2AJXH

Crystal structure of cocaine catalytic antibody 7a1 fab' in complex with transition state analog
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
EVKLSESGPGLVKPSQSLSLTCTVTGYSITTNYAWTWIRQFPGNKLEWMGYIRSSVITRYNPSLKSRISITQDTSKNQFFLQLNSVTTEDTATYYCARYDYYGNTGDYWGQGTSVTVSSAKTTPPSVYPLAPGTAALKSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antibody 7A1 Fab'
publication title Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
pubmed doi rcsb
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajxH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajxH01
4H25B 3P9MB 4R90H 1VACB 4NQUA 2H3NA 4JVUA 5ITBH 1MLCB 5JUEH 1FIGH 1MCOL 3TN0B 3RL1A 2D9QB 1EFXA 3OKEA 3PWPD 2GK0A 1XZ0A 1VSCA 2XTLA 4HMDA 4KRNA 1XF1A 2LV4A 1U8HA 5C71A 2OTUA 4NN6B 2ZSVB 4XNXH 1KIPB 2X4NB 5SWZE 1QPXA 1A21A 3HI5H 4KVCL 2Z8RA 1LO2L 4AL8H 3LKNB 2AXFA 2BNRD 4IDJH 1HHJB 3DI2B 3UBXB 2DBLH 5IJKC 3QAZB 3OJ2C 4IJ3B 3UTPD 3MLVH 4KUZH 1JRHI 4HWBL 3LY6A 4OCRH 1RIHL 5TQ2H 1RFDL 4JFFA 5B39B 3LS5L 1NCWL 1A6PA 1S7UB 4Y16A 3UEZA 3QFDA 5M95B 2A74B 4G6FB 4ELMF 3QNYA 2BFVH 4AEHL 4PRAB 3EYFB 4ACPA 1ZT7B 2V5YA 4Q6IB 1UM5L 1CLOH 1IRAY 2IPKB 5E2UL 2DQCL 5F7EL 1XR9B 3A6CL 1T0NA 3RUGE 1INQA 4MHHG 5I16A 4HS6A 3WSQH 1TENA 5I73C 1Z3GH 1R3IH 1RQ5A 2R1WA 4O4YH 4MA1C 3OF6D 1IGTA 5IIEA 4S1QL 1JHKL 1W2KT 1WFNA 4EUPH 3RIFF 2WUBL 3QDME 5EOQH 2ZCLH 3T1FA 4DAGH 5FEBA 1OY3B 5DRXA 5J6HA 2FGZA 4YXHL 2JB5L 4MX7B 35C8L 1DBKL 3CVHA 5HHXL 4PJEF 1MFEL 1IEBA 3QWOB 3SGKA 1FNEA 3BEVB 3G6JF 4DVBA 1D9KC 1NMBL 3DVGB 1Q9KB 1PAMA 2ARJB 4GUPA 1EEUA 3QNZB 1O0VA 2Q7YA 1ZLUK 5MENE 5KG9B 1MWAA 3QIBB 2FWOA 5IW3A 5JORA 3MV01 1IT9L 4D0BA 1EUUA 3TH2T 2BHZA 1F4YH 4JY4A 1CDYA 1Q72H 4OLVH 4K8RC 4LCCB 5DJ8B 3RL2B 4UTBL 1L7IL 2FH8A 4LCWD 4KXZH 5LXGH 2NPLX 5J12B 3C6LA 1MCFA 3RA7H 3EDEA 2AI0H 2G60H 3I75A 4LHQB 3SHSA 5HDQL 4YHPB 4M4PA 2VLJE 1CICB 3S37L 2NTSP 1DANU 3JBG7 4N5EC 4LBEA 4ONHA 1LO5B 3OTTA 3D0LB 4JQXA 4KV5E 2YEZA 5IQ7H 1PGRB 1RJLA 2R8SH 3T0DA 5FA3B 3Q6FB 5HD8C 4YDKL 1CFNB 5DDHA 4G42A 3ZZ1A 3L3HA 4H1LH 3CVIL 4ELMB 4LF3B 2AJXH 1X5HA 3EDKA 4MAYA 5CD5D 1DN2A 1RZFL 3RJQB 5FB8B 4M7JL 3QG6A 4H0HB 5J1AB 2KPNA 3NZHH 5JXAL 3JV4B 4RBPK 5JNYB 3IDIA 2OL3L 4YGVB 3AGVA 4M5ZH 4L4TB 5EUKA 3O4OB 4XC1H 4IRZL 5L2KA 4BH8B 4LLUA 3HI6L 5E00A 2J4WH 2X89D 1NUNB 1QBML 4WCYL 4LSVL 3WD5H 5T5NG 1OAQH 3AAZA 3VFUB 3VFWB 1FZKA 5IMLA 3W9EA 2EDJA 1LE9B 5J0BA 4JDTH 2HT2D 4WFEE 1ZS8A 3DMMC 2FJHB 3MODH 1S3KH 4PJEB 2WNGA 1JWSA 4X99A 1M4KA 4DWHA 4Y5YA 4HXBH 2P43B 5EU4A 5D7KD 3KYMA 3TN0D 3G6JB 4M3JA 3D3VA 1P7QA 2OR7A 2HJKA 3K2UH 3LKQB 2CMRH 2ATKA 2GKIA 3KJ6H 1G84A 1HK6A 4S0TD 1UKQA 5EBLA 3GO1L 2BOBA 5EOCJ 1A6AB 4F57H 3DX8A 3H7BB 2O5YH 4Y4HA 4JPIB 1G7MA 1G1YA 1ZT4A 3L5XL 2FYYB 4N90D 3GRWA 3BKYH 1DBML 4X0KA 1FE8H 3CFDA 4UTAL 5DXWA 5IV2A 3NIDE 4HF5H 3OKOB 1FAIL 5DLMH 5SWZB 3VFTA 4G6FD 4S1RL 4BQCA 1XH3B 2XA8H 3EHBD 3S4SB 2Y5TB 5KBNC 1JBJA 3MRQA 2ZCKL 3T2NH 1MCOH 4MVBC 2AW2A 4LK4A 3QJHA 1JGLL 2WQ8A 4KV5F 1HOCA 1KIRB 3M07A 3EO0A 1UCTA 4MAUH 2E7LC 3UPCA 1EEZA 4OF5A 1FZOB 1KJMA 3LQMA 4KVCH 2NW3A 4RAUA 1U6AL 4FQLL 1TZIA 3DROB 2MMXA 4G8IB 4RGOL 1YUHA 5TDNA 3OGOE 1OB1B 2XRAL 4PRBB 1G7PA 5JQHC 4P2QA 4HWBH 2PTVA 4FMFA 2YPLB 3V52L 3LS5H 1NCWH 1XF4A 3GBLA 4QGYA 3S8WA 2FEDD 4AEHH 5IW1B 3BP6B 3FB5A 3RP1A 2YD9A 2C7UB 4DOHE 4U1MB 4XXCC 1YEDB 2DQCH 3E2HB 3MV8E 2GITA 3TPUB 4D8PB 3OKLB 3QDJE 3QDMB 2X4UA 5CWSA 4MCYB 3QIBD 4OUOA 5GS0D 4LQ1A 4HDIB 4FQ2H 4HUWB 2AV1A 1RUKH 2WIMA 4JFDA 3MGTA 4NKIL 5LBSH 4F7MA 1XCTA 2IMNA 2RFXA 4WDIA 4YPGA 2JF1A 1ZGLB 4NCC1 3IF1B 4MJ2A 3QUZB 2PW2A 1CICD 1E4JA 5MENB 1VADA 4XHJD 1QKZL 4PJDE 4RRPG 1P2CB 2QKIA 4NM4H 2JB5H 2C5DC 3ARFA 35C8H 3S97C 4A6YB 2NW2B 3OKDA 5HHXH 3M1BA 1BZ7B 1MFBH 1SMOA 1OGAE 4XP4L 3IJYB 4MA3B 2X44D 2AJZB 1NGZB 1GPOL 4ZTPL 1FP5A 1HHGA 5GSRB 5JHDE 2VLJB 2H6PB 3MV11 1I1YB 1A1OA 3NIDF 2B2XH 4ODHL 4OCXL 3HI1A 3VFVB 1NH6A 3G5VA 3K0WA 4XX1G 1J0JA 1L7IH 5F3BB 4LEOA 1PKQE 4D0CB 1FGNL 4L4TD 1S5HB 4TTDD 4CBPA 5HDQH 3ZSSA 4P2OB 1TVBB 4JZJB 3GM0A 1Y18B 3PNWA 1UWGH 4M7KL 1XR8B 3DNKA 4U3XA 3QXAB 1YY9C 5DJAB 3L3KB 4QYOB 5HYFA 1FL6B 3QQNA 2OX5A 5DFTA 2Z31C 4U7SA 5GJTL 3P4OA 3P2TA 3V95A 3SQOL 3D1MC 3SQBA 2IPTL 2V7NA 1MREL 1T0PB 3BQUC 3ARTA 4BUGA 4PGEA 5DUMH 3SDYH 1A9BA 4DZ8A 2DQHL 3LH2L 4JFOA 1RZFH 3WBDA 3QWRD 2NY4D 4HAGA 1KCSH 3SJVA 3S98A 4X7TB 5C0NC 2XYCA 4OI9A 2IANE 4EDWL 3LEVL 4NQCA 1H3WM 1AXIB 5D72L 1CQYA 2R15A 4HUUA 4IRZH 4DN3L 1MRDH 2XQBL 3HI6H 5C0AE 2R1YA 1QBMH 1XIWB 4OFPA 1G0XA 4X7EC 3RWFB 5JIIA 2AXGB 4OSUL 2NR6C 4M9OA 3O4LE 2DTMH 4JZOA 1OARL 3LV3B 5I1CH 1CFQA 3O9WB 5E56A 5IQ9A 4NC0B 1EAJA 5SWZD 3GK8L 1KCKA 3E6FA 5CSZB 2DQGL 3UCRA 4ODTL 5LWYL 3S36X 5B8CC 3BH9B 3T0WA 2BVEA 2GJ6A 4V2CB 5FYJU 4ZYKA 2D7QA 1QYGL 3VJ6A 3HAEG 1ADQA 4JPKH 3D69B 5IVXE 4LARL 4P3DB 3V0AC 2VQ1B 3O2DA 1J1PH 4L9LB 4GG8A 5F1IA 3GO1H 4DK6A 5C0EB 1D5BB 3DARA 3PE9A 5I75B 3CJJA 4DGVH 3W2DH 2OK0H 2A0LD 5IF0A 1FAKT 3L5XH 1T89C 2X6MA 2FJGB 2BNUB 1DEEB 1IQWL 4NQTA 3UTQB 1DBMH 2OMNA 2YPLD 3IAQA 3MUY1 1QLRA 2VWEE 4YE4L 5HGAA 4XC3L 2ZPKH 4X6DE 4CMHC 4S1RH 1A22B 1C16B 1MCHA 4AM0B 3GJFK 2C4FU 5E6IC 2ZCKH 3CLEL 3MGAA 1AP2A 3O3DA 5I76B 1IAOA 1TPXC 4WW1B 1J87A 4PREB 3ZYOA 3QDMD 4C54A 3QIUC 1DSFL 4XCFL 3RAJL 5E6YA 1A3QA 1OAYH 2P8PA 1ORQB 1CG9A 3C5JB 1BM3H 4EEEA 1BOGA 1EIBA 1JNJA 3CZFB 1HWGB 1MQ8A 5IM7A 4MQ7A 2DQFB 5DEGB 4DOHB 4N1EA 3QUZD 2XRAH 4TNVK 2HFGH 5F89A 3SDCC 3MV8B 3OV6A 5H35A 3C5ZA 3LOWA 1KT2B 1RZIA 3QDJB 4U6YB 3V52H 5MEND 1WEJH 5BRZB 3NCEB 2OP4L 4CW1B 5EU5B 3QPQD 4HC1H 3C8DA 4LU5H 2HT3C 4BKLA 3QUMH 2JJTC 3MLRL 1QSEE 4Q6YA 1QD0A 3O6KH 4IIQA 4HWUA 4LVOC 3VGAC 2NY2C 3EJYC 4L3AA 4OCSH 4OF3A 5C0DA 4R8WL 5F96H 4ZUSA 2VLJD 3KLSA 1DFBL 2MHAA 4RFEB 4DZBB 2GIYA 2B5IB 4NKIH 2XZAH 3TA3B 1WITA 1FNFA 2YR3A 3O6ML 5DHVA 1S9XA 2JKXA 4DKFL 4G6JL 5CJQL 1OGAB 2WUCL 3QH3A 3NFPB 2A83A 4QHKI 1QR1B 3BWAB 5DRWA 4P2OD 5GRJH 2JK5A 3GHBH 4EJ1C 3VFNA 5JHDB 3PJSA 5IVXF 4YDLC 5IB1B 1E0OB 2NY1C 3WJJC 1KTDA 4QWWC 4YFDB 4JPWL 1GVIA 2YPVH 3RPIA 3RWGA 4Y5VC 1PKQB 3EOBB 4RNRA 2RB8A 1GPOH 3U0PA 4TVPE 3D85A 3DBXB 3NCFB 2PYEA 3GMQB 3WLWC 4OQTH 1A14H 4G9DB 2IFFH 4FQJH 5JW4M 5ALCL 4NRXB 4X6DF 4OCXH 1E27A 2LABA 5GSVB 2I27N 3HNTH 3B6SA 1NAMA 1BEYL 1HNGA 2XWBB 1C1EH 1AHWB 1FGNH 4BZ1H 3D0VB 3GSNB 5DGQA 4QCIB 3T2PA 4OTXH 4M7KH 1XIWD 5C2UB 1YEGH 4F58L 3TP4A 3QRGH 2GJJA 3QT2A 4PJ5B 4UOJA 1DVFC 4QTIH 1BZ9A 3PHOB 3VFGH 2XWTB 2Y72A 5E8NA 2IGFL 3O9WD 3DUUB 5IOPA 2IPTH 1JZ6A 4M48L 2IANB 1QQDB 1MREH 3QIWB 3PL6C 8FABB 2Z92A 3IDXL 4XPAL 2CKBH 3H3PH 3MRLB 5E1AB 1KNOB 2XZQH 3LH2H 4YFLF 5C0AB 4BQBA 1DUZB 3TVMA 5KJRH 4XCYB 2IJ0C 4RISH 4TNWF 2HFTA 1HEZB 1I9RL 2X1QA 4TOYL 4Y2DB 1ODAA 3MNWA 2R56L 5D1ZD 3F12B 5DMYA 3O4LB 5KAQG 4PGZA 1RIVL 1NAKH 1V7NH 5GRWA 5D72H 4F7PA 1KYOK 4DN3H 1YYMH 4UT7H 2XQBH 4GSDL 5CP7B 2HMID 4LLWB 1CD8A 2AK4A 2VUOA 2ZKHL 2JIXB 3KPOB 4OSUH 4GW4A 2X9XA 1U8NB 3RVTC 3WUWB 1G6VK 1B2WH 3BGFB 5JIPA 2VZTA 4ENEC 5IVXB 1R6VA 3VXQA 2OJZH 3GK8H 1JRHL 3EDFA 1DR9A 4NQXB 2DQGH 1FSKB 4ODTH 5LWYH 5ICYB 1RIUL 1JTPA 5D71H 5F9AC 5FO9B 5BXFB 2I26N 4U6VL 4Z6AT 4LARH 5INDA 3NA9H 4N8VA 3M8OH 4X6DB 4X8JB 1BVLA 3RY4A 4OLXL 2VAJA 3GMMA 2I9TA 4JZNB 2DICA 5C07E 4KDTA 1WWWX 3V6ZA 4JFHE 1YEKL 1IQWH 2UYLB 3MV8D 4TUJB 3HNSL 3U82B 3DV6A 3QDJD 3MBEC 5BRZD 1ZHKB 4NYLB 1Y0LB 1S7XB 4UILH 2ZOKB 4WHCA 1FH5L 2YPKB 7FABL 2DIAA 3CLEH 2XNAA 1I8IB 3RX8A 3G6AB 4H0IA 3KPSA 1LEGB 3VE0A 3HZMA 3W39B 2GUOA 4RCAA 1DSFH 3MREA 5D2NE 4F15C 3RAJH 2ENSA 5TFSL 3U1SL 1UQSB 1MCPH 3TA3D 3ULUL 5AZ2L 1XGPA 2CRYA 2AKRA 1WISA 1OVZA 1OGAD 3SBWC 3EYOA 4LSDA 1QSEB 3VFSB 4U1JA 1FHGA 4OGYL 2AABL 5JHDD 5DD3H 3RX5A 1A2YA 4Y8AA 4LGSB 1TNMA 1KOAA 4R0LC 1N3NB 4RRPA 5EB9A 3DX7A 2ICEA 4TYUA 3JWOH 1C12B 3P77B 4OZFB 5JW4N 5IR1A 2H26A 4X9BA 1W0WB 3O2WL 4RWYL 4YBLC 3JWDL 3TIDA 3LN5A 1N59A 2D03L 5DK3A 3VXUE 4M1CD 1SYSA 4PTUB 4R4FL 4WU7B 4WTXA 5FUCC 3O3AA 3U36B 1RJYA 3QUXA 3V4PH 3FQRA 2AJYH 1LDPL 2E9JA 3P0YL 3D3VE 2P8LA 5F44A 3K4ZA 4O5LL 3FFDB 5CJQH 2WUCH 2YK1H 3KAAA 3MOAL 2VZ1A 2JJVA 2VLRE 3U0WL 2EIZA 2C3VB 2IMMA 3L3IB 4ODVH 5I6XC 1B0RB 4LRIA 1Z9SA 2CRZA 4F9LC 4PJ5D 4DKEL 3BO8B 5BW7A 4JPWH 3RL1B 1HINL 1EFXB 3OKEB 4N1CA 1ZHNB 2GK0B 1XZ0B 1P7HL 1RPQA 3LD8C 2IAND 1U8HB 3QIWD 2OTUB 1CN4A 1VFBB 2JJWA 2DJ4A 3B2VL 4PJIA 5C0AD 3IB4A 5I1LB 5D1QA 5GISL 3OMZA 1AGCA 4YBQD 4Y2DD 4F33A 1DJSA 2VIRA 4HG4K 3H3KA 3ZKXB 5EH1A 1BEYH 5B21A 3O4LD 2VDML 4JRXE 2NLJA 1DQML 3UMTA 1BFOA 3H3BC 4GXUM 2IH1B 4J3UA 3QNYB 1ZANH 3MA7B 4RSVA 4F58H 4U6HB 3TBSB 3O6FB 2JIXD 4LQFL 4O51A 4YC2C 2HH0L 2IG2L 5KSBA 5JPMA 4ZOCA 1INDH 1SQ2N 4ZS6D 3SE8H 4PLJC 3L7EA 1INQB 1UVQB 3O8XC 5IB4A 4HS6B 3LRSA 1XGYH 2EYRB 4NCDA 1H3GA 3IDXH 5GGSA 3REVB 1B4RA 4FFYL 3S36L 4MCZB 3BT2L 4N68A 3P11L 3SKOB 4LVNB 4YEFA 1IGTB 1I9RH 4TOYH 4KH2A 5IIEB 2R56H 5DWUL 5DUPH 1QPPA 1FNLA 4X4YB 3HAEA 4U49A 4YR6A 5ITFA 3T1FB 4LRNL 3LN4B 1I3UA 2PF6A 1S9KC 1UKTA 5FYLE 4GSDH 1IGFL 4QRTA 4LIQL 3IKCA 4I3SH 4HCRL 2ZKHH 3DVFA 4C4KT 3OXRB 3QPXL 4Z95L 4RQQA 4DVBB 4N9OB 1ERNA 1QLFB 4NT6A 1F6AA 5EFIB 2AEPH 2O5ZH 4NIKB 4K71B 1MWAB 4M62L 5JORB 4PJBF 1T04B 4N0YL 3ZSTA 2B1AL 2P7TA 1DQJB 2VZ3A 3ZTNL 5IEHA 2P44B 3SN6N 5C07B 3H6JA 3VMOA 4S2SA 5ADPH 3RVXC 4NJ9L 5EZIH 2QQLL 2VH5L 3I75B 1HN1A 3MUZ1 1BX2A 4Q74A 4H88H 2CJUL 4OLXH 1WBZA 1OM3L 2YEZB 1RJLB 4ZO8A 3WFBL 3L9RA 1QSED 1MY7A 2VXUL 2VERN 5C0IA 5DDHB 2W07A 2I9LA 4G42B 5GGTA 3L3HB 4YJZL 2HVKB 4N9GA 1ZE3C 2F5AL 5D2NB 4MAYB 4OUUB 2ZG1A 3P9WB 4GS7B 1G7HA 2COQA 5ICXA 4KKCC 4NZTL 5D7IB 4LKXB 3TCLB 5A43C 3DUSB 2P1YA 5DYOA 1OP3H 3U6RA 4ISVA 1OD9A 1R3KB 1V05A 5JDJA 4LLVB 4LLUB 5IJKA 5E00B 3C9NA 4P5TA 5TFSH 3B2UC 3DGCR 3SJVE 5AZ2H 4Z76A 1HKFA 4BFIB 4B53A 3MRKA 2W92A 1V3LA 3W9EB 2ITCB 2BY1A 4NQCE 2OR9H 3QXWA 4JFQA 4OF6A 3VXUB 2Y9RT 4TUOB 1JWSB 4X99B 1EEYA 4NRYA 4HIXH 5EU4B 1QEWA 1AGEA 3BPNC 3KYMB 3K1DA 4PRNB 2GI7A 3P40A 1EFXD 3D3VB 2HJKB 4XHQA 1CGSL 4MJ5A 2ATKB 1DBBH 4ZUWB 3WFZA 2G75A 2WANA 1J86A 5KZCB 3BZEA 4GRLC 4PJBB 3JWDH 2GJZA 2LQRA 2XXCB 5IROC 2P45B 2D03H 1NKOA 4FQXC 2VLRB 2P4AB 3NAAL 4R4FH 4JN1H 5E2TL 1TDQA 3NA4A 3DX8B 4HGMA 5JW3L 4Y4HB 2UWEE 4J3TA 1G7MB 4GQPH 5E2JA 2GJ6E 5E4EB 5D8JL 4K9EL 2BVQA 4WUUA 2NXYC 5F6IC 4X0KB 2B4CL 5IV2B 5DTFB 4NO5A 4BSWA 3IDUA 2CH8A 4LAQL 3MRCA 4IMKC 1ZT1A 3O6FD 1D9KA 3LS4L 3WEXB 4U1LA 1CWVA 1FZMA 4X80L 3QJHB 1N6QL 5I30H 4U3CA 5D1XB 5IHLB 5I17A 4X6BA 5T3ZL 4WI7A 1HOCB 4E41A 4JFXA 2XKSA 4JRXB 3RHWK 2ITDA 2FHFA 1Z0MA 3NABL 4UQ3A 1TZIB 1HI6B 1QBAA 2ZCHL 4LLQA 1YUHB 2FJFA 1G7PB 3KPMA 3NFSL 5CKAA 3MNVB 5J06A 3KPNA 3VXPA 3ULUC 1DQMH 1AI1L 1ZAGA 1XF2A 3I02A 5BOPA 4UUJA 3TH3T 3V5DB 4MGXA 4DTGL 1HH6A 3DXAE 1J88A 1YEJL 3FB5B 1NLBH 4NO2B 3C5SA 2HH0H 3UC0L 3P0VL 5F3HB 4HS3A 5CWSB 2C1OA 2AV1B 5EBMB 4CADA 2CDGB 3OKMA 2X40A 3OZ9H 4F7MB 1JYXA 1XCTB 4IMLA 4YPGB 5C07D 4QRRB 4JFHD 1VERA 2IFGA 5LCVL 1RD6A 1MFAL 1H3PL 5A3IC 3JUZA 4PBWD 3ARFB 4FXKA 4HT1H 1IGFH 4LIQH 1E28A 1Z2KA 2WIIB 5F8QC 5INCA 3KHOA 3VFPA 2UWEF 4UI2A 4WU5B 1UACH 3V6FA 4P4KC 5H2BA 1G9MH 2R0WH 1HHGB 4MAYD 1RZKL 3FQUA 1DZBA 1A1OB 4M62H 4YBHA 5KVGL 3AM8A 1FORH 4N0YH 5E7FA 4J3SA 5IESL 3QDGE 3V8OA 4R3SA 2FBJH 4CN4A 3NH7L 4NJ9H 4EQ2A 2ZG3A 5F1KC 2JLLA 1G6RA 4TRPH 5SWQA 5C0CE 3AXLA 1X5LA 3NIFE 4TTGA 2Z91B 3B4NA 3RY6C 5IGXL 2CJUH 3T4AA 1ZEAL 5C6WH 1TVHA 1KN2L 3WDIA 5A2IH 4OD1L 1JZ5A 1EXUA 1JI1A 1R24A 3WFBH 4X9FA 3ZHDA 1WFUA 4ONFL 5D6DC 2V7NB 4ZFFA 1FO0L 4ZS7L 3QQ4A 5D93B 3B9KA 3VXUD 2HN7A 1QFHA 4PGEB 3PWNA 3ELAT 1FBIL 4HGKC 4JFPB 1KPUA 3D3VD 3Q5YA 3R1GL 3SJVB 1JK8A 3FB8A 2E7LA 4PJGE 5KZCD 4YEEA 3V5HA 2A38A 2F54A 5HHOA 1CTOA 2CIIA 4NQCB 5HJ3A 2VLRD 3AC0A 3BKCL 1YEFL 3KJ4C 4M93B 2BJML 4POYA 4S1DD 2N7AA 1S5IL 4LCUB 4GLRH 4LVHB 3GB7A 1A0QL 3HFML 5I8KL 4GRMA 4QOKA 5EU6A 1CFQB 3Q0HA 4PJAA 4QF1B 3ROOA 1WTLA 5LAXA 3E6FB 1VGKA 4XXCA 1ZGLP 2H8PB 2AK4E 3N0PB 2UWEB 2VLKA 5EWIL 3REWA 1JN6A 1AQKH 2VTFA 1A6ZA 2GJ6B 1GZQB 3PWJA 5D1XD 1CGSH 3HN3A 3W0WA 4ZYKB 4JRWA 1R5WB 4JRXD 3MROA 1A6TA 4GG8B 1SJEB 5CP3A 5F1IB 1T66D 3NAAH 3U4AA 4NKMA 5E2TH 2DS4A 4NSKA 4HXAL 4X5XA 4AYFA 1V3JA 5KTEL 2B4CH 4J8RA 3PHQB 1QLRB 5HGAB 1VCAA 1FC2D 1CXKA 1P7KB 3EAKA 2F8VA 4LAQH 4QRPA 5DC0A 3C60C 3BRFA 1IEHA 1P5VA 4OIBA 3NIFF 4I2XA 4G6KL 3IJHA 1FNGA 1IAOB 1N6QH 5JQ6L 3LPFA 3G08B 5T3ZH 4HPYL 4L8BA 1T03H 1KEGH 2XZCH 4QY8A 3IU3B 4AG4H 3F7YB 5AAMA 4PGCA 5C0GA 2P8PB 5M94B 1CG9B 3NABH 1JVKA 4YHNA 3K8MA 2DL2A 3DXAB 5F1OB 2CSPA 3KPSE 4QRRD 5CHNA 5IM7B 4GRWE 4MS8C 3N1GC 4YDIL 3NFSH 5F89B 3SGEH 4PJGF 1RZIB 2D7PA 1AI1H 1XCQA 1LK3L 3EJZD 3AU1B 3ARFD 2M2DA 4DTGH 2DAVA 2YN3A 2OZ4H 2YXFA 3TNMA 2R39A 5EO1A 1YEJH 1MAJA 4BA8A 4BKLB 1WIPA 1RJZA 3T08A 2HKFL 3P0VH 5C0DB 2HP4A 1IQDA 4ZUSB 2VR5A 3P73A 1ITBB 4X6EA 1WC7A 4GBXC 4J4PC 3WDJA 1V7ML 2X10A 1TQBB 4KTEH 3RWCA 2VDQH 3TYFA 5EU7C 4EIGB 2BVOA 1JNNL 4G5ZL 5BZWB 5LCVH 2A83B 2BNQA 3EO9H 5FA4A 1NGWA 5TF0A 4YAQB 1HHKA 5D70L 4KAQL 4K9EC 1H0DA 3TT1L 4U0RB 3MFGB 1NUFA 2B4CC 2FR4A 5E99H 1KTDB 3MRJB 3MRBA 3PUCA 4XX1E 3WN5C 5EORH 1KCVL 3QDGB 4NN7B 1D5XA 4LLYA 3RPIB 3RWGB 3D39B 4OKDA 1GIGH 1NBYA 4RNRB 1BQLH 1IAIM 4ALAH 5B8CA 1AQDB 4IEFB 3ECBB 5KVGH 5C0CB 1YEIL 5ESAB 3ES6A 3VWJC 4MMZC 4QT5B 3SJVD 5IESH 3GSWA 3IFLH 5DHXB 1NAMB 1N6UA 3BYTA 2QQKL 4EBQL 5D4QA 1RV6X 3S96A 4LCYA 4NQCD 1FG2B 4Z78A 1TQCB 3OL2A 1KLGA 2AJ3A 3BUYB 3TO4B 5DVMA 1MCLA 5DD5L 2CLRA 3CU7A 4UIKH 4LLMA 4RGNC 4Z0XA 5MEPA 3JUYA 2Z4QA 3BIKB 1WZMA 4PJGB 5DFVD 1MCSA 1P4LB 4KTDH 2DD8H 3BESR 4NRZA 5IOPB 3ARDA 1FO0H 4GRWF 4ZS7H 3KGRA 5E6IA 3GSQA 15C8L 3V0VB 25C8L 3E0GA 5FGSA 4LPWA 1MPAL 5HHPA 1JYWA 3PV6B 1KXQE 2XWJB 3TVMB 3QIUA 3M17A 2GJ6D 2A9MH 2HJFA 4I0PA 2R2HB 3R1GH 4ZUUB 4FQIH 1UXWA 3DURA 3MLZL 2OL3A 4YHZL 3HMXH 3SDDC 1NC2B 1NBQA 2PCPA 4ODSH 1I3GL 4U3HA 1CT8B 2BJMH 3LVEA 3IFNH 3WHE0 3SDCA 3O3UN 1UEYA 4JM2C 1UJ3B 2I60L 1LWRA 1O7VA 4NO0A 4M7ZB 4HJ0D 4M7LL 3NCJL 4JO2L 3RVWC 3TH4T 5JIHA 4M61A 5T3XL 3CMOL 2DQIL 4MJIA 2MPAH 1MJ8L 3LB6C 1MJ7L 1ZLWK 2JJTA 3INUL 1NCCL 5C1MB 4UB0L 4KKLD 4XAKE 4GKNA 3JV6A 4FFVD 3GUTB 1JGVL 1RZKC 1Y6NR 2PO6B 3X3FH 3QWQB 5SX4I 3PP3K 1HH9A 1I1CA 1N0XL 2XKNB 2GK2A 3NTCH 1NBZB 1BVLB 1BD2A 1T4KB 1UM4H 4DEPC 3DXAD 2R29L 3GMMB 2I9TB 3CSYA 2AERT 4F3FB 1Q94B 3VRLE 4K3JL 1H3XA 4HIEB 2N1KA 1T1YA 1YMMA 2YBRB 5IJVA 3L7FB 3DV6B 5GGVY 1KELL 3D6GA 3WJJA 3IFPB 4PUBL 3CFCL 3RDTC 4X7DC 3QXVA 3PABA 1O5DT 4XXDA 1U58A 1BMGA 2RBLA 4RFOH 3GSNH 5F7DB 5GPRA 4Y5VA 2XNAB 1T83C 1GAFH 4G6KH 3KPSB 3GKZA 4GRWB 3VE0B 3RTQB 4J2XA 2GUOB 5KSUB 4K94H 4HPYH 1OAXH 1SYVA 2KH2B 3MREB 5KSAC 4P46C 1ZVSA 4L8SC 4POUB 1KC5L 1HSAA 1MRCL 4HX1A 1XGPB 2WBJA 3MUGB 2BERA 4DW2L 3WHXA 4U1JB 2HT4D 4E5XA 4P9HH 1R0AH 4LVEA 4HLZG 4QLRA 1A2YB 4ZOAA 2NYYC 5AWNH 1G7LA 4LCIL 1BIIB 3N9GL 5LVEA 2Q8BL 5L0QC 3QQ3B 1DLHA 3QDGD 5HGGS 3BDYL 5HI5C 4O58H 1I7ZB 4NUJA 3PL6A 4OGXL 5EO0A 1Z5LA 1CLYL 3D39D 5ILTH 3CVHL 2H26B 4W81A 3PP3H 3QULA 3NPSB 3D18A 1DDHB 3DVIA 5F7LB 1P69B 4GAFB 5C0CD 1T5WA 2QV2A 4XVJH 1V7MH 4Q9RL 5B38G 1UG9A 3MA9H 3RWHB 2ICWJ 4XP1H 3OHXA 4UOW0 4G7YL 1JNNH 4G5ZH 4RFNB 4PJHE 4KPHL 2XN9A 4PJ7A 3TO4D 3R06A 5B3JE 3IAGC 4KAQH 5GGQH 1P84J 5EC1A 2ADIA 5GRUL 1DBJL 3GJFA 3OB0K 4LFHD 3C87A 1UWXH 4JB9H 1JPSL 1KCVH 4WUUE 1CZ8L 4Y0GA 3SKNA 5HYIA 2KDGA 4X6FA 2Z0BA 3V4VL 1GJIA 3DVNA 3IXAB 3VRLF 4HIHA 2DWDB 4UV4L 3UAJD 4ZNCD 1IAIH 3QDHA 3BN9C 4D0DA 5J4MA 1XAUA 5LKNA 2GY5A 1YEIH 3U0TA 4F7TB 3TVMD 2XQYK 4OF7A 5FK9A 4PBXA 2V6HA 3DHJA 4F33B 1JPST 4HJJL 3GBML 2C3WA 1B4JL 2QQKH 4EBQH 4E41E 3FQTA 1OTTD 1NC2D 4BZYA 3KS0J 1BFOB 3OAYK 4OI7A 5FO7B 1Q8MA 3V8CA 1U2CA 3MRIA 4NP4H 4O51B 2XPGB 3MBEA 4Z7OE 4EDXB 3MZTA 1TNNA 5JPMB 4JREB 4PJ9A 1DUYA 3F7PC 5J89A 2J88L 4H8WL 3SOBH 1FIEA 3STLA 3G5XA 3LRSB 3MXVL 3NMEA 5DEFB 1CFBA 4HD9A 3JTSA 5E5MB 2LU7A 4DGYL 2XFXB 1ZK9A 3HG1A 5CD3A 4I0CC 1AFVH 1KFAH 2PO6D 5HSFA 3BPCA 3K3QA 4FP8L 5ITFB 4I18C 5TPWL 3IGAA 4R2GC 4YHZH 3SE9H 3BN3B 2Y06L 1LO3H 4UT9H 3SBWA 3QUYC 4HWZA 2DDQL 3OWEA 4WI8A 1FPTL 5JO5A 5GJSL 2I60H 3CFKB 3MRRB 4RX4A 4NT6B 4M7LH 4R0LA 3NCJH 4CGTA 1YQ2A 4L5FH 1IAKB 2W0FB 3CMOH 4PJHF 4YO0A 3IU4L 3OSKA 1MJ7H 2BHYA 3INUH 2P7TB 3VWKC 4Y4KB 1VKXA 3IETB 4TVPH 5B3JF 5HHNA 1M7IA 3KPSD 4Z8FL 4ETQA 1X5JA 1EO8L 3RTQD 4S2SB 1MI5B 5CIPA 1F4WL 4DKDC 2OQJA 4JKKA 4Y4FC 1JTTA 3OAYH 1BX2B 2CPCA 1L9NA 3TV3H 4JGUA 1NMCB 3SDAC 5FYKL 3FHAA 4XP9L 3BMVA 2ED9A 5AD0A 2WV3A 3N85L 4F9LA 4N9GB 1KELH 3JTTA 2VKWA 4G9FA 1JV5B 4NM8L 3U2SB 4HUMB 4X8XA 3MRFA 3B9AA 4JANA 4FQCL 3STZA 1G7HB 3H2WA 4WJ5A 5HGHA 3JXAA 5ICXB 2EC8A 2OSLA 5LGKA 4LL9A 3GI9H 2Q86A 3LQZB 5I8EA 1AKJA 4UINL 1QFWH 3ME0A 5DRZA 3BFOA 4YHML 4XZUB 5DYOB 1J0KA 1CL7H 4Z7OF 4APQC 4ISVB 4PGJA 2EEBA 5KAQF 1FYTE 1KC5H 3EYUL 1MRCH 2F8OA 3KPPB 4PG9A 4Z76B 4M1GL 5FYLL 4Y89A 5I8OH 3MRPB 5DHYB 1MQKL 2F54E 4OT1L 1EJOL 2ESVA 3MO1A 1AGBB 3MLUL 1J11A 4LOUC 3FTGB 3QEGH 3ALWA 1EEYB 4LCIH 2HRPL 4NRYB 3N9GH 2P5EA 3SE4C 3L95A 1QEWB 3KPRE 2F58L 3KYKL 1KCUL 2JCCA 3O8XA 3WIFA 2CUIA 1CLYH 3HE7C 1TZGL 5I73B 4W70A 3BZEB 3CVHH 4XWGL 2DMBA 4U1SB 1BQSA 5ACLA 4O02H 4PJHB 2GJZB 4PJAE 5K9OA 3O0RL 3LKPB 4F8QA 1ED3B 5E24E 1CS6A 2FB4L 2WBWB 1JGDA 2D7MA 2LU4A 1EGJL 4EOWL 1T7ZA 2VLKE 1BPVA 1MWAH 5I66A 5ID1A 2EE2A 1I8MB 4YHOL 4YXKL 3W0WE 2B8OT 2VQTA 5C0JB 2FBOJ 4PRPE 1M6OB 4NO5B 4W6XB 1U0QA 2CGRH 3MRCB 4GAYA 1ZT1B 5H94A 2IALA 3T04D 1A4JA 3UTZA 1D9KB 1GGBH 2NY6C 4HKBA 2CRIA 4V1DA 1FZMB 3N1MC 43C9B 4WO4C 2RAMA 1CZ8H 1FVDA 4UBDD 4Q0XH 4X6BB 2CDFB 1I3RA 4E41B 4JFXB 4Y16C 4XP6L 2CK0H 1NEUA 2XY2A 2D31A 2ICWA 1WWCA 2CIKB 3MCG1 4D3CL 5C8JB 3IVKA 2ITDB 4QRPE 4L9DA 1L7TH 4UQ3B 4QXUH 3ZKND 5CEZE 4QHMA 1OT2A 5DO2C 4PTTB 1MVUB 4YPJA 4I2XE 5DD1L 2YA1A 4U7MA 5HYSB 5ANMA 1SJHA 5FUOL 4RAVA 3GBMH 3F6LA 2PNDA 4KJQD 5IUSA 5MI0C 4LNVA 1L4IA 3KPNB 5JXEA 4JY6A 4MXQC 3TZVB 4X7FC 4KMTH 1HH6B 1T7VA 5AG8A 5C70A 1WCBA 2H45A 3SEPA 4HIIB 3BZDA 2RGSA 4QRUA 2YD7A 1E4XI 2KBGA 2CD0A 3C5SB 1S9VA 3IDGA 5E94A 4NGHL 3TCXA 3BP4A 4PS4H 1AC0A 5E4IA 3WL9A 2FNBA 2J88H 3QO0A 2VQUA 3OB8A 5CS7A 1ZHLB 2GYSA 1RUAH 3HZKB 3CCHA 5T33H 3HUJA 5DJ6B 4XT1C 5AAWA 1UENA 2JELH 4CADB 1K4DB 3GMRB 4MZ2A 4Y4KD 3OKMB 4FG6D 2ZWLT 3VG9C 4IMLB 4DGYH 1XF5A 3SGKC 1KN4L 5IHZB 4Z0BL 5FF6B 3U7YH 1MI5D 4PJCE 1JPTH 4KFZC 3ESVF 5EBWA 4KROB 4NO3A 4FP8H 1J10A 1F58L 3RZWA 4EUPB 4XNUL 2ZUVA 3LEYL 2PETA 1WQVT 4M6OH 4W4OA 4DFHA 1OQXA 3O2DL 4MJ6A 4YXLL 4PJAF 4MD4A 1E28B 3WKMH 1DP0A 5INCB 1CK0L 5E1HB 1FPTH 4NCC2 3R8BB 1U3YA 4WWID 3VFPB 3C6LC 1GGTA 5BQ7B 3G5YB 5C6TL 3DMMB 4MZ3A 3V6FB 3BW9B 1KUMA 4JG1L 4YQXH 4GW1A 3GRWH 4BK5A 4JG0H 3FQUB 4NWTH 2IQAA 4JQXC 3I6GA 5F71A 2H2SD 1E4WL 5CJXA 4GRLA 3H9ZA 3HB3C 4Z8FH 5IROA 2BRRH 4CUCA 4R3SB 4FQXA 4C57C 2L7JA 5H37G 4ZQKA 1F4WH 4KRPD 4P5MA 4F7CA 4HULB 1HQ4A 1P4IL 3SDXA 5EUOA 3SGDI 3FO9A 5L88H 1NJ9A 3OQ3B 4S1SL 1TVHB 4BQ8A 1I1FA 1EXUB 1R24B 5FYKH 4B7IA 2AEQL 3B9DA 3EFDL 1U8LA 1J0HA 3TM6A 3HC4L 3Q5TA 5MEOA 3GHEH 3LAFA 3QQ4B 4G8FA 1HQRA 2HN7B 4UDUA 2HLAA 4H1LB 1PQZA 1OP5H 1FYTB 3VMPA 2CXKA 1PSKH 5D2LA 2B0SL 2DLGA 3NZ8A 4H8WC 1CVSC 4CJ1A 3FT3A 5E9DA 4G3YH 5ADOL 4MB4A 3V5HB 4LDEB 3QEQA 4FQ1L 2F54B 4YHMH 2V2XB 2OR8A 3BH8A 3MV7D 3QZWG 1RY7B 2EECA 3AS2A 5KVFH 2ZSWA 5C0BE 4PR5B 4Y5YC 5TH2A 1A1NA 3ARRA 1F3DJ 4IM8A 2J8UA 2IPUK 1UH2A 4D9LH 4LSRH 5B38A 1CGWA 5BV7L 3KPRB 1CLZL 4J3XA 3FO0H 2EO1A 2W9EH 4M1GH 1T20A 5FYLH 1X5GA 2FO4B 3GB7B 3UJTL 3BIBX 2DMKA 4ZNEA 3CNKA 1EHLL 5C9JA 4OCYL 1QRNE 4PJAB 3ROOB 4PJCF 5LAXB 3KPQA 3SO3C 2AV7A 3BZFA 1GHFL 3A67L 2FGWH 1D9KD 4G7VH 3MMEA 4DQOL 2F58H 2AEWA 1A6ZB 3KNBA 1QSZA 1WSST 3N1FC 4M03A 2BSTA 1ZLSH 3TFKC 1J0IA 1HXYA 3DLQR 4E41D 1FDLL 2OMBA 5F6HI 4AT6A 2DQEH 4O2FB 4PRPB 5I1JH 4K8RD 1JE6A 4CAGA 3CC5A 3WO4C 3TYGL 1BIHA 4NKMB 4XNMB 3FRUA 4EOWH 2ED8A 4NSKB 3J8F7 4HGWA 5LGJA 4HJGB 4OFDA 3OR7B 2BSSB 3P4MA 1UA6L 2A2QT 4JY5L 4N5ED 4HK0A 1AY1L 4J8RB 3ROLB 5I1HL 3TZVD 1NSNL 5F1NB 2BMKA 1BD2E 4OD3L 4Y19A 1NLDL 3CFEB 1DQLL 3FQXA 3CUPA 4GMSH 4NHUA 2VL5A 5HD8D 1PVHA 4W6YB 4TSBL 4R7NB 3T0VA 3IJHB 3TJEL 4PPTA 1FNGB 2P24A 2X09A 3GSUA 3A0OA 1ETZB 4W6WB 3J7HA 2GEEA 2H32A 4XP6H 2PR4L 2XG5A 4PGCB 1C5BL 4D3CH 1CXHA 3S3JA 5C0GB 5C7XL 3RI5K 1GGIL 2FL5B 2NY3C 5DD1H 4NWUL 5CHNB 2VRAA 4KROD 2C1PA 2VSCA 1F97A 5MP6H 6FABL 5CILL 4ETYA 4YHLH 3X12A 2HTKC 4IHOA 4FHBD 2A6DA 5F7FA 1AO7A 1Z6JT 2Z31B 1QFOA 5SV3A 1A7PL 1S9WA 5C08E 2V2TA 1KTLB 2X4SA 4Z7WA 1OHQA 3BQUB 5EZLA 2K9UA 3HA0A 1RJZB 3DMMD 1CFVL 1NGXA 2YD1A 4WHYG 3S5LG 4NGHH 4MQXC 4PJCB 4OLYL 1T5XA 1W72L 4P5KB 3GMOA 4L3CA 3VGFA 1ZTXH 5MEQB 2Z93A 3P73B 4IRJB 4C56A 4BQ9A 2OTWA 3EO1A 1X5FA 4HV8A 4ONGL 3QHFH 4R7DA 3EHBC 4KK9C 1S7RB 2VZOA 3RWCB 4O2EA 4Q6IC 4JVPA 4Z0BH 3STBA 1F6FB 3CH8A 3HNVL 2W59A 5JPNB 5DRNA 1F58H 3ZT6A 5CGTA 4XNUH 5FA4B 1NGWB 1BJ1J 1ADQH 1HHKB 5CEXA 1UEMA 4YXLH 3O2DH 4XRCB 3WFHA 1J12A 4UV7L 1MF2H 3HKFA 1FLTX 3O45A 2WINB 4ORGB 2ERJC 3TBYA 1CDBA 4HCRA 1F4XL 2BVPA 5IWLA 1EEQA 2XN9E 3I85A 4AIOA 5B8CB 4MVBD 1KCRH 1FYTD 4P57A 1QFUL 3ES6B 5CMAB 5CLWA 1E4WH 2FEDC 5TQ0L 5A2FA 3DX9A 2VXVH 3MLWH 4F9PC 4CVZA 1H3UA 4QHKJ 3S96B 2NNAA 4HUNB 5IBTH 3FT2A 5EOCH 2DYPB 1P4IH 4OZIA 3QIBC 5GS0C 3N1PC 3ARWA 2BXYA 3I9GH 4AEIH 4WFFE 4HSQA 1OAKL 3C2AH 4Z0XB 5MEPB 3KPRD 2V2WB 1U92B 4POZC 2Z4QB 4KMLB 4F37K 2AEQH 3EFDH 2D0GA 4NRZB 1SVZA 4Z5RB 5E6IB 3GSQB 3AVEA 2BY0A 1X6NA 5C0BB 5HHPB 4NUGH 1TPXB 3EYQC 3SY0B 3PP4H 3QIUB 2NY0C 4P3WA 1Q1JL 5I1GH 3RRQA 5ADOH 2E8YA 5CFHA 4KI1A 3DURB 3KXFA 1OQOA 2OM5A 1AGDA 3FO2A 1JGEA 2OL3B 3GBNH 4FQ1H 4PRPD 2AJVL 4K7PL 3GSXB 3VXNA 1QRNB 4FTVA 1RZGA 3RNKB 2PCPB 4LGRB 4HAFA 3V6OC 3HE6A 4RMUA 1KIQB 4X6CE 1IILE 3SDCB 5GXBB 2R1XA 3UROR 4U1IB 1KACB 2DTSA 1DBAL 5E8EA 1P4BL 1AD0A 5DHVH 5K9JH 1EHLH 6CGTA 3HZYA 4H20H 1K4CA 4AIZA 4OGAC 1T1WA 3TO2A 3PGFL 1GHFH 5TF1L 5CEZD 2Q8AH 5DMKB 2DQJH 5I1EH 2DLFL 1NMAH 4XVSL 4LVOB 4DQOH 4GKNB 4ODXA 3VGAB 3BZ4B 3WFCL 2AQ3A 3P9LA 1A6UL 4GBXA 1FDLH 4J4PA 3UJIL 1IKNA 3KR3H 4X98A 5FYJL 1BD2B 2LVEA 1U3JA 3HLAB 2AGJL 5JLZB 3K80A 5TE6H 4JO1L 5HGBA 4X5WA 4FRWA 4L8CA 2NY4C 3TJHC 1S7TA 3KLAA 5FUCE 1T1YB 3QO1A 4JY5H 3MLXL 4YDLB 2HTLC 4GW5A 2A1WH 2ED7A 4WW2A 1YY9D 1NAMH 5I1HH 2NY1B 4IOIA 1NSNH 3CPLA 4XI5D 4FQHB 2Z31D 1DQLH 5DQDL 4XXDB 1U58B 4WNQB 1F11B 2O61A 5D5ME 4TSBH 2XQYG 3BQUD 3QXTA 4TUKL 3TJEH 4QTHB 2Z9TA 4N0CC 3H7LA 3SPVA 1QSFA 2NMSA 3VWJA 2WLYA 3S88L 4PV8B 4IRJD 4G9FE 1C5BH 3WIHL 5C0ND 3WV0A 4TNVF 5I0ZA 2HJLB 1IC4H 4NDMA 5F21B 1ACYL 5CAYB 5GZOC 5C08B 4IIQC 4OV6F 4E5XB 6FABH 4GT7A 3MGOA 3VGGA 4ZOBA 2VZUA 1NANI 2WM0A 3TNNB 5BV7C 1DVFB 2NR6D 3ARQA 4BSJA 4C4KO 3ILPA 4OKVA 1DLHB 4KKBC 2A0LC 1NUGA 2CO6B 3PL6B 5EO0B 4HHAA 1CFVH 3O3BA 5F9JA 1I9IL 4LPYA 4X6CF 4ZOEA 1B6UA 3QULB 5ECJE 5BVPH 3D18B 5E2VH 3S35X 1FFNA 3I50L 2R23B 4WV1C 5E8OA 2P5EE 5DJZA 2BK8A 1AIFB 4ONGH 5KOVC 2J6EA 3DUHA 1RUML 1T0MB 4M4RA 1I7UB 1G9NL 4JE4B 3IDJA 2ILLA 4TSCL 4U1HA 3HNVH 1Q9WA 3E2HC 1WK0A 2A6JA 3GIVA 2DYPD 3I6LE 3THMH 3R06B 4U2ZA 1XFPA 4NOBA 3ARZA 4JM2A 2VN7A 7CGTA 2KL6A 4RGMB 2ADIB 5J11B 1WIOA 3GJFB 1SM3H 1QVOA 4UV7H 1N2RA 3AS0A 1LQSR 1R3HA 4WY7L 5C09A 1N0LA 4JHWL 4I48A 3D25A 1JHLL 4MSWA 1OTUD 5E6ID 1IL1A 3L3DB 1IBGL 3C09C 5C0BD 1S8DA 4XVUC 3OPZL 5L2JA 1QFUH 1KEMH 1JF5A 3U0TB 5IMOB 3QIUD 2BDNH 4V1DE 4XMPL 3OXSA 3AROA 3OJDB 4PLNC 4JLRB 1X9QA 1IC7L 1NFIB 3HZVB 1UJTA 5D5MF 1JGUL 1TTGA 1LO0H 3FZUC 2C3GA 3QCVL 4DGIL 4GRWH 1QRND 3QZWA 4MWFA 1J05A 3V5KA 5DQ9A 5IW6B 3VFMA 3H42H 1A3LL 5E2WH 3MRIB 3CAFA 3W9DA 1MEXL 5JMRA 5IHUH 2N56A 3MBEB 2N7BA 3NN8A 5KW9L 2K7QA 1C08B 1W0VA 5IMMA 3GSVB 3CLFL 3ARYA 1KIUA 1OL0A 2FEEI 5F93C 1A5FL 5CCKL 4P2OC 5FM5M 2VYRE 1T83A 2HT3D 3MC0A 4BELD 3CSGA 5DZNA 1IFHH 1KGCE 5L9DH 5HY9A 3EJYD 4D2NA 1QZ1A 4B5EA 3LZFH 3KPLB 4LLDB 5CD3B 4X6CB 3RWIA 5JA9A 1Q1JH 2V9QA 4OQ1A 1PG7X 4P46A 4F15B 1CF8L 3IGAB 3VI4E 1ES0A 3ARPA 1JJUA 2I07B 4NKDA 1BD2D 2E27L 4PP2A 1KLUB 4KK8C 5DJ2B 1JYNA 4HWZB 2P8MB 1XF3A 3OGCA 4Z7VA 3MX0A 5EA0L 2EDNA 4LSPH 5CUSL 5JOPD 3CXDL 4QRSA 4TQEL 1BGXH 1P4BH 3VXTA 2NY1D 5I1DA 1RZ8A 4QWWD 1Q0XL 4MD0B 2UUDK 3F5WA 1C7TA 5ACZA 4FZ8L 1QO3A 1XIWC 4XVSH 4YBLB 5F9WB 5I8CA 4CRPA 3BSZL 4XNZB 1E4XL 5DJDA 5JW4Q 5CIPB 3UJIH 3O9WC 1I7TA 1A7RH 2PYFA 3QI9A 1RSFA 1MAKA 2Q3AA 2AGJH 3RVVC 1T2JA 5C08D 2ZUTA 5D5MB 3P30L 3SE3C 3WE6B 4OCMC 1C5DA 3GMNB 1BECA 3GIZL 4YDJA 5DZOA 4Q9QH 5D1ZC 5I6XB 3MLXH 3FB7A 3JTTB 3MRNB 3SDXE 4BUHA 4MNGA 1MUJA 1DVFD 1LEKA 4G9FB 1S7QB 2HLFD 4WJ5B 5HGHB 2VC2L 2B1HH 3RBSA 4L29B 2HMIC 3U30C 3Q6GH 1VENA 1VHPA 3HR6A 4XP5H 3S5LA 1E4KA 3LQAH 5DRZB 2VMFA 3CXHK 4NZRL 3I2CL 1INEH 3HS0A 4TSAL 1AXSB 2MQ0A 4OZHA 1K3IA 1CGYA 5J9PB 4OIIL 5D2LE 1KENL 2FZ3B 1JNLH 3G5ZA 1VPOL 2EC9T 1ACYH 2X4TA 5F88B 3RGHA 2G9HA 1LVEA 1A7QH 4Y88A 4FFWD 4JDZA 3DETC 1L9MA 5EULV 4NC1C 3EOTH 2BRQA 2W65A 2QHRH 3GJEA 1P1ZA 1X5AA 3HAEH 4ZDHA 4YC2B 3VI4F 2UUDH 4QHUB 3RVTD 2P5EB 2G5RA 3BVNB 3EFFA 4LKCA 4DUXA 3ULUE 3DECA 4ZAKA 4OZ4A 1KPRB 3VH8B 3O8XB 4H26A 4MNHB 1N8ZA 1CDIA 4ZNEE 2NQCA 1I9IH 1ND0A 1SJXA 2A9NL 2QQNH 4P23C 5K9OB 1TETL 5TE7L 4D94A 3E8UL 4LRIC 3G9VA 1JGDB 3CMGA 3ARGA 4WFFD 4XPBL 1NCTA 5D7SH 3ZMRA 4I18A 5ID1B 1IKFH 1EHXA 4JR9L 4K3DH 4R96B 5DMJB 2YSSB 4HZLA 2R4RL 1DL7L 3UJJL 4FXGB 4GAYB 3CFJB 5DJXB 2UV3A 1IM3A 1I8LC 2QSCL 1G6RL 3VXRA 2IALB 1A4JB 3UTZB 1AH1A 2EDHA 3TA3C 5D96C 2W60B 4V1DB 3BXNA 3MBED 5E95B 4WY7H 5B39G 3LDBC 4JHWH 4BFEA 2X70B 3T0XA 3HR5A 1I3RB 1YQVL 2KQNA 2BOCB 2I5YH 3VWKA 4LMQI 2ICWB 3QQ9C 2WWKT 3IVKB 4Z77B 3UTSE 5IFJA 5GGTH 5GS3A 4NQEA 5D7JC 3QEHA 3SDXF 2YD6A 2R4SL 3CH1B 3T8XA 1J0YA 1X5IA 3L6FA 2F53A 5DD6B 1NFDA 3RGVA 5FUZL 4Y4FA 4RAVB 3VU2A 1VA9A 1YNTB 4JY6B 1LILA 3EKCA 1NDGA 4QXGH 5DT1L 1YEHH 1VDGA 3BE1L 4OLZH 3MJ6A 5J56B 2O93L 1WCBB 2EDKA 1A3LH 3DIFA 5L7XL 1S9VB 3ZYIA 5B3NA 5E94B 1JFQH 1UB5A 4KRLB 1OCWH 3MRMA 5CSGA 2DWEB 4AEFA 1LO4L 1YZZA 1AO7E 4TVSa 1GSMA 4MLIA 4YIQA 3KVQA 3VDBA 4GG6A 1U91A 3MQIA 2Y6SC 1I9JL 4Z7WE 1XF5B 1P6AB 3FOMB 2AXJA 2W1NA 1N64L 4NNXA 4NO3B 3ULUF 2D9CA 2YN5A 4OF8A 4QO1A 3QIWC 5MHSD 1T1ZA 5JOFA 5JDSB 2E27H 5ERWA 4MJ6B 1G9NC 2IAMC 3OAZK 4MD4B 3QXDA 5FECA 5CEYA 2DLTA 3CSBA 1NCBL 4K07A 5EA0H 3U4BH 5DJCA 4G8GE 4JRYA 5CUSH 4J6RH 1A7BA 3T0EB 1II4E 3AREC 1U3ZA 3LIZL 4OJFH 4TQEH 4HMEA 3DSFH 3BPNB 4R4BA 3S7GA 4G9FD 5IMKB 5IBLC 1Q0XH 1MLBA 2IQAB 3I6GB 1U93A 4PRHB 5CINL 3HE7A 3GMLB 4RAHA 3WYRA 1JWUB 32C2B 4LIQE 5AYUL 3ZDXE 3L5HA 2EDEA 3MACL 4FQXB 3FOLA 3WS3B 3BSZH 4HEME 3O6LL 4JKPH 1RUPH 4ZQKB 4M5YH 4P5MB 1HQ4B 3F8UB 3SDXB 5TDOA 1A9EA 5IP4A 1NJ9B 3MXWH 5F6IB 5BS0A 2HG5B 4K8RH 4DN4L 3FFCA 1I1FB 4Y5XB 4I5BB 1LE5A 1QBBA 2X1PA 1U8LB 1UADC 1Z9LA 1WZ1L 2YOCA 4G6ML 4ZUTA 3RQ3A 5MEOB 5SWSE 4G8FB 4NBYB 2VR9A 2VWEC 4UDUB 4YNYA 4X4ME 4P5TC 4OZIE 1PQZB 2Y7QA 4WO4A 2DBJA 2X4OA 3C08L 4YUEL 2P5ED 2AVGA 3NZ8B 2VC2H 4ERSL 5BMFL 3O8XD 4PY8I 3FT3B 5DGRA 3RKPA 4MMXC 3MRHA 1MNUL 3RZCB 4E0RA 4OZGA 5MERB 2D3VA 2EEDA 3L5WB 2YD3A 3S35L 1YECL 3I6LD 4TSAH 2EH7L 2NTFA 3MNZA 1ZWIA 2ZSWB 5BO1L 5E8PA 1A1NB 5JR1H 2J5LC 1FFPA 1NCAL 2A77L 1KENH 3MUJA 2EICA 2FSEB 1JL8A 3L3JA 5D7LA 3S34L 5CJOL 3U9UB 3U83A 3WKNA 1CTNA 2IF7A 2EDDA 2WSKA 1EBAA 4K7FA 1R5VA 3KXFE 3NCBB 5ISZA 4XBPA 1S9YB 4XMKL 4AY0A 4Z7WF 3RNQB 3X13A 4IRSC 2G2RA 3KPQB 3D2UB 1MH5A 1DQQB 1YDPB 5I18L 2CR3A 3IXTA 3LPGA 3DX6A 5LGHL 4GAJL 3MMEB 2VXQH 4V1DD 4OFKA 1E6JL 4KI5E 3KNBB 4P59H 3SGDH 5FGRA 4CMMA 4ZXBC 3L3GA 5FGCE 1I4FA 2YZ8A 3S4SG 2Y4SA 3KLDA 3CC5B 5IT2L 5A16B 3RVXD 3EYVB 1JMZA 3FRUB 4XB7A 4Q2ZA 5DSCA 4E42B 3GSOA 1X5YA 2GTZB 4XPBH 4KJYA 1KF9B 3MJ9L 3K8LA 1M05A 4KGJA 4JR9H 1BQHB 3QHZL 4Q58C 3LEXA 4ZPVA 5I1IL 4XBEH 4QRQA 4MDJA 4ZUVB 3ZDXF 4WGVB 1SJVA 2BZDA 5B4MD 2BNRA 1DL7H 4KHTL 4N0FA 3FQXB 5EU7E 3MBXL 4NHUB 2APXA 3UTSB 3BP5A 2QSCH 1G6RH 1MCCA 2IQ9L 4XPGH 1KGCD 4NQDE 4P4KB 3RHWF 1PD6A 4AENA 5GS1B 2P24B 3GSUB 2GAZB 5I74C 3MYJA 4JPVH 5BZDA 4KKCD 5T1KB 1VGEL 3H9HA 1U8MA 4J1UB 4IBLT 1J1XH 1NFKA 2MJWA 1MCNA 3FB6B 2F74A 4H5SA 2R4SH 3RWJB 1LK2A 1ZXQA 5FDYA 2M1KA 4KVNH 1F8TH 5FUZH 1T22A 2AJUH 2C1PB 5GGUB 1SHMA 1KULA 3B2UD 5T3ZE 4IHOB 3TT3H 1PYWB 4PP1D 1AO7B 5DT1H 1LNUA 1BZQK 3D9AL 1WWBX 2CLVA 4ZMAT 1A1MB 1U8KA 2X4SB 5FKAB 5HYQB 4Z7WB 4RIRA 4HPOL 3MCLL 3H9SE 1CGUA 1NGXB 3RUGF 3T0ED 2WAHA 1JWMB 3X11A 2GFBA 1T5XB 4M00A 4L3CB 4RGNE 1J8HE 2Z93B 1KJVA 4OFVA 5EU3B 4BSVA 4LDOB 4PRHD 3P4NB 3EO1B 4HV8B 3NFNB 4JO3L 5IFHL 1I9JH 1ZLUH 3O6FC 2ICCA 3UP1A 1FFQA 5DD0H 4FQXD 2FO1A 4M8QA 4KY1L 1OSPL 1N64H 1RUQL 4CNIB 5BJTA 4G8GB 1U8JA 3V4UH 3KJ4B 4KI5F 3HC0B 2MCPL 1SEBA 4YGAB 1MCDA 3E3QC 3AM8C 4FFZH 1Q38A 5CEXB 3F58H 4HFUL 3X14A 1NC4B 4KK6C 4LCWA 5H8DA 5CP3H 5A2KH 1D6EB 2HKHL 1G7IA 2FX7L 3R4DA 5I2IA 4GKSB 3TBYB 1PG7W 5A2LH 5DJ0A 2IBBA 2MSPA 1QUNA 2BVPB 3MJ7B 2ID5A 4LSTL 1SBBA 4XCCL 4QXWA 1YYLL 1HZHH 1XGQB 4U7KA 4P57B 4OLWH 5DR5L 5CINH 1BP3B 2ZG2A 2QEJA 3ULVL 4PY7B 2DL9A 4FQQA 3QNXA 4XPFL 5FGBA 5CEZH 4Z7UA 3MACH 4KJPD 4CL7A 2Q6WA 3HPLA 1HSBA 3KPTA 3B9KC 2NNAB 5SWSB 4RBPH 1IM9B 1YJDL 3GMPA 1YPZA 1BVKA 4K71C 2PTTA 4XH2A 4QHNB 2ORBL 1B9ZA 1F4AA 1MHEA 3Q48A 3ILQC 2ARWA 3ULUD 2NY5L 4N8VG 2GSIA 2PKDA 1ZSDA 5ESVA 1LO2H 5KN5B 4PJ8C 3WNNA 1KJ2A 3C60B 4LP4A 3D2UD 1Q9LB 2GSGA 3VFRA 3F7RA 1FFOB 1EHNA 1MRFL 5I1AA 3OKNB 1RIHH 2ZOLA 1H5BA 1RFDH 2VDKL 3RUGB 2NCMA 5BMFH 3KXFB 1AGDB 1Q9OA 4EI5B 5DK0A 5CBAB 2BSRA 3P9MA 1VACA 3RKDC 2EH7H 1MLCA 4P4RA 4X83A 1UM5H 4PYHA 5BO1H 4Q9CA 2Y25A 3TBTB 5E2UH 3TN0A 2YUWA 1UWEL 1NCAH 5F7EH 4GS7C 3A6CH 1MFDL 3S34H 5CJOH 1XGTB 3VXME 1A7OL 4HS8L 5I19L 1M7DA 5A3ID 2ZSVA 4HIJB 1KIPA 2X4NA 1PY9A 1W0YT 5E8EB 1AD0B 5FGCB 3LKNA 2APFA 3HZYB 4AIZB 3CZJA 1J18A 4PRIE 1PFCA 3TO2B 3UTSD 5LQBL 5IFAL 4S1QH 4MXWL 1JHKH 5LGHH 2WUBH 1H8SA 4P4KD 4Z7VE 4UU9A 3P9LB 4JO4L 5B39A 3UO1L 3DOSA 4ELKA 3V0WL 4YXHH 2WLZA 2A74A 4GBXB 3RWDB 5KS9E 1DBKH 5T1KD 4KXZI 4X98B 1MFEH 1XMWA 4AMKL 3EYFA 4Q6IA 5J8OA 3DRQB 1NMBH 1WFTA 3IDYC 3JVGC 4JM2F 3T65B 4NQDB 4X5WB 1EGJA 3KHQA 2I25N 3QHZH 4KJWC 3KLAB 3QCUL 1MELA 1IT9H 3QO1B 5I1IH 1MAML 1X7QA 5K9KA 3BPLB 1FNSL 2DM2A 3RFZC 4UTBH 4AZ8A 1NQBA 1AO7D 3WN5B 4PB9L 2Z8VC 2LU3A 2IQ9H 3U48A 3FRPG 2O61B 4U05A 4F2MB 3S37H 5E4EC 3BOVA 5B22A 1M7XA 5J3HD 3DPBA 5CZVL 3VWJB 4W4NA 2C4XA 4M6ML 1VGEH 1YNLL 4BH7B 3GFUA 2IADB 1FLRL 1HHIB 2NY7L 4BK4A 4YDKH 4F9PA 3BEVA 1CBVL 1MHHA 5JHLL 2GHWB 3CVIH 1Q0YL 1Q9KA 3DTXB 3CIQA 2ARJA 3ORJA 3H9SB 4G8GD 4GKOA 5KG9A 3QIBA 1I1AC 2L0DA 4M7JH 3MGOB 1EZVY 2A6KB 4OZHE 5JXAH 5DJ8A 1J8HB 2OL3H 1NC4D 1BLNB 1T66C 3BYYA 2FX9L 1MJJA 3SKJL 4YHPA 1NL0L 4GQ9L 1FNAA 5ID0B 4JCLA 4XVTL 1MHCB 1OWRM 4HKJB 4YWGL 4WCYH 2YA2A 4LSVH 1QNZL 1LO5A 3D0LA 3Q2CA 1FFNB 2VL4A 4DUWA 1OTSC 4G43B 3D48R 2YKLL 3PQYE 5DJZB 3Q6FA 3MUHL 1WJ3A 3TPKA 1RZ7L 4OI8A 5IFHH 1CFNA 3W11C 3SDDB 1IC5L 4ELMA 4LF3A 2P46B 2QR0B 4HKXB 4KY1H 3WUZA 3X3GL 3HMWL 1RUQH 4Z7VF 5EIIA 1GC1C 1MSPA 5TGBA 1OPGL 5SWSD 3GIVB 3V6OA 3GGWA 1IM9D 2FIKB 4PJDF 4ESKA 5DA4A 5J1AA 4JM2B 2APTA 1HXMB 2H41A 5KS9F 2E6PA 5TJWK 5I15L 4YGVA 3HCVB 4WI9A 3U79A 2ZUUA 5BVJA 4L4TA 1OP9A 4KU1A 2QADB 1FVEB 1G7JA 4WTWA 4ZD3L 3RY5A 2FCBA 2OJEB 3D25B 4K3HA 3C60D 1EO5A 4IS6B 1BBJA 3IKKA 1IL1B 3O41B 1CD0A 5DVNA 4CDGC 1IJ9A 4GMTL 3VFUA 3VXRE 3VFWA 4UTAH 3ULVH 1FAIH 3KXFD 1JF1B 3VGBA 4KC3B 4EI5D 2FX8L 3ARDC 1B90A 2FJHA 2R9HC 3QJFB 4PV9A 4PJEA 4DEPB 4MWFB 3QZWB 1S7WA 2HVJA 4MS8D 1JGLH 5C6PB 3G6JA 1DN0A 3VFMB 4KKAC 4NQEE 1KB5L 1DE4B 1UXSB 4I0PC 3W9DB 1TJIL 2NY5H 1NFDE 4KI5D 4ZFOB 1I1RA 5EZOL 5AZEL 3RDTB 1W0VB 5IMMB 1GZPB 2AXHA 3TBWA 1U6AH 2ATPB 4FQLH 1WBYA 5GZNC 3UZVB 1A6AA 1H9VA 5CJBA 3SO5A 1NEZG 3H7BA 4RGOH 1FO0B 4JPIA 1QRKA 4LGPB 4OZHF 3WUWG 4LSSL 3RWIB 3VXMB 1JF6A 5EC2A 5KSAB 1EH9A 4P46B 4GO6B 4L8SB 4GBXD 1KPVA 5SWZA 1J1OL 5IVZB 1P53A 1TJHL 4RZCB 5KOMC 3S4SA 2Y5TA 1ES0B 1EV2E 3EJJX 4PRIB 4PP2B 3WIIL 4GG6E 4UIMB 3WFEL 1UWEH 4NQDD 2VKXA 4Z7VB 1KIRA 4ODUB 3MCKA 3TGXA 4PJDB 4QXTB 4RDQF 5I1DB 3VXTB 5KS9B 1TCRB 5EN2A 5L0QB 4L4VA 4HUVA 4G8IA 2DJUA 1MHPL 4MXWH 3F5WB 4M93C 2OXGA 5ACZB 1VFOA 4ONOA 4PRBA 5L6YL 2BHUA 2YPLA 4JO4H 2JTDA 5DC4B 1QKZH 3GJFH 4WV1A 5DJDB 3VWJD 5T3ZD 1JNHB 1I7TB 3ULVC 3UYRL 5IW1A 2AEIT 5T3XE 3BP6A 4AMKH 3V7AG 2WK2A 4XP4H 4TPRL 2C7UA 4U1MA 3UZQA 3QCTL 1C5CL 1K8IB 4ZTPH 3TPUA 5JZ7C 4D8PA 4LPVA 3OKLA 1PZUB 1YJDC 2OS7A 1M1SA 3H9SD 1C5DB 4MCYA 1I85C 4P99A 5AUMA 1MAMH 4ODHH 4HUWA 2J8HA 1P9MC 1U2HA 1F4HA 1NDMA 2ZUSA 3BHBB 3FB7B 2NY5C 1J8HD 4PB9H 5F7YC 5BS0E 2OBGA 2WBJC 4Q9BA 4HWEL 1EMTL 5E8DL 1TZHA 3QUZA 4WFED 5D9SB 1AE6L 4U1GC 3IFOA 3S5LB 1AXTL 2DKMA 3CDGB 4AIXA 1NFDF 2XT1B 2DI7A 5CZVH 3VCLA 4A6YA 1EPFA 4OZHB 1MFCL 5GJTH 1S78C 3OKKB 4OZFG 3G5ZB 5BCAA 4JFFE 3SQOH 3IJYA 2UZXB 4MA3A 4P9ML 3SDDD 2AJZA 1NGZA 2X4TB 2G9HB 2RHEA 4JDZB 2VLJA 4OZGE 2DQHH 2H6PA 1I1YA 3VFOB 3KWWA 1SY6L 2CDEA 2Z35B 3GJEB 1BJ8A 3VFVA 4JM2D 4FNLL 3HPJA 3FT4A 5D7LE 2FX9H 1ZA3B 3EFFB 1UB6B 3PQYB 4LKCB 3RVWD 1U9KA 3LEVH 4R4ND 4EDWH 5F7HA 1S5HA 5ICZA 4M6NL 2QADD 3TC9A 4GG6F 4XGZA 5KANI 4H26B 3MLTA 1N8ZB 1F3RB 4P2OA 3LB6D 4GQ9H 3DYPA 3VG0L 1TVBA 2YXMA 4XVTH 4JZJA 4ODWA 3NACL 1QNZH 3L3KA 1W72A 4QYOA 1FL6A 1L6XA 4NHCL 4XB8A 5IB5B 2ADGB 4O2CB 2YKLH 1A7NL 4CU7A 1OARH 5EG6C 2XACC 3CXHJ 4I18B 4YX2L 1RZ7H 5HDLA 1CD1B 1IC5H 4X7SL 1AJ7L 1ZA6B 3L5IA 2VDPL 1U8PB 5SX5K 1HKLL 1OPGH 2VN4A 4K3GA 3QUYB 5DC9B 4LP5A 2OLDA 4G8EA 3W81A 1EK3A 5CIPH 4AH2A 1QYGH 2AJSL 3JZ7A 4CVUA 1N4XL 5I15H 5JMOC 4U6XB 3BXNB 1U3HB 1T6WA 2H2PD 4BZ2L 3RDTD 2YUZA 5HBBA 2VLME 1F2QA 2E7CA 2MOVA 3VWKB 1JZ2A 1AC6A 4K2UL 1XIWA 1GGCL 2WZPD 2HFFB 1JHTA 3RWFA 4NQEB 2V17L 4NQSA 1FVCB 5C2BL 4YE4H 5F9DC 3VXMD 4XC3H 3WXWL 4HFWA 1CXIA 2EC9U 3IJSA 4JHAL 2V7HA 4PJ9C 1NFDB 3O9WA 5KSAD 4Z7NE 4P46D 4IDLA 5CSZA 1MCKA 3IAPA 4EXKA 4PRID 3SDAB 3L5JA 5HI3C 2AK1L 1NDGB 1XGRA 3SE3A 3BD3A 2ZUQC 5D1ZA 1BREA 3D69A 5FKPA 1CE1L 4GJTB 2E3VA 4XCFH 3T4YB 2NYYD 4XMLL 4K55A 1FL3A 2DKUA 3CDFA 3DI3B 3QFJA 1PZ5B 3BAEL 1P84K 4OZGF 4NFCA 5ABDE 1I75A 5F72S 4YIQB 4BQ6A 4JAMB 4WVRA 4GG6B 1U91B 2FJGA 1DEEA 1FN4A 2DM7A 5L2KE 2PXYB 4X7CC 5DUBA 3AB0B 4LSSH 4APQB 5T1LA 4HKZB 2OP4H 1L0XA 1G9EA 3BI9X 4AM0A 5SX5H 2F9BT 1RURL 1RULL 1T1ZB 5ERWB 3UAJC 3MLRH 5I76A 1Y6MR 4WWKB 2IBZX 3WFEH 4AQOA 4WW1A 5CEYB 4PREA 4R8WH 2EYSB 1DFBH 4WEUD 4GOSA 2EDQA 3LKOB 3ZKSD 4CU6A 1ORQA 4Y7MA 3UDWC 1OTTC 1EVTC 3O6MH 4R4BB 4DKFH 3ABZA 1MLBB 4G6JH 3IS0X 1MHPH 1OF2A 3HE7B 4N8CL 5DEGA 3FRPA 4HBQA 2R2BB 4P23A 1UJ3C 3BN9D 1BBDL 5BRZA 2H3NB 1X4XA 4OM0L 5EU5A 2BY3A 5ENWA 1OD7A 2DJSA 5TDOB 1A9EB 3BUTA 1S7VA 1TJGL 3PWLA 5BS0B 5E0QA 5GRYA 3ZLQC 1IGJA 4U0QB 2AXFB 4ZUTB 2ZNWA 5ALCH 1I8LA 1CD9B 4Z7NF 1BF2A 2NY6B 3TA3A 4WO4B 2EKSA 3LCYA 3PQYD 2QSQA 1OGAA 4JFFB 1EMTH 3NFPA 4LPXA 4Y16B 5HVHB 3QFDB 3BWAA 3MRHB 5FYKE 5JHDA 2X2YA 1AXTH 4E0RB 4OZGB 1ZVHA 4R90L 5IB1A 4RMSA 5D7JA 5ITBL 2GQHA 2NTFB 3MNZB 2W91A 3NPZB 1RHHA 4FOMA 1MFCH 5E8PB 4P2QE 1FFPB 4WI6A 3WIHA 4KDWA 2IGFH 1T0NB 5D7LB 5MI0B 4CN1A 5I16B 2AAVA 4M48H 4K7FB 2R1WB 4XPAH 2CRMA 3GMQA 3HI5L 3RTQC 5L8LB 4CJ0A 3KS0H 4G9DA 3QUYD 3CFBA 4NRXA 2G2RB 4MDIA 5GSVA 2RIKA 3ZE1E 2DBLL 3B8YA 3IXTB 4WFHE 1MCWW 2XWBA 1RIVH 3MLVL 5DRXB 1AHWA 1U3HD 4OCRL 5J6HB 4CMMB 3D0VA 4JFDE 4NN5C 3VG0H 1I4FB 3OJVC 3CVHB 4RA3A 3VWKD 1IGIL 2BFVL 1IEBB 3VG9B 1DQTA 1K5NA 1U8QA 4PJ5A 4NHCH 1FNEB 4NQED 5C3LD 3CDCA 1IEAA 2V9TA 4GUPB 1M05B 2Q7YB 4YX2H 3DUUA 2FWOB 1FZJA 1JRHH 3QIWA 4X7SH 4D0BB 1Z3GL 1R3IL 4YHYB 4O4YL 3MRLA 2VDPH 4NJAL 2YS4A 5E1AA 4DVRL 4HWNA 4JY4B 2IAMA 3SDAD 5IEKA 2DQUL 1RIUH 4NBZB 5C0AA 1DUZA 3MLSL 2WBKA 1HEZA 2P47B 4Y2DA 3C6LB 3VRJA 4U6VH 5EOQL 3AREA 4DAGL 4AENB 4LBEB 5JXEC 4ONHB 5F6HJ 4EN3C 5BZDB 5CP7A 1NEZA 4LLWA 5GS2H 2D4DA 4K2UH 2X1OA 1U8MB 3H9HB 1HILA 2JIXA 1YEKH 4ZG1A 3KPOA 3HNSH 4H5SB 4HLZH 5HTSA 2PXYD 2XTJC 1U8NA 3WUWA 3WXWH 4APQD 1A3RL 2YUVA 4K23L 3ZKMC 2IBZY 1FH5H 4M6AA 3QG6B 7FABH 3MYZA 3GSRA 2ADFL 1MCRA 1F4YL 4OLVL 1Q72L 3IDIB 2YD5A 5ICYA 4WWKD 5LXGL 5EUKB 1LNUB 2V5SA 5BXFA 2CLVB 1U8KB 4XPHL 3RA7L 5L2KB 2G60L 1CE1H 4LOUD 3HRPA 4RMWA 4X6DA 3U1SH 3ULUH 4PG2C 4W4OC 3AAZB 4OCLC 5D6CA 1KJVB 3RU8L 5T3XD 3WS6A 4BSVB 1FZKB 5IMLB 5GRVL 5LG1A 3HE7D 2ZNXA 1YEEL 3U7AA 5A2JH 4OGYH 3PWUA 2AABH 3GDBA 3ZE1F 4TVPD 1ZS8B 4WFGE 2FIRT 2YRZA 4ZFZA 2AJXL 3UPRA 4Y5YB 1TMCB 1ZHKA 2RQ8A 4NYLA 1Y0LA 5BJTB 1CXLA 1VFMA 5CGYC 2YPKA 1P7QB 1RULH 3FO1A 5CZXC 5GGRY 1I8IA 4WHTA 1LEGA 3O2WH 4RWYH 5CJXC 5BS0D 4UMGA 3K46A 4M5ZL 3K81A 5CJ5A 2UVFA 2QLVB 3ARBC 1Z0NA 5EBLB 5K93A 4JFEA 2BOBB 4XC1L 4IRSA 1ORSA 4G80A 3P0YH 1LDPH 3GI8L 1ZT4B 2NY6D 4GXUN 4WO4D 3WD5L 4PFEA 1OAQL 2X4RA 2FLBT 4O5LH 3CFDB 4ZXBA 2YWZA 4JFFD 4N8CH 3MOAH 4GXVL 3LRHA 4L4TE 4Y16D 3OG4B 1IVLA 4R97B 3U0WH 3VFTB 4FQQB 4JDTL 3BPOC 3FKUS 1BBDH 5GRXG 3WO4B 3MRQB 1S3KL 4DKEH 3ARUA 4OM0H 5JOEA 1JPFA 3GMPB 3T77A 1BVKB 1HINH 2PTTB 3WNPA 2FHBA 1C12A 3P77A 2CMRL 4S10A 2H32H 5D7LD 4OZFA 3EO0B 3KJ6L 1EEZB 1GL4B 1W0WA 4FG6C 3E1F1 3B8SA 1KJMB 5ESVB 2EIEA 2NW3B 4RAUB 4WU7A 3B2VH 4F57L 5GISH 4JGJA 1N7ML 3VFRB 5TDNB 1BVZA 3BDXA 3IDMA 4P2QB 2VDMH 2ZOLB 4KHXL 5F7KC 3BKYL 1SMAA 1NMCC 1FE8L 1UC6A 3PF2A 1XF4B 3ETBF 2J7LA 3W5NA 4HF5L 4U33A 1NBVL 5DLML 1VEOA 4EKXA 2XA8L 3PV7A 4ZO6A 5DK0B 4L1HA 2BSRB 3T2NL 4LQFH 2NY3B 4P4RB 2IG2H 4PYGA 3BO8A 1CQKA 1JPGA 2GITB 1YC8A 1ZHNA 2QQQA 1HIML 2X7LA 2X4UB 2H2SC 3I3BA 1M7DB 2H9GA 4MAUL 2E9WA 1RI8A 2ZZUT 4FFYH 2VLMD 4JFDB 2J6EL 3MGTB 3S36H 3BT2H 1VFBA 3P11H 2RFXB 4WDIB 5I1LA 4KRPC 2R0LL 5DWUH 3C6LD 1T1XA 3AFLA 2PW2B 4LRNH 3DHMA 4UU9B 1VADB 4ELKB 1RK1A 2QKIB 5F97E 2IH1A 1GOFA 1CDCA 3OKDB 1IGIH 3M1BB 2UY6A 4L4VE 4HCRH 3MA7A 3HB3D 1OOAA 4U6HA 3TBSA 3O6FA 3NBNA 3QPXH 5GRVK 4Z95H 3EBAA 3EZ8A 2FDBP 4HK3J 2YPLE 3S6CA 1UVQA 2NZ9C 4U2YA 3UTOA 3UPAA 2EYRA 4FQ2L 2B1AH 1WV7T 3HI1B 1RUKL 4NJAH 3REVA 4DVRH 1X7QB 3G5VB 3ZTNH 5K9KB 1F2XK 4MCZA 2DQUH 3OR6A 5LBSL 2EDTA 1HNFA 3SKOA 4LEOB 3UBXI 3MLSH 3EZJB 2ERJB 3ARSA 2D7OA 2QQLH 1ZKAA 4NZUL 2QBWA 2VH5H 4X4YA 2X9WA 5L2KD 2PYEE 3LN4A 3RI5F 3FN0L 3PNWB 1OM3H 1QTYT 3FQWA 3DRTA 4NM4L 2WWMC 2FHCA 3P4OB 1MFBL 1K6QL 2VXUH 3OXRA 3T3ME 1MHHB 1QLFA 5EFIA 1MIEL 2F5AH 1A3RH 1A9BB 4DZ8B 4K23H 4JFOB 1T04A 4AQ1B 2B2XL 4NZTH 1P7QD 2ADFH 5FM5O 1DQJA 1QSVA 4JN2A 1R3JA 2HYMA 5C07A 1MJJB 1QOKA 3K1KC 4PJ8A 4BFBD 4HUUB 4XPHH 4YZFE 3MSPA 3UYOD 4Y4HD 2R1YB 3EIFA 1UWGL 3FN3A 2L7UA 5F1SA 3BGMA 3TZVC 2NY0B 4WIQA 3RU8H 3IS1X 3TFKD 4P2RA 1YEEH 4JZOB 4GKZA 5IQ9B 1HHHA 5J6GA 1NGPL 5JTWA 2HVKA 2UZIL 5IWLC 5DUML 5D2NA 4OUUA 3SDYL 5EIIB 5TGBB 5HYEA 1B3JA 3GGWB 5J13C 1F3DH 5D7IA 5HHME 4LKXA 1KCSL 3VJ6B 3TCLA 4WI4A 1GYAA 5BVJB 3DUSA 2YA0A 1N5AA 5ETUA 1G7JB 4PRDA 5FYKD 1R3KA 1QP1A 4KROC 1BBJB 4LLVA 1MRDL 5JW3H 3GI8H 5HI4D 2V5RA 4WGWB 5IF0B 1V5JA 5D8JH 4ZSOA 4NNYA 4K9EH 4LFHG 4P2QD 4L1DA 4LDLB 4BFIA 2DTML 4GXVH 3RIAK 5I1CL 2ITCA 1PX3A 5L8JB 2EKJA 4UDTA 3VXUA 3B5GA 4TUOA 2EDYA 4PV9B 1TCMA 3NGBC 3LS4H 1AP2B 2NY3D 4AJ0A 4DFIA 3JVGA 1UH3A 1S7WB 2HVJB 3O3DB 2AQ1A 3OX8A 4F37F 4X80H 4PRNA 2QSVA 1DN0B 2NY4B 3MOBL 4WFHD 4ZUWA 1RU9L 5FCUL 4JPKL 4LAJH 4PJBA 2HTKD 3PDGA 1J1PL 5FYLD 5HHQA 4JFDD 4NZJA 2RCSL 2VLRA 5E5UB 3T3MF 3TBWB 1WBYB 1BOGB 2ZCHH 1N7MH 4DGVL 3W2DL 4MQ7B 2OK0L 2VXSL 5TDPA 3HE6C 4CVXA 5T5NF 4MQXD 5AG9A 4KHXH 3C5ZB 5H35B 1RAMA 3ZE0E 2EZ0C 5DTFA 5EC2B 2ZPKL 2EYTA 2FRGP 1NBVH 1N6VA 1KPVB 4P2YA 3QFJE 3VXSA 1NUDA 4XWOC 4KK9D 4YZFF 3BKJL 4MB5A 3WEXA 3N06B 3UC0H 4IIQB 1G0YR 5HXMA 5D1XA 1I1AA 4IOFC 4LNRA 1HIMH 1HWHB 2MHAB 4JRXA 3MCKB 1IAMA 5BV7B 1HCFX 4J7RA 3ZDZE 1OAYL 1IKNC 2J6EH 3U7WL 4XPTL 1T2QL 1BM3L 2EDLA 3G6DL 1HI6A 5DHVB 1S9XB 5EN2B 4L4VB 1CGVA 4HUVB 1U42A 2R0LH 3QH3B 1UZ6E 5H37H 4KRMB 4NC1E 5DRWB 2P5WA 1MFAH 1AR1C 1H3PH 2HFGL 2JK5B 3MNVA 3VFNB 4PLKC 1J5OL 3PJSB 2K7PA 4MXVE 4NQVA 1WEJL 4WW2C 2EXYC 4WV1B 5IB2A 2OI9C 3V5DA 2WWKO 4HC1L 4I1NB 3MR9A 3DSNA 4LU5L 4NO2A 1LDSA 3QUML 1DEDA 5F3HA 5CLTA 3O6KL 3ZYJA 4M02A 3U0PB 3D85B 4OCSL 5F96L 2PYEB 1RZKH 3MJ9A 5BRZE 5AUMB 4HQQL 2UY7A 4WI2A 1E27B 1GH7A 5EBMA 1BJ1H 1NDMB 2CDGA 3B6SB 2XZAL 4POZD 5FYJE 4QRRA 3NH7H 4NZUH 1F6LL 1TZHB 2EE3A 5GRJL 1PEZA 4WFGD 3GHBL 3IFOB 3C09B 4PJIE 3FN0H 5IGXH 1WVZA 3EYQD 1ZEAH 1J7VR 3VCLB 12E8L 1I9EA 1KN2H 2NY0D 4OD1H 1UT9A 2WIIA 3WNKA 1BZ9B 4KUCF 2DQTL 5E8NB 1K6QH 2YPVL 1CI5A 4ONFH 4WU5A 3D87B 4PLOB 2Z92B 1MIEH 4KZDL 1FBIH 3JWNC 4OQTL 3ZE0F 1A14L 4GLRI 2IFFL 3KWWB 4FQJL 5KSBE 2CDEB 3MNWB 3HNTL 3HPJB 3FT4B 5FIEA 8CGTA 1I7RA 4LHUG 1C1EL 4CU8A 5ICZB 3T2QA 4F7PB 4OGAD 2NXZC 4XGZB 3BKCH 3MLTB 4BZ1L 1HYSD 1YEFH 2OTPA 5C86A 2DLHA 2Z91A 4OTXL 4ODWB 2AK4B 3BX7C 1S5IH 1YEGL 1W72B 3QRGL 3ZDZF 4GW4B 5HHMB 1A0QH 3HFMH 4QTIL 4XI5C 5I8KH 3V2AR 2BP3A 3VFGL 3VXQB 1UZ6F 1NGPH 3IDNA 2UZIH 3HC3L 2CKBL 3H3PL 3F65A 2XZQL 4JFPA 1T6VN 5EWIH 4MXVF 4PJ5E 5KJRL 4G8EB 4RISL 1F13A 4IRJC 2CUHA 3TJHD 4AH2B 2CXGA 5INDB 2HTLD 4U31A 4N8VB 1NAKL 1V7NL 4YHIA 4LPCA 1G7QA 3NVQA 5EZJA 2DM4A 1CGTA 1YYML 4UT7L 3WXVL 4HXAH 1CDHA 3V6ZB 2LAAA 4N5UA 4LCUA 2EE9A 1JHTB 1WBXA 4N0CD 4NQSB 5KTEH 3C5ZD 1JI2A 3NOIA 1B2WL 3LRGA 4Y1AA 4HFWB 3IJSB 2V7HB 2O5XL 4AEEA 4QF1A 2OJZL 1UH4A 4OLEA 1T21A 4YK4C 5FO8A 2H8PA 4WHYH 5GZOD 4PJIF 2UWEA 3SGEI 1XGRB 5JQ6H 5D71L 1ROWA 3HZMB 3MOBH 1GZQA 1I85A 1RU9H 5D1ZB 5FCUH 1P9MA 1R5WA 1WLHA 5FKPB 1CLCA 3NA9L 1K3ZA 3DGGA 1FL3B 1SJEA 3M8OL 2WW8A 4I3GA 2RCSH 3QFJB 2FLRT 2AKRB 4L4VD 4KKBD 3U30B 4YDIH 3EYOB 3FMGL 3PWVA 2VXSH 5KSBF 1IGYA 1YA5A 1FN4B 2M8XA 5DUBB 3PHQA