KB 1OCWH 3QDMA 4ODXA 4LOUC 4JREB 1K8DB 4Z7WA 2OX5A 5DJYB 2ENSA 3DGGA 4WTWA 2CR6A 2VISA 5FDWB 3ZT6A 3KS0H 3MZGB 5BW7A 1PKQE 5FYKD 4PD4K 5IVNA 2RCSH 4FFWD 4KU1A 5C0JB 1MRCL 3U2SB 5DGQA 3RAJH 5C0AE 4I13B 3QDAA 3I3DA 3ULVF 1EEQA 2OLDA 3S8WA 1IQWH 5MENB 3HB3C 4RMUA 1A9BB 2WQRA 1PZ5A 1D5IL 2E5EA 2IPKB 3OAUL 2BSED 3TCLB 3C9NA 4ZQKA 1KXVC 4U1KA 1JFQH 5DUPL 4MDIA 5HYJB 3O3BB 1UWXK 2AK1L 2RBLA 4B5EA 5FGCB 5C2BL 5EU5A 4X83A 3T0EA 3REWA 3DMMB 3U9PL 5D1XA 4WHYG 1CDUA 1DQML 1MRDL 3IU3A 5HI4C 4G6JH 4OJFL 4IOIA 2JB5H 3CDCA 5A16A 3H3KA 3SDDB 1FAIL 3MJ7A 4P49A 4M61B 5FYJU 3O2WL 5J1AB 3BQUC 4M62H 4OIAA 3B6SB 3LH2H 5TDNB 3K4DA 4GKSB 4Q0XL 1AC0A 4YGAB 4KK6C 1SY6L 2YBRB 4W68A 1NH6A 3FRPA 2NX5D 1NCNA 3P4NA 4NUJB 4ODSH 1ZA6B 2B20A 1ZANL 5TGBB 4IMLA 3FRUB 4S2SA 1LE9A 2VNCA 4XAWH 4PRIA 1YPZB 4JRWA 1KIRA 1Q9KB 4UTAL 5FGBC 2O5XL 4M48L 4XBEL 2DJUA 2P8MB 4TQEL 3BN3B 1PY9A 4K7FB 3BSZH 1M4KA 5KSBE 4HDIB 4FFZH 3GSUA 4Y4FC 3SDCB 4MWFA 1DEEA 1IC5H 2HH0H 1T1YB 4MAYB 3U6RB 3BI9X 5TH2B 4LU5H 4PP1C 1E0OB 2VZSA 2HN7A 4UTBH 2D2OA 2A74A 1VERA 4LKCB 3MLWL 3V8OA 1FN4A 3CSGA 4XWOC 3DO3A 4J4PA 3QCVL 5HJ3A 4PLKC 5EOQH 2ITCB 5IHUL 3WIHA 4QTIH 3SOBH 5DEFB 4RFOL 1T4KA 3QIWA 5JUEH 5K9KB 3VWJC 3RI5F 4AG4L 5HBBA 3W81A 4OGYH 4UTBL 3QWRA 4P99A 2G5BB 1ZVYA 2VZ1A 5IMLA 2ARJB 5JOFA 3AXLA 4F7EB 1HEZA 5J4MA 4UBDD 3KPSE 5GZND 1VB9A 3GMQA 2ZZUT 4W81A 5E7BA 4PGDB 1RUKH 1KF9B 3O11A 4HS3A 5CGYD 3UP1A 2NTFA 4ZTOH 2ZCHL 3H0TA 2CLVA 4Q58C 5HGBA 3KWWA 1JF5A 4YHOH 3KXFA 1Z6JT 1N4XL 5FOJA 4UIKL 4PUBH 5K9OA 5INDA 2XV6B 1CLCA 4LHUA 1JI2A 4XI5C 4YUEL 1RFDL 1TZIB 1X7QA 4ZFFA 5AYQA 2X9YA 5JOPE 4XP5H 1GC1C 5IEHA 1FORH 2DIAA 4J3XA 4HXAL 1HILB 1BOYA 2BSSA 2BX5A 5SWSD 1JV5A 5CLWA 3K0WA 5BV7C 2Y5TA 3QI9B 2YN5A 4WGVB 5SWZD 4GKZB 3LPGA 3F58H 2XTLA 3MCKA 4P46D 5C0IB 1BF2A 1U8KB 4CUCA 2DL2A 2LU4A 1OSPL 1JGLL 2AJVL 1TMCB 4HAGA 4XBGB 1WT5A 3HI6L 4OQTA 4V1DE 4JFHD 4MNHA 1E4KA 2FGWL 5C0BA 1NFIA 2XT1B 1B4JL 4E41A 1X5AA 5DD1L 3FB6B 4I9WD 3V4VL 4GAJL 5GGQH 4WTXA 1YN6A 3MYZA 1I9JH 4FFVD 1KTLB 4P5KA 3AAZB 5JPMB 1XCTB 1JK8B 4YX2H 1KYOJ 3HI1A 5B4MD 2NZ9D 4HCRL 4PJFF 3BUYA 5JNYA 5LBSH 3O41A 4GS7C 1CL7H 4F9LC 4C56D 4NSKA 5JZ7C 4ORGB 1OAQL 1MWAB 3O2VH 3P11H 1OLLA 4PJBA 1E28A 5EBMB 4F7PA 1ADQL 2A9MH 3LDBC 4HC1L 4HAFA 1K8DA 4P3CH 1YMME 3ZMRA 3LN4B 5I6XC 4F37F 5D2LA 4H25B 3RWJB 3CX2A 2R1YB 4NQUA 1C1EL 2X2YA 3S98A 2HT4C 2DJ4A 2QQNH 5D1XB 4OFIA 1JWUA 3KPMB 5J6HB 2DIBA 3KYAA 3NABL 1HIMH 2IQAA 1JGVL 2J88H 4NCC1 4YHIA 3STLB 4RAHA 4MAYC 3OKNB 4MNGE 5E00B 2H1PL 2YK1H 5HYSA 3MFFA 3HZVB 5LGHL 2BZDA 3GSWB 4CKVX 4A6YA 1T1ZB 4WJ5A 3CFJA 1PVHA 4HKXA 4LSTL 2HKFH 3LB6D 4KAQH 5TE7H 4X7DC 2B1HL 1QYGL 3VD4A 2GYSA 4KY1H 4P4KC 5GJSL 3ZKMC 1AD0B 1HWGB 4WEMB 1ZLVK 3DRQB 1JPFB 1JPTL 3OB0K 4NN7C 1Z9LA 3VWJB 4NQTA 4WI8A 3O3EA 3WIFA 1DBJH 4OF0A 1GGBL 4M93B 1AGBA 2H32B 3QPXH 3A67H 4FTVA 2YPVH 2YD6A 3FMGL 5EC1A 1UKQA 3B2VL 3W5NA 3GSUB 4LLYA 3MLRL 2BK8A 4G3YL 3V0WL 5FV1L 5CGMA 4FQLL 2CLRB 1A4KB 2EICA 5EU3A 2VLKE 3JWDL 1KCRH 5TQ0L 2P42B 5DRWA 1CR9L 3UTTA 3TBYB 3AROA 1KEMH 4L3EB 2VLME 5EULV 3RWHA 5DS8B 5HI5D 5EU6B 3DARA 3H9SA 1A5FH 1W72B 5HVHB 4XCYA 3KJ4B 1QO3A 3QG7L 4PJ7B 5D1ZB 4ZODA 3EYSH 4QRPB 3W0WD 1KIRB 2J6EL 4G6AD 5C92A 4J23A 4LHUG 3VRJA 4PTTA 1Q9WB 3DSFH 3G5YB 3C08H 4NJAL 5JTWA 5MEOB 2HVKB 3PWPD 3OHXB 1F97A 5GRJH 1MFEH 4KHTH 5DDHA 4MAYA 2GJ6B 4LVOB 5CILH 5KVGH 1ZVSB 4WU5B 2FEDD 2JE8A 4OZGE 4PLNC 4I0PB 4N68A 2VIRA 3BQUB 2MKLC 3QNZB 3HG1B 4HMDA 4DCQB 2A38A 3OR6B 3EGSA 4JM2F 1A7RH 4G3YH 2R39A 3P9WB 2WUBL 3NZHH 3IDXH 3LMJH 4WI4A 2DQHL 4KKCD 5HGBB 5F89A 4I0CC 5AUMA 3L5HA 4N0RA 4WFHD 1CGSH 1Y0LA 2G2RA 1HHJA 1KXQE 2Y36L 4KHXL 4PJ9C 4OCWH 5C07D 4OSUL 5EBLB 3MMEB 3G5ZA 4QWWD 1T03L 4NO0B 5HDLA 1F58L 4L8BA 5HXMA 2PCPA 1IAOB 1D5MB 1KJ2B 4FP8L 3SEPA 3WXVL 4M48H 2I5YL 3BX7C 2NW2B 3CSYA 1I9EA 4KQ4H 3TO4D 2WQ8A 3JSSA 4HKJB 4Q9QL 2RHEA 1FZJB 1J1XL 1GPOL 3BPOC 4XHQA 1EAJA 4LLWB 3RIAF 5FV2A 5CHNB 3LY6A 4PJ5A 4QXUL 3UTQA 3BN9C 4HMCA 3LDBB 4G6KH 4CJ0A 4NHUB 1NBVH 3HMWL 4K71C 4DEPB 4JRXA 2CQVA 4YDVB 1BIHA 2R0ZL 4YHZL 3MBXH 1Z0MA 5BZDA 3O9WB 4YHPA 4MX7B 4RMWA 5I9QB 2AXHA 4LRNL 1QRND 2X44D 4JPWH 4OCWL 5E8OA 2VDLL 1OB1B 3HC4L 2I9TB 2DQGL 4JFQB 3PIQB 5JA9A 1G7HA 4HS6A 1MI5A 1NC4B 4YJZL 3QQ3B 1IC4H 5GZOC 1J05A 1RURL 4NQDB 4OZGF 3QHFL 2ESVE 3KDMB 4U49A 5IB5A 1I9JL 4N0FB 3CFIC 2FYYB 4P4KB 1HHHB 2VERN 3E6HB 1XAUA 3WKML 1LP9A 4KQ3L 2ZCHH 4JFEE 1T0NB 5I8OL 5FXCH 2NR6C 4R8WL 5BVPH 1LEIA 4BZ2H 5HHPA 1NL0L 3QRGL 4Y88A 5I17B 4F58H 1PKQA 4Y2DB 5E08H 5FYKL 3MJGX 1CD1A 3RZCB 2DWEB 1AKJB 2QQLL 2OL3H 2XN9E 3AB0B 4P2OD 4L3EE 1S7TA 4NBZB 3GIZH 3MCG1 5FCUH 3BKMH 2AJ3A 1WISA 4P23D 4KQ3H 1JNJA 4FQ1H 4LLQB 4JFOB 2APWA 1A3LH 1NCWH 3LPFA 1A3QA 3T1FA 4NSKB 1NGPH 1ZEAL 3R0MA 1J7VR 3QNYB 4U0QB 4H26A 3VD5A 4WUUE 3U4BL 3QQNA 3KJ4C 5DTFA 5F96H 3GMLA 3QFJA 4L8DA 3V0WH 3HKFA 4JHAL 4OKDA 1BJ1H 5EOTB 4N1HB 1YY9C 3VD3A 1RAMA 3WIFB 1NDMB 4X4XB 2SEBA 5EUOF 1EBPA 3OQ3B 3AFLA 3Q2CA 4K94H 1NCCH 2FWOB 3AMKA 2XZCH 3VGEA 3NMEA 2EZ0D 4UT9H 4FNLH 2WLYA 4JO3H 4P0DA 4MSWB 1QSFD 1D6VL 3GRWL 1F4WL 5BQ7A 4GS7B 4TSCH 3WLWC 2D7QA 4X98A 2B1AL 4WRLA 4AH2B 4GUPB 3C8KA 5DFTA 1IJ9A 3G9VA 4WFFD 4MNGB 1AH1A 3UBXI 3HZYB 1CBVH 2HJKA 1M1SA 3LN9A 4G8IB 3T3ME 5J56B 1GIGH 5ADOL 1VHPA 3NIFE 2BOBB 4NQCD 4ZXBB 3PP3H 2H9GB 1EHLL 3HFML 1DR9A 1G9NH 2Z31C 5KAQG 4BFBD 3OKOA 2DQUL 3QYCA 3VCLB 1YEKL 1LEGB 5D72L 4N0UE 4BYHA 1P1ZB 4YWGL 3RUGA 2W38A 5T5FL 3KYOA 3H3PH 5IB2B 4ZPVB 4XXDB 1QSEA 3LKQA 3V4PH 4I0PA 1TJHH 4AG4H 2R1XB 4Y16D 4BSWB 5EOCH 4NOFA 3KYKL 2AGJL 5E8NB 1XGYH 3GMNB 3DXAE 4TTDD 2NY5C 2DQIL 5F89B 4ODHL 1HCFX 3ROLB 1DUZB 1QLRA 4NKDA 3UJTH 3OBAA 2ADJB 4R7DA 3G5YA 3C2AH 5C09D 3WMSA 2J4WH 3ULUD 4Q9QH 5SWQB 4R97C 2OJZH 4PREB 1I8IB 4G9FD 4PTUA 3CCHA 1QVOB 1SQ2N 5KOMC 4YQXH 5IG7B 5F1NA 1RMFH 3C09C 3O8XB 3LQZB 2GK0B 4PJ7E 5SWZA 5B39A 5MEND 2XACC 3L5WB 4HULB 1RI8A 4M62L 2K7PA 4Z0XB 3MRDB 4GXUN 4Q6IB 3MOAL 3UAJC 2FECL 4MVBC 3V9FA 4GKSA 4J12A 2FGZA 2OS7A 2FHBA 3IGAA 4N1CA 2KDGA 4U3HA 3D2UA 1P2CA 1QBLH 2BSTA 4AZ8A 3RGHA 1CWVA 2F5BL 2VSDA 2WIIA 4XVSH 5DXWA 4S2SB 1LE9B 1FAIH 4L8CB 4J3VA 5D5MB 4ODTH 2O93L 3ILQD 1ODAA 1IGCL 4RWYH 4MX7A 3HMWH 1PFCA 3PJSB 5E99H 2AXJA 4GRWE 2CK2A 3U30C 3EYOB 5E8OB 4HBCH 4NWUL 4MWFB 2W65A 2VTFA 3MRPA 3MRJA 1ORQA 4QYOB 4NRZA 4WWKD 3DYOA 4U7KA 2PN5A 3QUZA 2B1HH 1NGYA 3I2CL 3HR5B 4GBXA 2BNQE 3DVNA 2C1PA 1RURH 2EYTB 2MTPA 4LMQI 5DK2A 4XPBL 1F11B 2YD1A 2H26B 3NFPA 1JJUA 3WDHA 1GGBH 5C70A 2Y6SD 4TOYH 3WDIA 2PW2B 1UM4L 3QDJD 2KKQA 3H8NA 5FIEA 5JHDB 4R0LC 4NGHH 4Y4HB 2QKIA 4OCSH 1OHQA 4JQIL 4NIKB 4JFQA 2XNAB 1G7HB 3O2WH 3L3KB 5HYJE 2HKHL 2VDOH 3ABZA 4N90E 4LLDB 5H2BA 1J05B 3GEWB 4NNYB 1Q0XL 2V2XB 3BW9B 2IH3B 1A1NB 4WHTB 5MHSD 3S37X 3GUTA 3NIDE 1HCVA 1NCAH 3RPIA 3TC9A 3QXDA 4NZUL 1FG2B 1F2XK 3BYTA 3CFKA 3QJHA 2IAMB 3MRBB 5JOEA 1YNTB 3UTPD 4HGWA 4N8PA 4XBPA 4M7LH 3MRIA 4FZ8H 4M02A 4JFDD 1MWAH 2WAHA 4CVUA 1NDMA 3RWFA 3S5LA 4C55A 1T80A 3TPUB 2AQ3A 4MJ6A 4XP1H 1KIUA 4UV4H 3MUY1 1LILA 3F7YB 1HXMA 2X89D 3ARDA 2B0SL 3KPRE 3FT2B 4RMQA 3V0AC 1CGYA 3RVVC 1IC1A 1JRHH 3MNVB 5ESVA 5H37G 1UCTA 1W0VB 3BKYH 1QZ1A 4C56E 3UTSA 3H9SD 3MV7D 1NCBL 1UVQA 2EE9A 5HYQA 2R23B 5DRNA 2AJSH 43C9A 1CICD 4Y2OA 2R2BB 5C6TL 3BP6A 4TVSa 1QBMH 4OD3H 1E4WH 1KFAH 5DRZB 3FN3A 4PJXB 1NUDA 3CLFH 3K2UH 4XNZC 4YGVB