2AJXL

Crystal structure of cocaine catalytic antibody 7a1 fab' in complex with transition state analog
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
216
structure length
216
Chain Sequence
b'DIVITQDELSNPVTSGESVSISCRSSRSLLYKDGRTYLNWFLQRPGQSPQLLIYLMSTRASGVSDRFSGSGSGTDFTLEISRVKAEDVGVYYCQQFVEYPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody 7A1 Fab'
publication title Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2005-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajxL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajxL01
3MV9D 4FTVB 2YPLD 1T1YB 3DSFH 4K8RC 3LKRA 4KKLC 2UVFA 4LASH 1LE5A 1P7QD 3I75A 2JE8A 3UBXA 4FQQA 4YHPB 1SEQH 4ZO7A 1CGXA 5D9SB 1HI6B 2DD8H 5D1ZA 5C0IB 4ZXBA 1WICA 4G8IB 3UTPD 3MV7E 4Q9BA 5I1HH 2D2OA 4ZQKA 1MJUH 2AK4B 1ZGLA 1T2XA 2OJEA 1MRFH 4TSCL 3WFZA 1NAKH 4L3EB 2X4RB 4LCWE 3VWJA 4TRPH 1NGYA 4QHKI 4LLQB 3TNNA 1KCRL 4JQVA 2ARJQ 3MV9A 4Q7DA 4UB0H 3RL2A 2Z0BA 1F00I 3B43A 1WCQA 1RMFL 4N5UA 1QBLL 1WISA 4XTRD 1JK8A 3U4BH 3U0PB 1DL7H 1SMOA 2VN7A 1P7QA 2YRZA 3GSQA 4HIJB 1R0AH 3RX8A 1D6EB 4Y2OA 3RWEA 2D0HA 3L3DA 4HPYH 5LAXA 2P5EB 5AAWA 5DXWA 5KTEL 2GSGB 4RGOH 3NPZB 4CMHB 2JIXD 4XC3L 4DKFL 3LKOA 3VH8A 3CD4A 4WVRA 4YFEA 1HWGB 2HKHH 4B0MM 1G7JB 4HIIB 3A67H 3WHXB 4F9PC 2AW2A 1DBBL 1F97A 3MRRB 4IDJL 4GG6B 1WZMA 4V1DB 1VKXA 2FD6L 1BBDL 2VE6A 1OP9A 1UACH 3GHEH 5DZLA 2C4FU 3WXWL 3MSPA 2ZUQC 1C7SA 4ZDHB 5ABDE 4NHUB 5HHPA 4DGIH 2PTTA 1LP9E 3CLEH 4GRWE 1XCTB 2Y25A 2H6PB 2DM7A 3OKMB 4GW4B 4LSQL 5EBLB 5CSZA 2W0FB 4GFTB 2JIXA 2D7TH 3RDTB 3MRMA 3W0WE 4E5XB 3HE7C 5C6WH 3Q6FB 2EH7H 4JFQA 4PFEA 3CFDB 4NQED 4ORGB 3DO3A 2F9BT 1H0DB 4PP1D 3DVNA 1T0MB 3OKLA 5SWZE 1FYTD 3VFRB 4A2LA 5D2LB 2ZZUT 3BH9B 1HQRB 3FQRA 4N0UB 3IXTB 5AD0A 3UZVB 4JM2C 4R7DA 5JW4N 5C92A 3SGJA 2WNGA 3KDMA 2AI0L 1INEH 4IOFD 1IAMA 4PJXF 2DLFL 3CVHH 1DLHA 1A7BA 2M26A 4OTXH 4HKJA 4M6MH 5EO1B 4RWHA 1FNAA 4MCYB 2LAAA 3RVXC 4NQEA 5CUSL 1DR9A 5DJZB 2CJUL 3ZYIA 3OR6A 4GMTH 1FYTA 5J56B 4Y7MA 4HGWB 2BNRD 3L5XH 4XWOC 5GGUB 5TH2A 5I73C 1JGUH 3PHQB 1RFDH 4PREB 5HYSG 4NPYB 1GZPA 1J5OH 4F58L 1BJ8A 3PWPD 1CXEA 3R06A 1MCCA 3VXSD 3RZWA 4KJYA 1XGQB 3I02B 5D7LE 3UC0H 3MBXH 3QUKA 1H3VA 1U2HA 4XNYL 3RWHB 2EYTA 1FNEB 3O41A 2XQBL 1HILB 1HH9A 3BRDA 2YHGA 1TITA 3G5YB 4TOYH 5KOVC 3SDYH 4YHOL 3HI5H 1OQOA 2P5WA 4XPBL 2PO6B 2BNRA 1M7IB 3D39B 43C9A 3S35L 3O81A 2HAZA 3GSVB 1VPOH 2RHEA 1GC1C 3WEXB 3PWPA 5DJCA 3MACL 1IAII 3LDBC 5F9OH 4L8CA 1BIIB 4JRWA 2B2XL 3TZVD 1L7TL 4ENEC 4PRHA 3H42H 1BQHB 3LPFA 5ACZA 4R7NA 3AFLA 3SE9H 5HGHB 3FONA 1CFBA 4WUKH 4P46A 4P49A 4CW1B 5C2UB 4F7CB 5L8KB 1QRKA 1ZT7B 3OJDA 2NY4C 5CBAB 1FG9C 2HFEB 1UADC 1VFOA 1QLFA 3MLXL 3VDAA 4DK6A 2ZCHL 4A6YL 4XCCH 3E6HA 5DD1H 2VWEE 4H20H 2GJ6E 4P2CG 1T66C 3REVA 2NR6D 1NLBH 3IF1A 2VLRB 2NXZD 2QKIA 1Z5LB 5KS9E 3L3HA 2I60H 3TYFB 5LVEA 3WJJC 4OKDA 2YXMA 4NCDA 3T77B 4EOWL 1D5MB 1NMCC 4S1SL 3C09C 3TPKA 4YEFA 4J3SA 3T8XB 4NO5A 2DQTL 1Q94A 4DEPC 1YUHB 5HJ3A 2FBOJ 4LQ1A 3F58L 4X99A 4D9LL 4DW2H 3B5HA 5CLWA 2BVOB 4G6KH 4YBLC 5BW7A 2EIDA 3MJ6A 5EN2B 4JB9L 2VQ1B 4MJ4A 1AKJD 1MFBL 1F4XL 5AEAA 3RVWC 5I1DB 3QIUD 3MA9L 3D69B 3N1PC 4JN1H 1V3JA 1MHPL 1UG9A 2DBLH 3BN9C 3ISWA 4CDHA 4UIMB 3BT2L 4D9QD 1S9YA 4XCNA 4JFXA 3AREB 5BMFH 1F4YL 3T2PA 2AK1H 4XAKD 4Y19D 1WUNT 4DTGH 3MLTA 3CSBA 5E70A 2DOCA 3HFMH 2H26A 3A6CH 4M6OH 4OLEA 1H5BC 2P5EE 4X9HA 2V5SA 2GI7A 1EAJA 2Y36H 1AKJA 5I19H 2P44B 2XA8L 1QACA 3C5JA 3V6BR 3QIUA 4PBXA 4L4VE 1WV7T 3TO4C 4MSWB 5FUZL 2VXQH 1JGEB 2WIIB 3WFDH 3ETBF 1KIPB 4M6NL 2H41A 2J2ZA 4Y19A 5FYJL 1HHHB 3OAZH 4IMKC 3T0BA 4U6XB 4KHTL 3ZDZF 3QCTL 4NBZB 4JPVH 3LRGA 4IDLA 4PJIA 5EUOA 5GSRA 5I1AA 3IVKB 2FX7L 1J1PH 3REWB 3BD4A 3T0ED 2RBLA 1XAUA 3P4NA 1FFRA 4X5XA 1JHTB 5D2NA 1IT9H 5MHSD 5L88H 4YAQA 1DQQB 4K8RH 5FOJA 4WUUB 3MUY1 5L2KB 2V7HB 2X4TB 3BKCH 4QHNB 3ZKNC 4BFIB 1KJ3H 5SX4H 2XTLA 1V3MA 4HWNA 2XZAL 4Q2ZA 4N0UE 4RFOL 2VDPH 3EDFA 3DJ9A 4NGHH 5HYQA 1TCRB 1MVUA 3AXLA 1DVFC 4G43A 3MOAH 3UX9B 1JJUA 3SCMB 3T0EA 2IBGA 5D1QB 5EFIB 3UJIL 5ACMA 3L9RB 2VLKD 4AIXA 2J6EA 3UTTB 2ZG1A 4HQQL 3QIBC 4H0IA 2RQ8A 4WFEE 2ZUSA 3Q6GH 1AGCA 5EDXA 5I1JL 3S97C 4LHQB 4ONHB 3GSOB 5KZCD 5J12C 2KPNA 4M43L 4JG0L 1MLBA 2BSRB 3DO7A 4U3CA 1FVDA 4NZUH 4HWZA 1LK2B 3ZMRA 4RMTA 5CKGA 4YGVA 3KLAB 3O3BB 2B1AL 3D0LA 5C8JB 4PJ9C 4OZHB 3VFUA 3M8OH 1AHWC 3IGAA 4PB0L 1VHPA 2VLKA 3AY4A 5HHXL 1IGYB 1UJTA 2HH0L 3WFHB 5DUBA 4CVXA 1P7KA 4L8DB 5IMOB 1HOCA 1XF5B 3VFOB 3RGVD 3FRPG 4OQTL 4DCQB 5IBLD 3H8NA 1RZ8A 5D70H 3P4MA 1T1ZA 3UTQA 3RUGE 2YD9A 1PY4A 5E24E 4UDUB 1FC1A 4GKOA 5MI0B 3IDIB 1X5JA 1IGCL 2ID5A 5GS1C 4J3OC 5JW4R 3STZB 3HZYB 3MQIA 2A2QT 5FK9A 3ALWA 3SQBA 4HV8A 4M1CD 4BUHA 5EO9B 3DURA 5HVFB 5C0RL 5E2UH 1MHHB 3QO1A 1HXYB 2A9MH 5DYOA 4M1GH 4KK6C 2BVEA 4WJ5A 1I9JH 4HBCL 3RGVA 3UAJC 2AK4D 1G6RL 2BVQA 1N7MH 5E4IA 4L3ED 5CJQH 2E5EA 2C3GA 1U8HA 3FZUC 3J8F7 5AYUH 5ESVA 3K1DA 5HI3D 5LBSL 5LGHL 3BVNB 1M05B 4R4BB 3V79C 2VLMD 1T1YA 4DUXA 3MODH 2A6JB 2QQQA 3FRUB 4YC2B 3PWLA 4YHPA 4HGMA 1G7MB 3C8DA 3HI6H 4G8IA 3SDAC 1NCBL 4D0CB 5MEOB 2AK4A 2D9CA 25C8H 5EZLB 1WBYB 2NY2D 4MA7H 4L3EA 2OMBA 2X4RA 3MYJB 4HAGA 1CFSB 5TE6H 5F89B 3QJHB 4K23L 4NFBA 4NZDA 2XI9A 4P2OB 3TJEH 1C5CL 5HBBA 1W72B 3U0PA 4LSSL 1K4DB 1UKTA 2P7TB 1D6EA 5ILTL 2DIJA 4MD0B 5BVJB 1TQBB 4HUVB 1EZVY 4DAGL 5J3HC 2VXUL 3FL7A 3I6GA 1LK3L 5L6YL 1R3LB 4OGAC 3OGOE 1D5XB 2YUZA 3RDTD 3AGVA 1L4IA 3QUYC 4XT1C 5K9OA 4P3DB 5FOBB 1GC1H 1HKLH 4XB7A 2A6IB 1G7JA 5ISZB 1OP5K 4WO4B 3WHXA 1D6VH 2OTPA 5FGCE 4LEXL 3MRRA 4GG6A 2RB8A 4WWKB 4OLWL 2A0LD 4I3RL 5AYQA 4EI6B 4JQXA 4GRLD 4ZDHA 5ACLA 4WW2B 3CAFA 4NHUA 1RZ7H 4PTUB 3QFJB 1XCTA 1U8LA 1F02I 2H6PA 3KPOA 3H6JA 1MREL 3LEXB 2W0FA 4E5XA 3RDTA 4FHBD 5I71C 5DEZA 4ZS6C 5T3XH 3CFDA 4NKIH 1OHQA 5EA0H 1T0MA 5LWYL 1EERB 3VFRA 4Y5VB 4KHXH 3RNKB 5D2LA 1RSFA 1P84K 3BH9A 3B2UC 1MCQA 1KN4H 3P77B 4WI9A 4GRLA 5DRXB 5GRUL 3ZLQC 5CD5C 3VRIA 1KELL 3EBAA 4NWUH 5KSAC 1ORQB 1NSNL 4KMTH 1TETL 1A64A 4WUUE 2I9LB 1W0WB 4GSDL 4HXBH 3UEZA 4LVHB 3MLRH 3FKUS 5EO1A 1JHKL 4NDMA 3JTSB 2AEWA 4MCYA 4Y0GA 4F33B 3SDDB 1CLZH 4UTAL 2R56L 4MAYC 5F72S 3MRGB 4HGWA 4KTEL 2OYPA 2PO6D 2HA1A 3H9YA 3D39D 5GGUA 4P5KA 4POZC 3PHQA 4PREA 3TO2A 4NPYA 3FB7A 1EFXB 1JV5B 3UTTE 5CJXA 2NPLX 1KB9K 3B8YA 4LLAA 4YDLB 3I02A 1XGQA 2HJKB 3FQXB 1RIHH 5KVFH 5IVNA 3KXFB 3NTCH 4G6MH 2FL5A 5IVOA 3RWHA 5F1SA 5IQ9A 3G5YA 2KQMA 1OAZL 4PS4H 5BZWB 3RRQA 4NRYB 4DZBB 1A3LL 2PO6A 2X10A 5HGBA 1M7IA 3D39A 3K46A 2AEPH 5HVHC 4PJXA 3GSVA 2X4UA 5IMLB 1KACB 1NL0H 1NUGA 2VLRD 1J86A 4JFFB 2QJDA 1G9MC 2AJVH 2X1OA 2X1XR 3JWDC 4K3DH 4PGEB 1BQHA 1MCOH 3EO9L 4KUCF 2X9YA 3F7VB 3PJSA 5HGHA 3VW3H 4CW1A 3PUCA 3TBWA 4Z7UF 5F96H 4F7CA 3MLZL 1WWBX 5HDQL 5JIIA 1X5ZA 1ZT7A 4O58L 5CBAA 2HFEA 1FP5A 4RDQF 5E5RB 1EHLL 1ERNA 4HG4J 2UYLB 2GTWA 1AIFB 2NY7H 4CN4A 2XTJB 5KSBE 3DTXB 1LDSA 2VLRA 3LD8B 1Z5LA 5H35B 1HE7A 1BIHA 3TYFA 4AQ1B 4ZXBC 1G1YA 1JZ7A 1MWAB 3LN4B 3T77A 4K07A 1EK3A 1D5MA 4K55A 5GZOD 1ODAA 3T8XA 3UTZB 3VWJC 1LEIB 2X7LA 3WUWB 1HYSD 4JQVC 3TBTB 3ARED 5TF0A 4GQPH 4U1HB 5DLML 1PYWA 1LD9B 4FXLA 1PQZA 3LKPB 4NC1E 5DC0A 1A7PH 4GXVH 4PGZA 3UZEA 3WIIL 4BSJA 3RVTD 3HCVA 2ADFH 5EN2A 3QPQD 2VQ1A 3DROB 3FOLB 1YEGH 3ARZA 4LAQH 3BMWA 2C4XA 1OLZA 5I1DA 3D69A 4Z0BH 5I1LB 1S9VB 5F9WC 1OLLA 3MJ9A 4APQD 3BHBB 3FT3B 4RQQB 4HKZB 1EDQA 1SYSB 3NACH 1FFPA 2HKFH 4X4MA 5GS2D 3AREA 5HYSB 4FQJH 5JOPE 4QF1B 3VFMB 3T4YA 4HK3N 4X6DE 4XTRC 3ZE1F 2CRYA 1UQSB 2YK1H 2F74B 4XMLL 3NGBB 4WENB 1M7XA 1J1XL 5E08H 2G2RB 1V7ML 2YXFA 1MJJB 3E3QC 5CMAA 2EDWA 4M5ZH 4MSWA 4MNQB 1JGEA 5T5NG 4EBQL 2ILLA 1KIPA 4WEUD 3O3DA 3WUZA 2O93L 5IB4A 1FN4B 3WMSA 1OP3K 1HHHA 4KROB 3QQ9C 1JUFB 5F88B 3KPTA 1YN7A 4K3EH 4TULH 4U6XA 3RI5K 1S7UA 5F7UA 3QFJE 1HK6A 4QHLB 3V4VH 1XR8A 3IVKA 5HVWA 1KNOB 5EU5B 3REWA 4NQCE 2FBJL 3SCMD 2VDMH 5I76B 4XI5D 3K4DA 1MIEH 3CPLB 5D72H 3BKJH 3BP6A 4JEGB 3V0AC 1JHTA 2YZ8A 2CH8A 1RJYB 3HRPA 5DR5H 4F80A 5DFWH 3I50H 1DQQA 1KCVH 5HDBE 5L2KA 1PGRB 3HC3L 1IGFL 1IC4H 2V7HA 2X4TA 3LPWA 2MNUA 5D71L 2YPKB 4QHNA 4Y8AA 1N0XH 1PKOA 2WM0A 3QUXB 5T3ZE 2Q20A 3VGDA 4XXCA 3HKFA 1WFTA 1IFHH 3SCMA 4XNXL 3H3PL 5EFIA 3MV11 1QOKA 1WIPA 1HDMB 3L9RA 4NZRH 1AC6A 3CXHJ 2D3VA 1F4HA 4IOFC 1E4JA 3MPCA 3CZFA 2DQCH 2AS5M 1C16B 1J05B 3UTSD 4U6VH 1E6JH 1NANH 4ONHA 3CCHB 1G7HB 3PDGA 1UM6H 3TH4T 1ZHKA 2CIIB 1LK2A 3QRGL 4X6CB 1T5WB 2R0KH 2QQKL 5JHDB 3KLAA 3O3BA 1KTDA 4MMZC 1R5WB 2B0SH 3QEUB 3U7WH 5C8JA 4BELD 4OZHA 2YD3A 3WL9B 3IKCB 5CCKH 5EBWB 1UCTA 3V4PH 1U41A 3VFVB 3NMEA 1MCNA 3DXAB 4MVBD 3U48A 3INUH 2X9XA 3S88L 1U3HB 4L8DA 4ESKA 5DVKA 5T5FH 4HF5L 1BOGA 1XF5A 3VFOA 3P73B 4DCQA 2HYMA 2P42B 4LDLB 4P46C 5CGMA 5I18H 4ZUWB 4CVZA 4UDUA 5IUSA 3IDIA 2GJZB 2VL5B 3I84A 3HZVB 4TVPH 4LRNL 4ZUTB 2HT4D 1EA9C 2EYRB 2AJUH 3HZYA 4W70A 1MCJA 1JF1B 5GRVL 4JFFE 3CFCL 3LS5L 4AM0B 5EO9A 3QAZB 5K9KB 3K7UA 5CBEB 5F6HJ 5D8JL 1N5YL 1UEMA 1I3VA 3CFJB 3A6OA 4LIQE 1WFNA 4RRPG 4J4PD 4RZCB 2JLLA 1JZ6A 5CSBA 1YNKH 5E6ID 4QHMB 3FQTB 2EICA 3KGRA 1IZJA 4U49A 2R15A 1BHGA 3BVNA 4F2MB 2D9QB 2XNAB 4HJJH 1JF6A 2ZOKA 1OSPL 3EHBD 3SJVD 4ZTPH 2A6JA 4DVBB 1UVQB 3SE8L 3FRUA 1T0NB 4OF8A 4YQXH 2A9NH 3PQYE 4LSTL 2NR6C 2Q3ZA 2FEDD 3FJTA 2CUMA 5C0DB 3OKKA 2YN5A 1L0YA 3WO4C 2EDHA 4J4PA 1TVHA 3I3EA 4C4KO 1MCPL 4D0CA 5MEOA 5FO8B 5EZLA 1WBYA 5E6IA 1WWWX 1LP9F 3MYJA 3ULVE 4QOKE 4GRWF 1LO3H 2VIRA 4UBDC 5FDWB 1CFSA 3U46A 1CLYH 3AAZB 5F89A 3QJHA 3I6KA 4HMDA 4P2OA 3SJVA 4NOFA 3GHBL 3GJFB 5B38G 1INQB 1W72A 3GIZH 4KY1H 1KIQB 4JDTL 2VLJB 2CKBA 1JGLL 1K4DA 1EEYB 2ZCLH 3U0WL 2OK0L 5E8NB 3IDXH 1ZOXA 2P7TA 1A6AB 1F11B 5BVJA 5H94B 4HUVA 2HMID 3OGCB 2O5YH 3JZ7A 3QIUC 5HDOA 1R3LA 2NW3B 1D5XA 2IANE 4TUOB 4FQPA 1KJ2L 1PEWA 1ZLSH 2KZWA 1MI5B 4P3DA 4GLRI 3MUJA 1PG7L 3EYSH 3ZYOA 2A6IA 4J3XA 5ISZA 3O3AA 4WO4A 3O45A 4TSBL 4WU7B 5EPMB 4ZAKD 3SKMB 3TCLB 5F3HA 1TJHL 3JWDH 3FO9B 1FJ1B 4LARL 4B41A 1GIGH 4M1DL 4JFOB 1KXVC 1WC7B 5IFJA 4EI6A 2CQVA 2WZPD 1X5KA 2DLGA 4TPRL 4MNQE 3OWEA 4DGYH 2R39A 4F7MB 5CKAA 3T2QA 1C5BH 2VQUA 5D2NC 5HHOE 5FUOL 4GW5B 4H8WC 2X1WL 1H8SA 3O2WH 5A2KH 3NH7L 4R8WL 4LCUA 1PJ9A 5DD3L 4ZAKA 5C0FB 1CLOL 1MFAL 4Y5VA 3RNKA 5FV1L 3BAEL 2IPTL 1JMXA 2NLJA 2EE9A 2YWYA 5DRXA 5DK0A 1QR1B 4GAJH 4PJBF 1AD0B 5MP6H 3T0EC 1ORQA 1JNNH 4AG4H 5J7CC 1B3JA 4X7SH 2I9LA 3L5HA 4N8PA 2G9HB 3UYRH 4RFEB 4CUCA 3KXFD 1NBVH 4HXAH 4WIQA 1XFPA 5JIKA 3L95B 5TFSH 3JTSA 4JRYD 2BVTA 4AENB 4F33A 1RVFL 3SDDA 1P69B 5T1KD 4PPTA 2EEBA 3E8UH 4ZOEA 5MENB 4IJ3C 5AWNH 1YJDC 5AZ2L 4D0BB 1X6NA 2W07A 3JSSA 4X5WB 1EFXA 1A6UL 5I1IL 4WI5A 1JV5A 1WBXA 2XRAH 1OARH 1C7TA 4C59B 2N1KA 2HJKA 3AY4C 3FQXA 4LSDA 5EU3B 3B83A 3HR6A 3KXFA 2VH5H 4PYHA 2DQUH 3UYOD 1DQLH 1A1MB 2C1OA 2WANA 3U4EB 4JRYA 4IRJB 4MQSB 4KXZI 2AXGB 4GT7A 4PJ7E 2WINA 5T1KA 2DN7A 4YDIL 4Z18A 3TIDA 1QNZH 4NRYA 4PJFB 4PJBB 4CNIA 4DZBA 4HWBA 3L7FB 3KLHD 4JVUA 3D85B 4X0KA 4HDIB 3DXAE 5IMLA 5IKCA 1G9EA 4U7KA 1MCSA 4Q9QL 2ZOLB 4XPGH 4PRBB 5IK3B 3F7VA 3RGVC 4MA3B 4X83A 5E95B 1CVRA 4X9FA 5I15H 2YUWA 4DN4L 1MHCA 4M48L 4JCMA 3MLYL 9CGTA 3PP4H 1D5IL 2Q8AL 2DDQH 2DWEB 4XAWH 1OW0A 2UYLA 1RAMA 1AIFA 1WAAA 1XF3A 3EGSA 4CDGC 2VAJA 3L3IB 3HRZB 5FHBL 3DTXA 2OTUB 3T0AA 2ATKB 3MJ8B 1N5AB 5H35A 4CGTA 1MWAA 3LN4A 4OLXL 2HT3D 1QP1A 1BFOB 4JO3L 3X3GL 4PJ5B 4R4ND 2OXGA 2X5PA 4AIZA 5HI3C 1LEIA 2XWJB 4LLVB 5HHNA 3NN8B 3TBTA 4N1EA 1NLDL 1UZ8B 3C60B 3VWKD 2QHLA 1RZKH 4U1HA 3NA9L 1B9ZA 1LD9A 2CDFB 3T0WA 5IF0B 4UILL 3MJ7B 2VKWA 5CJOL 1G9ML 1VGEL 4HUKB 3RZCD 1JPSL 4P3WA 4BJLA 4PV9B 3FOLA 5EU6D 2HG5A 4OCMC 2E6PA 2F58L 2Y4SA 5F93C 3B3IB 1CFNB 2DWDB 1S9VA 1I3GL 2DQGH 3QNZB 3ARPA 4CMHC 3BHBA 3CNKA 3FT3A 4FFYH 4RQQA 4HKZA 1FZMA 5L8LB 2ZKHH 2R0WL 4FQ1L 4MAUH 3LEYH 1LHZA 1VCAA 5HYSA 4P2QE 3DV6B 1N6UA 2X4SB 3W39B 3VFMA 4KROD 4FG6D 2HRLA 3ARWA 3ALPA 4QWWC 2F74A 1RURL 4KJPC 3RZCA 6FABL 4JQXC 5EU6A 1FYHB 4WY7L 1MJJA 4AEHL 5IFAL 2C9AA 3UPRA 5F1KC 5DS8B 5FM8A 3RNQB 4ZUVA 1QYGH 1JBJA 1MJ8H 4QRPD 2OR9L 2FB4H 3RDTC 3P9LB 2I5YH 2IBZY 4J3WA 1FN4A 2DMBA 2V9TA 3L1OH 3MRQA 2Q6WA 1ND0B 2GY7B 1YQVH 5F88A 1JUFA 5EG6C 1OT1A 4FQLH 2R1XB 3GZKA 5C0GB 1CTOA 2DBJA 2A0LC 1T7VA 4QHLA 5EU5A 3DMMB 1RIUH 2IQ9L 5IVXB 5C0AE 3SE3C 1V7NL 3F6IA 1RJYA 4QRPA 5J9PB 3O9WD 3CDYA 4YXLL 5JR1H 3NZ8B 3QCUH 2YPKA 5JLZB 3BDYL 2HN7B 35C8L 4UAOB 3W5MA 4CN1A 3MFFA 2EDOA 3SOBL 1L9MA 3N0PB 4Q6IB 2ARJA 3RI5F 3RUGF 4L3CB 3E6FB 5GRJL 2FWOB 5JHDD 2OZ4A 1I8IB 3MRPA 1FO0L 1YEHH 1LEGB 4UMGA 3VXUB 1FGVH 5ID0B 3LIZH 4OCYL 1OGAE 1QFWL 5CJXC 1HDMA 3MTRA 5MEPB 1K8DA 5AUMB 1SQ2N 3IU3A 1UM5H 3O9WA 4OCSH 5IBTH 1J05A 3ZTNH 3VE0A 1I1AB 3R1GH 1VFBB 2VZUA 4BUGA 1OAQH 5T5NF 3CCHA 4P9ML 4BH7B 3FB5A 4HPOL 2RFXB 3V52H 4XB8A 3V6ZA 2CIIA 1KN2L 4X6CA 1T5WA 3VG0H 2ICEB 2PO6C 5JHDA 1LGVA 5J8OA 1R5WA 3QEUA 4BA8A 3G9AB 2B4CL 4UV4H 3WL9A 3ULUD 3VFVA 3EOTH 1G1CA 1XGYL 1T1WB 1KTLA 1YEIH 4JFYA 4RA0C 1T7WA 4WW1A 5E9DB 4ELMB 1Y6NR 1T04B 4PRPB 2Y5TB 1T2QL 3HG1B 4ZUWA 3OKDB 5CZXD 1A5FL 4ODTH 1KFAH 2L4OA 2Q3AA 2GJZA 2VL5A 4NJAL 4YX2L 4OAWB 4ZUTA 4ZNEE 1FRGL 1JRHI 3CSPA 1JF1A 5CIPA 1KLGA 1J9CT 1NFIB 4PUBH 4AM0A 2HLFC 1IBGH 5K9KA 5BVPL 1MLCB 3HS0B 4YDKL 1BAFH 1TTGA 2WV3A 3CFJA 3T1FB 3SQOH 4N9GB 3QDGB 1XF2B 4YHLH 5D7JD 4QHMA 3FQTA 2A1WL 4OLZL 3X14B 4HUXB 2D0FA 4LRIA 4F2MA 5JXED 5GZND 3FO0H 4U0QB 1E6OH 4FQCH 5TDNB 3UJJL 1FIGL 1HCFX 5FXCH 4DVBA 2J6EH 2VDQH 3JWOC 3MLWH 1T0NA 2PKDA 1RK0A 5ETUB 5CINH 5LGJB 5C0DA 4RMQA 1ZV5A 1FDLH 4PLJD 4U4BA 2AJSH 5D7JA 5FO8A 1U8QB 3IDYB 3QI9B 5DHYA 4WI6A 1FL3B 2N7BA 5CZKA 2X89D 5FDWA 2DJSA 3AAZA 5JXEA 1MI5D 2R2BA 5IOPB 2YA1A 5C7XL 4JANB 4TUKH 4EXPX 4Z77B 3AREC 4I48B 2ZJSL 1JWUB 1MQKL 3ZL4H 1INQA 4X6EB 3V8OA 1XIWB 1KIQA 1S8DB 4RGND 3EYOB 1R6VA 5E8NA 4G6FB 3U0TB 2DMCA 4MJ2A 1A6AA 2MCG1 5CAYB 4XCEB 3RVTC 1F11A 1ITCA 1EAPB 3QPQC 5CEYB 5E99L 3GEWB 5ERWB 5H94A 3QCVH 2R4SH 1T21B 2D7TL 4HS6B 4S1RH 1WBZA 2DJUA 2X89A 4P2YA 4AL8H 4LDOB 2DF3A 4F9LC 1ZA3B 1MI5A 2XKUA 4M8QB 3KPSB 4U1NB 4Z76B 4I5BB 4WU7A 4LSUL 5EPMA 3TCLA 2UY6A 5KAQG 4WTZG 1FJ1A 3S37L 1E4WH 3SKJH 4JFOA 1WC7A 4XP5H 4PJDE 4WGVB 3FRPA 3G6JB 2D31B 4UQ2B 2QLVB 4F7MA 15C8L 5FB8B 2DI7A 2R2EB 1BFVL 3LKSA 1U8JB 1AO7E 1CFVH 4GW5A 3SGKA 3IAPA 1NCCL 3MMEB 1CCZA 4JO2L 5F9DC 5CWSA 3BWUC 2HLAB 1FORL 3EYVB 2RCSL 2DKUA 1P7HL 1N4XH 1I9IH 3WFBH 5C0FA 3U82B 1OTSD 3QHFL 2QSCH 5C0EB 5MEND 1GGIH 1YDPB 4R2GD 1YC7A 1NFKA 4QXGH 1ADQH 4A6YB 5DO2D 5IVXE 5FYJU 4NZTL 4I1NB 2GK0B 1QR1A 3SCMC 5D7LD 5D1QC 4XI5C 4G80A 1GPOL 5C6TH 1BZQK 4C4KT 2IADB 2G9HA 4ZFZB 4RFEA 3UPCA 5DQJA 3H9SB 5J6GB 3L95A 3NCYP 3AS0A 4BFGA 3W2DH 4JZOB 3W9DB 4AENA 1A7OH 3HI5L 5GIRB 4EUPG 1G0DA 4Z7OE 4XPTH 3O4LE 5C2BH 5MENA 4PGBA 1VPOL 4OCXH 5TQ0L 4X5WA 3BFOA 1FBIH 2JCCE 4MZ3A 1FL6B 5KSBF 2FO1A 3NAAL 4NN6B 2W1NA 2DQJL 4H8WL 1QLEH 1A1MA 4BFEA 5HY9B 5B38B 5T1MB 1GJIA 5C86A 3DYOA 4ONFL 1YYML 3HNTH 2FH8A 1H8OA 3VXPB 2V5MA 1FHGA 1M71B 1MEXL 4PJBA 1UFUA 4PJFA 5MI0C 3OHXB 3L7FA 1JHLH 3AS1A 2GJ6D 5IESL 5ID1B 4HDIA 1CBVL 3HLAA 1XZ0B 1DEEA 1EEUA 5ENWA 3IXAB 5C70A 4MVBC 2ZOLA 2W9DL 1UA6H 4PRBA 3K2MC 3K2UH 1KEMH 4MA3A 4BKLA 1FH5L 2EH8H 4PJ5D 2F5AH 1N2RA 3RIFK 2X09A 3I6LE 1G0YR 2J8UB 1YJDL 3R0MA 2Q8BH 4KI5F 4AH2A 3C60D 2HT4C 5I0ZA 4N0YH 3ARBD 1IM3B 4P3CH 4WNQA 5E8OA 3HRZA 2J7LA 1ZLWH 1B6UA 4YC2C 2ATKA 3MJ8A 1JVKA 1OWRM 4X6DF 4LCIL 1L7IH 4UOW0 2AXHA 2BVPA 1WEJH 2H1PH 2MQCA 4WTWA 4J4PC 4KRPD 1IAIH 3OB0H 1BFOA 3ES6B 2B1HL 4JKLA 3EJJX 4XBEL 4PJ5A 3WDJA 4XNQB 1T03H 5DF0A 2Z93B 2XWJA 1J0JA 4LLVA 4R9HA 3S9DB 3QSKB 2VXSL 4NKQB 3EHBC 4P2OC 3C60A 3CXDL 5J57B 5M95B 5TE7H 3QQ3B 5HD8D 4G9FB 3R8BB 2VZTA 5IF0A 2JELH 3MJ7A 1IQWH 3NABH 2GQHA 5EZOH 2Y36L 5E2WH 5JZ7D 3O2VH 4PV9A 4LKXB 2EDJA 1TQBC 4L4VD 4J3UA 3BXNB 4WHYH 1CICB 3B3IA 4OF6A 1CFNA 3VRJB 5GS0D 4FFVD 1GHFL 4JFPB 4DN3H 5HDBF 3DV6A 3QA3B 4WO4C 1MIML 2X4SA 1DBAL 4L5FH 1IMHC 3L3OB 4LPCA 2EXYD 4W4OA 2ORBL 4O02H 3FN9A 2IC2A 4PR5A 4YE4H 3SGEH 1LNUB 3QNXB 1ZGLM 1EHXA 2HMIC 2X70B 2ZCKL 1B0GA 1TPXC 5DS8A 3RNQA 5L88L 3MRIB 3LV3B 4NCC1 5I1GL 5JNYB 5J1AB 2NY6B 2B39A 3GI9H 1F90L 1OQXA 1I85A 5GS3A 3QRFM 4GUPA 4PLNC 1CS6A 2JJUA 3JV6B 1IKNA 4UINH 1CI5A 2J8HA 4Y5VC 5HHMB 2R1XA 3D3VB 5CEZD 4FMKA 5EBMB 5C0GA 5DMGD 1YEEL 3P9WB 3PL6B 3HC4H 4WDIB 1N8ZB 4U1SB 3VXUD 4QKXB 1VADB 5LCVL 2D03L 4A2MA 3L3KA 1UENA 1J11A 4WFED 3O6ML 3DV4B 5ANME 2F8OA 1RHFA 4LVHC 4OF5A 5IB3A 4Y1AE 1G6RB 1FSKB 4OSUL 3JWOH 5JLZA 2HN7A 3QDJB 2X42A 3SDDC 4HIXL 4FMFA 4Q6IA 1HIMH 3V5KB 3CJJA 4L3CA 1J0KA 2FWOA 1I8IA 5D7IF 3QHTC 4JY4B 3VXUA 1LEGA 5ID0A 5KANI 3V2AR 12E8L 2R4RL 4BSWB 5FECA 4GKNA 1YEDB 4YDLC 3MRBB 4TUJA 5AUMA 2B5IB 2QSVA 3B4NA 1K8IA 2MTPA 2YC1B 4HFUH 4OV6F 5DWUL 4HG4K 1NC2B 3HG1D 2RFXA 4IS6B 3GNML 2BJML 3VXOB 2GCYA 5D5ME 1UEYA 1UYWH 2ICEA 1B4JH 1N64L 3JXAA 1OPGH 3G6DL 4YH6A 3LQAL 2Z35B 4HZAA 4NP4H 3NA4A 2A9ML 1UB6B 4FFWD 4YEEA 3BZ4B 1DBMH 5FUCC 3MNWB 5E9DA 4ELMA 4Z0XB 1X9QA 1T04A 3QDGD 3L3JB 2VDRL 4C83B 5AYUL 5EZIH 1ZHNB 4UU9B 1FNFA 1IARB 3HG1A 3IETA 5D7IB 2QR0B 3CMGA 3MRCB 3ULVF 4BQCA 4OAWA 4QXUL 3M17B 1OW0C 3BP7B 1MPAH 3HAEB 2FEEL 3KLHC 7FABL 2XTJC 1NFIA 2ZG2A 5IR1A 4ZSOE 3P3YA 4FQXB 1CF8L 3LD8C 1MLCA 1S7TB 1HHKB 4S10A 4JZNB 4N9GA 1U8OB 3QDGA 4NKDA 2PXYB 4NNYB 1XF2A 1RUPH 4NQUA 3V6OA 4NWTH 1KPUB 2ADIA 2ERJB 3MX0A 4KVNH 1QEWB 4PRIE 5KVGL 3X14A 1Q72H 2J8UE 4GRMA 4LGRB 3FN0L 4NUGH 3ZHLA 3IFLL 4JJHA 4HUXA 4EQ2A 4MGXA 3U1SL 4JG1L 5FYJE 3C2AL 2OJZH 5EULV 1PSKH 2XN9B 5JOEA 1AE6H 5I6XB 2IMMA 2AV7B 4NM8L 4G6FD 5EIVA 1AQKH 5ESQB 5ETUA 4JPWH 5LGJA 2OL3A 2FSEB 3GI8H 2HT3C 4JDVB 1U8QA 3HB3D 5D1XD 4X9IA 1FL3A 4KUZL 4I8DA 4NQDD 2F54B 4OD2A 1MF2L 4J6RH 1DQDH 3Q5TA 4YHMH 4P5TB 3WLBB 1A1OB 2R9HD 4PG2C 1IE5A 3MXVH 1LO5B 4LL9A 5A1AA 4JANA 4Z77A 1SY6A 1JWUA 5JW4M 4X6EA 3OKNB 1N59A 1S8DA 2J1KA 3EYOA 3U0TA 4JFEB 3ARYA 4KAQL 3PP3H 5KVEH 1EAPA 3NGBC 1H3PL 5CEYA 3VG9B 2VITB 5ERWA 4NM4H 5SX5H 1ZA6B 1T21A 3TT1L 2R29H 5D1XA 4OZGE 1KC5H 4NQDA 3H9HB 3B5TA 3HE7B 5DDHA 4PRDA 4I18B 4HUWB 1ZA3A 4M8QA 1SMAA 1MRDH 4HLZG 3U6RB 2WIMA 4U1NA 4Z76A 5EA0L 4I5BA 3ILPB 1W0VA 4JPKL 4KROC 4JHBA 4FG6C 4OCLC 1FE8H 2E6JA 4HGKC 1J87A 4JKWA 5B39G 2AGJL 1H3GA 5C07B 2D31A 2I9TA 4UQ2A 4DVRL 3L3GA 3D0VB 1ZAGA 5FB8A 3MJ9L 3Q3GB 2L7UA 3LY6A 3CC5A 1A6VL 3MXWH 4OGYH 5E8EB 2HLAA 4OM0L 3EYVA 1OTTC 5L2JB 2PN5A 5FYKL 1EPFA 4FZ8H 4EIZC 5C0EA 4PJ7F 4DJMA 5I73B 4YHZL 4A6YA 5IG7B 2X2YA 4RRPA 3WSQL 1N6QL 1FG2B 2GK0A 1IGJB 2Z31B 3LQMA 5H2BB 4G5ZL 3U30B 2H32B 3VFWB 43CAB 2R69H 4I2XB 5HYJB 1TTFA 4B5EA 4ZFZA 4TTDD 3O9WC 3PHOB 4JZOA 4TYUA 4RSVA 3T0VA 3W9DA 2DLHA 1CD1A 2CK2A 4XX1E 5ALCL 5TPWL 1C1EH 2MCPH 4MA8H 2NMSA 2A6DB 3P0YL 3QUMA 1IM9D 2EDQA 3H7BB 3P9MB 2HVJA 5HHVL 1WTGT 4BZYA 3AU1B 1F8TL 5FF6B 1AJ7H 2E9BA 4K3DL 5E8DH 2ICWI 4K7PL 3TESA 4KKCC 1K4CA 1CQYA 2GIYA 1U3HC 4HMCA 3QG7H 4XP1L 4RWYL 5HI5D 3EDDA 1YY9D 5JQ6H 5HY9A 5B38A 5T1MA 3VGAB 3CK0H 1MCWW 2NTSP 3VXPA 1M71A 1IM9A 2IALB 4MJ6A 1RUML 3OHXA 1BVZA 1BOYA 2IF7A 2C7UA 5JPMB 1LQSR 2NQCA 1XZ0A 4MD5B 1Q0YH 2R2HB 4LVNB 3ULUC 4LF3B 4OFKA 1HH6B 3IXAA 1EVUA 3QAZC 4NHCL 3CH1A 5C0BE 1VENA 4YIQA 4OIAA 1WIUA 2GTZB 1NMCB 1IC5H 4Z7WB 1XF4B 1IEBA 1YEKH 2VDLH 2V17L 3Q48A 1NBYB 5JQHC 5DFVD 2R0ZH 5E1AB 3LSOB 3D2UD 5T3ZH 5DJXB 4LRIC 4YHKL 2UZYB 5KSBA 3E2HB 3ME0A 4J8RB 5IEKA 3BQUD 1IM3A 4G9FD 4YUEH 1D9KD 3G5VB 5SV4A 3SN6N 4YHYC 2PTUA 3F5WB 4C56B 4Z0BL 3LRSB 4O4YL 3QPXL 2EZ0D 4KI5D 3WCYA 3ARFD 2Z93A 4KK9D 3RIFF 3D2UA 3OKEB 3NCJL 5JXEC 5GZNC 1KCLA 4GBXD 4NSKB 1U8NB 3QQ3A 3BQUA 2OXHA 4G9FA 5BRZE 4YR6A 1NBQA 4O2CB 4TVSa 1A14L 3ZKXB 3CUPB 3QEHB 1H5BB 2GY5A 1KG0B 3EOAA 4LKXA 3TIEA 3WS6A 4OCRL 4PLJC 1R3JB 4EDXA 5DRWA 1Z9MA 5FA4A 2JJTA 5FFLA 1ED3B 3ARFA 3IFNH 2H9GB 4JFPA 3MOBH 4K2UL 5BQ7B 4GBXA 2C3HA 1MY5A 4TULL 1I3RA 4JZJB 4RGNC 1MRCL 3L3OA 1QRNE 1C8PA 2CMRH 3O4OC 4NYLA 1OCWL 5DEGA 4NQCD 2BSSB 2PNDA 5FYLL 4LIQH 1LNUA 2P8LA 3QO0B 3LS4L 4AEIH 1GGBH 2X70A 2HTLC 5IMMB 1B90A 3UJTL 1RZJH 3LV3A 4J23A 1KCVL 2BNQE 2K7PA 4KQ4L 3RL1B 5KSVA 1NEZG 2NTFB 5J1AA 3SGKC 4OQTA 2HFFA 4YFLI 1U8MB 1MCLA 2A83B 4I77H 2Z92A 3QDJD 1EZVX 3JV6A 3VGGA 3AS3A 5J11B 1Q0XH 2CKBL 4MWFB 2OQJA 4MJ5A 3D3VA 2OR7A 3M1BB 1A0QH 1UH3A 5IB1B 5DVNA 1MFCL 2DRUA 1N8ZA 4LCYB 1VADA 2ZNXA 5LGKA 4L8SB 2JB5H 5C08D 3HPLB 2VSCA 2APWA 3KYNB 3QNYB 2LAGB 5GGQL 1G6RA 4JQIH 4U1GB 2DQEL 3QDJA 3B9AA 2CO7B 3VMNA 4Y4FB 4YK4B 3VXME 3WIHL 2V2XB 2W92A 2UWEB 3V5KA 1OTSC 3P0VH 3EYUL 3BN3B 3NZHL 4X8JB 1VFUA 2B20A 3DI3B 3OTTA 4JRXD 5C1MB 1CDHA 2F5BH 4BSWA 3SPVB 2AXFB 5C08A 2XZZA 3KYKL 3MRBA 4NO0D 1FCGA 5K59E 1P4BH 5D96B 3NCYS 5EC2A 3V0VA 3X13B 4HC1H 5DUPL 2VISB 1I3UA 1MVFA 3B9KB 5DT1L 4CL7A 3GKWL 1ORSB 3KR3L 4IS6A 3S4SG 1R5VA 4TVPL 3VXOA 2JKXA 1GGCL 5K9QI 1DLFH 3P0GB 3N9GL 4HJGA 2FGZA 1TJGH 2APBA 2PYEB 2YS4A 4JRXA 4M5YH 2NY1B 3PIQA 3ZKSD 2IJ0C 4PB9H 4BH8B 1KGCE 3TT3H 1UB6A 2ED9A 4NO0A 3BZ4A 3T0XA 2FIRT 3MNWA 3G5ZA 2WP3O 4N5ED 2JJSA 2WW8A 3L3JA 2VDOL 1ZHNA 2A77H 4W81A 4AMKL 4UU9A 1IAIM 3D18B 5KANG 5D7IA 3TBVB 3MRCA 4KJWD 2BY3A 1KJ2B 4KZDH 4PJEF 4L4TB 3B6SA 3BP7A 3HAEA 2ZUYA 4AIOA 2W9LA 2A9NL 4MNHB 4JHAH 1LEKA 1S7TA 1HHKA 5ESAB 4JZNA 1EBPA 1U8OA 3ARRA 3I3DA 4TQEL 3ULVD 2BY0A 1CFTB 1KPUA 2EIZB 3ZTJG 1QEWA 3GFUA 2F54D 1NMAH 4UV7H 2OZ4H 4P5TD 1FV1B 2QL1A 4HWBL 4Y16D 4JCLA 3C60C 5DD0L 1S9WB 2XN9A 4E41B 2OP4L 3KPRB 2P8PB 3QUZB 3TBYB 1IILE 4JFED 5ESQA 3RWDB 4FP8H 2FSEA 1N3NB 4CN6A 4DWHA 2CRIA 1KUMA 4JDVA 4L4JA 4KRPC 4IIQA 4PJEB 4FZEH 2DQDL 1BF2A 1RULH 2F54A 1OM3H 3BZDA 3OX8B 4K9EC 3GBNL 1LO0H 4P5TA 3WLBA 4OB5H 1A1OA 4TN9A 1XCQB 4Y16A 1NMBH 3D6GA 5HD8C 1BF8A 4JFEA 3LOWA 3F62A 3QDMB 4W4OC 4GAGH 1LDPH 1MWAL 2VITA 5C07D 1RI8A 2OM5A 1A4JA 5I1EH 1ZA6A 1ZHBB 5DQDH 5T33L 4Z78B 2X4NB 4XMKL 5DK2B 3H9HA 5GS0C 4I18A 3SKUD 3DSNA 4FFVC 4HUWA 5FEBA 4MXWL 3U6RA 1K3ZA 1BLNB 1IZKA 1EO8L 1I85C 3F12B 4OLUH 5CGYC 3U2SB 3ULUH 5CP7B 5JUEL 4X9GA 4OM1H 5I1KL 1QA9B 1A1NA 1LWRA 1S7RB 3GSNA 1AXTH 1EMTL 2EXYC 3ET9F 3GRWA 3NFSL 3OG6B 4U1JB 1A7NH 1I8MB 4OD3L 5KSAB 5C07A 1JPTH 5D6CB 3PHSA 2Z31D 3KG5A 3WD5L 3D0VA 3DMMC 4LOUD 3H0TB 3WHE0 2JCCF 3OAZK 1QD0A 3BUTA 3Q3GA 5AG9A 2XOTA 5DHXB 1FCCA 4AK1A 2W65A 5E8EA 1WZ1L 4UT9H 2DB8A 1AFVL 1KENL 3CIQA 1RUQH 5JORB 5JOFB 3RHWK 4UAOC 1OY3B 4Y5YB 2FX8H 3LMJL 1BP3B 4I0CC 1Q9WB 2ED7A 2K9UA 3NCCB 4OCWH 4Q6IC 1FPTL 1CXHA 3B8SA 1J8HB 1IRAY 3S5LB 2WWKT 5DMGC 1FG2A 2Z31A 2GFBB 3TV3H 3PGFL 1JTPA 3QWOB 1WT5A 1MOEA 1P84J 5H2BA 3RP1A 3IFOA 1J88A 1W2KT 3VFWA 43CAA 5HYJA 4I2XA 4PGJA 4GG8B 4W6WB 3OL2A 2BRRL 3PHOA 3GJFH 4JFDB 4ZD3H 1I1RA 4QHKJ 3TPUB 3S8WA 1VEMA 2BERA 4LP4A 1ZEAL 2XWBA 5TQ2H 4D0DB 4R3SB 1YNLL 1JFQL 3CFEB 3RJDA 4Z95H 4ISVB 1BQLL 2A6DA 32C2B 4XVSL 4Z7QE 2BRQA 4KVCH 4JY6A 1EVTC 4PJCE 5C0CB 3AU1A 3DRTB 1B0WA 3PXJA 3T1WA 1ZVYA 5FF6A 3QHZL 1UCBH 4MS8C 4E0RB 1F6LL 3MLSL 3JTTB 3CZJA 1KB9J 1TVDA 3VJ6B 3WFCH 5I15L 1DEDA 3T4AB 1IAOA 4JN2B 1T20B 2VERN 4WI2A 3PDOA 1G9NH 1XF1A 3CSYB 1QO3A 2XZCH 5KW9H 2X4PB 5JPMA 3MREA 3KYOB 4MD5A 4XZUA 2NCMA 3PWJA 4LF3A 1S7VA 1B2WH 4FFWC 3TWCL 5D1ZB 2F19H 4HK0A 4ZQKB 4LPWA 4XGZB 2CLVA 4OV5A 4Z7WA 3V6OC 3N1MC 1JP5A 1NBYA 3OJMB 5E1AA 3C5SB 3TNNB 3LSOA 4OQ1A 2O5XL 4C58B 4KKBD 4G6JH 2AEIT 2YPLB 2AABL 2Q76B 4XMPL 4OGXH 1C08A 1P7QB 5C71A 1GL4B 3GSQB 4BQBA 2WUCL 3G5VA 4NNXA 1MAKA 3RWEB 3IDGB 1E4XL 2CUHA 3L3DB 5LAXB 1NFDE 5E2TH 2I26N 1U8IB 3IDYC 1AI1H 3BPCB 1NGQH 4JFHE 2RAMA 3UBXI 1QBMH 4N1CA 1BVKB 4P2QD 1HCVA 1YPZF 5HI4D 4YLQT 4NSKA 4BM7A 5KVDH 1ZTXH 2PUQT 2M1KA 5BOZG 1UM4H 5J13B 4OZIB 5FKPB 2VE6B 3CUPA 3QEHA 3GJEB 1JNLH 5JXAL 1KG0A 1DQMH 1FO0B 1YEFH 3O6KL 2PTTB 4XPHH 3W81A 2BDNH 2F53B 2YMXL 4EUPA 4D3CL 4P2RD 3HB3C 1S3KL 1HINH 5D1XC 3UTOA 3PXHA 1ED3A 3MRMB 1A6PA 4GKSA 4UQ3A 2H9GA 4JM4L 4P48A 2R9HC 4P2QA 3WE6B 4ODUA 5DHVB 5BQ7A 1EBAA 3QEGH 4PJHB 4JZJA 2J88H 3OKLB 3N1FC 3DYMA 1PEZA 5EUKA 1WJ3A 5F6HI 3T2NH 2XV6B 1K5NA 3RWFB 3J7HA 5F7EL 5AD0B 1FFNB 2BSSA 4LQFH 4R7DB 1T80A 4NC2B 1CT8B 5E00A 3QO0A 3KDMB 3RU8L 1QSEB 4Q9RL 1DSFL 4P2RA 5ADPH 5IMMA 3S35X 5I8EB 4JO1H 4ODSL 1DLHB 1YPZB 5I66A 4HKJB 1M7DB 1WSST 1BQSA 3CDFA 1IKFH 1LO2H 1MAMH 2ZPKL 2BFVL 4F37K 2PW2B 3AS2A 1CDYA 1UZ6E 4PJGF 2D4DA 1QFWI 4Y4FD 3FFCE 3JV5A 4QTIH 4MWFA 2UZXB 3OKYA 2ZWLT 2R0LH 3M1BA 2MPAH 5IB1A 1RU9L 2AQ2A 3RY4A 3TA3B 5D5MF 4GXUN 4LCYA 3QJFB 4L8SA 1MHEA 4ZS7H 4KJYB 4OCSL 1ZGLP 1TCMA 4DQOL 3HPLA 2ESVE 1CU4H 1MCRA 2XKSA 4NNPH 5J6HB 1PKQE 3KYNA 4O51A 1JMZA 3QNYA 2IPUG 5L9DH 5DA4A 4FNLL 1UC6A 1T6WA 4MDJA 1CXLA 4Y4FA 2V2XA 5JHLL 3VD7A 5TDPB 3BH8A 2IGFL 2BNRB 4I0PB 43C9B 4UV4L 1BD2E 4M7LT 2PYED 1JYNA 3BKYL 3GMQB 2NY1D 4AEEA 2G60L 3GMNA 1TNNA 3VXSB 5IBUB 5DJCB 4JKPH 4K9EH 2FJFB 4ODVL 4P4RA 5C0JA 3LB6C 4NN6C 4RAVA 1Z6JT 4U2YA 2BSTA 3X13A 4R7NB 3GGWB 2G5BA 3FONB 1JZ3A 5JA9A 3C08L 1R24B 4R90H 2FLBT 3OJDB 4XNUL 3I2CL 4UTBH 3RVUD 4L4TD 4I0KA 1QR4A 4OLVH 3O2DL 2HWZH 2PYEA 2FJGA 3OAYH 1U3YA 3QP3A 4U1KA 4JY5L 3S3PA 3REVB 4BH8A 4UUJB 3P11L 4JGMA 5GHWL 3L3HB 1KULA 3TZVB 5BV7L 5GGSB 4G7VL 2AJYH 4S1QH 1I4FA 1AY1H 1FFQA 1YY9C 4W6YB 4IMLA 1KCUH 3CLFL 3TBVA 4F57H 1Q94B 1KJ2A 4ZNEA 4L4TA 1IGMH 5EOQL 3FMGL 3MRDB 1CE1H 2DKMA 5HPOA 3RPIA 4I9WE 1K2DB 1U6AL 3QUZD 3CH8A 4R4FH 3B2VH 1IVLA 2NXZB 2P46B 5ICYA 5DUMH 1NEZB 4YDVB 5ESAA 2VDNH 3MRFA 2YWZA 3FAXA 1QFUL 1CFTA 2IQAB 2EE3A 2WWMD 2IEPA 5CEZH 1DBKH 3MV9E 2VZVA 4OZGF 5DFVC 5HVGB 3MCLL 5EBGA 1FV1A 3HUJE 1BJ1J 4XCFL 4UNVA 4OI9A 4JFXB 5GGVL 2ARWA 4E41A 1S9WA 5DMYA 4RBPH 2P8PA 1HNFA 4BYHA 3MLTB 3QUZA 3TBYA 3ULSB 2DIBA 4PBWD 4PY8I 3UTPE 3KJ4B 3BE1L 4RA3A 3QDMD 3RWDA 4WI7A 4RISL 4LSVL 4ZYKA 4TSCH 3G04A 4K7PY 1AKJB 1F2QA 2QQNL 4S1RL 4OI8A 5E7BA 2V2WA 3LEVH 4PJEA 5I8CA 3KYAA 4AL8L 3W82A 2EZ0C 1KCRH 3HMXA 4KI5C 5DZNA 1XGUB 1FVEB 2JJTC 3ARFC 4KDVA 4KK9C 3QH3A 3EKCA 1RMFH 3KJ6L 3I9GL 1QBLH 5F71A 4CVUA 5EORL 4GBXC 3DVIA 4CU6A 1J1OL 3UCRA 2VZ1A 3EYFB 3QDMA 4XBPA 3NIDF 3GB7B 3E3QE 1PLGL 5KTEH 3KHOA 5GSRB 4BZ1L 5LXGH 2BHZA 1T6VN 4XC3H 4DKFH 4Z78A 5DJDB 2X4NA 1AO7D 2WP3T 4X80L 5DK2A 5ICXB 2YPVL 1CG9B 4YAQB 5E2VL 4BZ2L 2NY6C 1X5GA 1BLNA 1DBBH 5I1CL 2NYYD 3U2SA 4IDJH 1H3XA 3HNSL 2FD6H 4Q2ZB 1BBDH 3FTGA 4NCC2 4ZOBA 3WXWH 1QA9A 5E6ZA 5HYQB 3OJ2C 4IOIB 3PL6C 4U1JA 4Q9CA 4R97B 3WLWC 4OIIL 4NRXB 1LMKA 3JV0A 1YMHB 5IP4A 3QWRD 4YBHA 1AO7A 3T3PF 1FVCB 4NQEE 1RK1B 1JE6A 1FSKC 3SDXE 1FYTE 4M03A 1FNGA 1D5ZB 1MLBB 2VABB 4PD4K 2N7AA 1Q9WA 4HWZB 4OFDA 3EJZD 4HD9A 4YGVB 4N0FB 3D0LB 2AI0H 4ZO9A 3VFUB 3IGAB 2IBZX 2WBJB 2LV4A 2DLFH 2GFBA 3MRHA 3S34L 3QWOA 2VLKB 4OLYL 3QWRA 4H88H 3K81A 4YJZL 4GG8A 1QLEL 3UDWA 3MUZ1 5DUBB 5GS0L 2B5IC 5EB9A 3VFPA 5CUSH 4JFDA 3TPUA 2MSPA 2CJUH 3RHWF 6CGTA 5KZCB 3UTQB 4D0DA 5FGBC 2P5WE 4R3SA 4LU5H 2BNRE 4WI8A 1NBZB 5SWSE 1HHIA 1S7QB 1XGRB 32C2A 1KBGH 1X3DA 4F58H 3PWPE 4QLRA 4J7RA 2PR4L 3DRTA 3MV8B 5FK9B 2MWCA 4DOHE 2YBRB 4HV8B 4MLIA 4EN3D 4PRHE 3DURB 4LSRL 4D2NA 3K0WA 4E0RA 4XNYH 1UA6L 5DZOA 3QO1B 5DMIL 5DYOB 3JTTA 2XQBH 4G9DB 2JJSC 3FQUA 3VJ6A 4YHOH 1J8KA 4PLKC 3RGHA 4XP9L 4UNUA 4XPBH 3CGTA 3S35H 4DK3A 4JN2A 4JFZL 2ADGB 3WNMA 3CSYA 3GSXA 2YA0A 3MACH 2X4PA 4YWGL 4MB4A 3KYOA 1NCTA 3NIGF 3K4AA 2B2XH 3QWQB 1L7TH 5E56A 4EN3A 3PWLB 5EZJA 4M7JL 4FQXC 1OVZA 4GKZB 4RIRB 5FV2A 5GJSL 3IU4L 2EDTA 4N5EC 4YXHL 3VXRB 4XGZA 2PXYC 3Q1SL 3QQ4B 1UWEL 1YA5A 3DX6B 2DQFB 1KV3A 1MCBA 2ERJC 3MR9A 3MLXH 4KRMB 3QXDA 3C5SA 3CDGB 2ZCHH 1CR9L 5IFHL 1WQVT 4A6YH 3DLQR 2YPLA 3BPNB 2Q76A 5J0BA 1IQWL 2VR9A 4CKVX 1CDIA 5JMOC 5I6XC 1I7TA 4EOWH 1A3RL 4ZTOL 3IDGA 4XC1L 1T89A 4KFZC 2F53D 4Z7NF 2DQTH 2NY2B 1U8IA 3AB0B 3U7YL 1K3IA 3I6GB 3BPCA 4XBGA 4CAGA 5FHAL 3T0DA 1KT2B 3WXVL 5K9OB 1BVKA 4P5TC 3FO2B 4D9LH 4YHNB 4JB9H 4PJAF 4P57B 5FKPA 4OZIA 3LPGA 1Q8MA 4WU5B 1II4E 3GJEA 2EO1A 4P4KB 1F4XH 4JM2F 1FO0A 3VG9C 3MA9H 2F53A 1QSED 4WEMB 1U8LB 1GVIA 3RAJL 1MHPH 3ARDD 3UO1L 3KPOB 3K74B 3U9PL 2Z4QB 3BT2H 1UJ3A 4NN5B 1CD0A 1IL1B 4I18C 2YEZB 1F4YH 4XAKE 4Y19E 5I8KL 1M4KA 4XPAL 3WE6A 3LKNB 1K6QL 5DHVA 2MQ0A 2OBGA 4ZFFB 1NKOA 4PJHA 2BCKB 3JV4B 4M7KL 3N50A 1NJ9A 2NX5B 2UZIL 5I17B 4PJIE 1KCSH 5EUOE 2CR3A 3BMVA 3RWFA 3TA3D 3UBXG 2OL3L 4GRLB 1FFNA 2XA8H 3VRIB 1BZ9B 4QXTA 1CT8A 1QSEA 4H1LB 5D2NE 3ARDA 4KZEL 3EOYG 4MXVE 3MZTA 4M4PA 5I8EA 4HW6A 1YPZA 5E03A 4M6NH 1M7DA 5DQ9A 2N4IA 3C5ZD 4UZGA 3VA2C 3BZFB 4KDWA 4O2FA 1J10A 4NDMB 5K59F 5JW4Q 5FYJH 4PJAB 2PW2A 2O5ZL 1SY6L 4RDQG 1XH3B 3DIFB 2W0LA 1SVZA 3A6BL 4KHTH 5F1NB 3QCTH 4OT1L 4UT6L 4YZFE 3T65A 1N0LA 3EDEA 3BWAB 1DQJB 3P4LA 4I0PD 2FX7H 4P5KB 3T0EE 1NGPL 2XZQL 3TA3A 3TO2B 3E0GA 3FB7B 1JWSA 3HC0A 5A2JH 4K3HA 3QJFA 2Z31C 4NJ9L 3F7RA 4LOUC 5ANMA 3U30C 5HDLA 3OXRA 1DFBL 5J6HA 2FL5B 4XP4L 1J12A 5IQ9B 4F37F 1XMWA 2E27L 2XZAH 3VH8G 4RFOH 1E28B 4W68A 5FO7A 1MH5B 3N85L 4ALAL 2QSTA 3C9NB 5TDPA 5E8PB 5HGBB 1PZUB 4I0PA 2X05A 4OFPA 3UJIH 4PJXB 3KS0J 2X4UB 3GMQA 1HSBB 4HQQH 3VXSA 1S78C 3QULA 2NY3D 2FJFA 1EJOL 2DKSA 3MJGX 4PJGA 3GGWA 3PJSB 4M43H 4PJ8D 4JG0H 2H8PA 3TBWB 1UWXH 2FEEI 1R24A 1U8KB 3OXSB 3VGAC 5CFHA 1X4XA 1ZS8B 1T7YA 1FAIL 5IM7B 5EWIL 4L1HA 2B1AH 1PW3A 4PB0H 1TXKA 2GTWB 3QEQD 3OB8A 3IJHB 4ELKB 5HHXH 2R1WB 2HH0H 2W9EH 3GSRA 4NC0B 4Z7VF 4LVNC 4UUJA 3TZVA 5GGSA 1P4IL 4OQTH 4QRQB 4NWTL 4U31A 4M93B 4Z5RA 1JPST 4KMLB 2OR8A 4L1DA 3HN3A 3FHAA 2X6MA 1IGCH 2X7LB 3TYGL 4FTVE 3QUML 3MRDA 3OPZL 1GRWA 3QEQA 4MJIB 4BK4A 3E2HC 5IVZA 1PYWB 3SGEI 1PQZB 1K2DA 1DZBA 3K80A 5GSVB 5C0RH 1DUYA 4ODBD 3DRQA 5DTFB 3GMLA 3HCVB 1NEZA 4YDVA 2AK4E 2Y6SD 4WFGD 4JE4B 2EDYA 1NGWA 1A7QL 4L3EE 5JPNB 2IQAA 3CVHA 5LBSH 5LGHH 3K8LA 2LFGA 1F3DJ 4KGLA 4LCCB 5E4EB 1KJMA 3MLVH 1FFPB 5DVOA 1RPQA 3THMH 4QRRB 4Z7VB 5C09B 1TZHA 4KV5E 2XPGB 3T4YB 4QT5B 3ULSA 4UIKL 3ZKXC 1NCBH 4RMRA 3GMMA 2HFGL 4IEFB 4QNPE 3BYTA 5CMAB 3BD3A 4EI5B 4XCYA 2V2TA 4J12A 1YY8A 3GMPB 4APQB 1XGUA 1FVEA 1C5CH 5EIIB 1ES0B 3O3DB 2AERT 4GG6E 5IB4B 4V1DE 2W0KA 2HRPL 4LSSH 5SWQB 1OGTB 4FOMA 1BBJB 3PWUB 4JZJC 5ILTH 1YN7B 1S7UB 3EYFA 3GB7A 4K71B 1U3JA 4J2XA 1XR8B 2C1PB 4GS7B 2VXUH 4DAGH 1INDL 1LK3H 5L6YH 1TZGL 4YHIA 1R3HA 4ZFGL 3AROA 3BP6B 5DJDA 5ICXA 2W59A 3S4SA 1CG9A 1A9EA 3NIFF 4Y2DB 2EDNA 3IJYB 1XT5A 3HAEH 3MNVB 1TJIL 5DEFB 3SGDH 4LEXH 1I9EA 4HAFA 5D2LE 4OLWH 5DMKB 4FQ2L 5J11C 1HNGA 4GQ9L 4I3RH 4ZG1A 2J8OA 4DKEL 3F6LA 4IOIA 2NXYD 4LHJB 1XEDA 2XQYG 4Z7QF 7CGTA 2WBJD 1VACB 4KC3B 1MREH 1HWHB 4NRXA 3O6LL 4L8SC 1YMHA 3V0WL 1FVCA 1P9MA 3CZFB 5FGSA 1RK1A 1PY9A 1LO4L 1FGNL 5CJ8A 5LWYH 1QBAA 4U1GC 1D5ZA 4MA8L 1AD9B 1ZHKB 2VABA 3S36L 2HTKD 3BSZL 4KRLB 4Y4FC 4YK4C 2BOCB 1AGEB 5GRUH 1KELH 2VMFA 4N0FA 1KTDB 3MV8D 3L5WB 1NSNH 1R3IL 2WBJA 1TETH 1JYVA 5B21A 3BW9B 4GSDH 5DVMA 1DBJL 2XQYK 1JHKH 5D7SL 3CVIL 3UTSB 5D96C 1S5IL 1BOGB 2IAMD 1UKQA 1SBSL 4UTAH 2R56H 2Z8SA 3B9KC 4CVZB 5C0ND 4KTEH 4U3HA 4XVJL 3D39E 1NBZA 4PJXE 5DJ8B 1S7QA 1XGRA 1I9RL 4WFHE 1RIVL 3MV8A 2Z9TA 2OX5A 2NY1C 2YBRA 2EECA 2PCPA 4MCZA 1SHMA 2ZSWA 3X3FL 2OMNA 3D87B 3U36A 1QSVA 3A0OA 3P4OB 1ZWIA 4G9DA 3LZFL 4MNGB 3VXRD 4UT7H 1OAZH 1CL7I 4K8RD 4HCRH 4KKLD 1A3LH 3MRNA 5KVMC 1MJ7L 2DTML 3RVUC 2ZOKB 3ZSSA 4KWUA 2ADGA 3K1KC 3MZGB 5HGAB 4NO2B 5BXFB 2VLRE 1AGBA 5DJAA 1Z3GL 2VLLB 3IRZA 1PG7X 1Q9KB 2HT2D 3EO9H 4RNRB 2G75B 4LLYB 3OKKB 1IGIL 4GKZA 2DQHL 3HZMA 4RIRA 4P59L 3DX8B 1TVHB 3MLZH 1G6VK 2BK8A 3VXRA 5HDQH 3QQ4A 4OJFL 5E6IB 4JR9L 4O58H 4HS3A 3BGMB 2NY5L 3DX6A 2DQFA 3BEWA 1NEUA 2VIRB 3MGAA 5TE4L 3CDGA 3U46B 1EHLH 1YECL 3I6KB 2RGSA 3S6CA 3STBA 1MFDL 3SJVB 2F8XC 4JO4H 2H32H 3HMWL 2CKBB 3VXNB 3QUZC 3ZDXE 4KU1A 4P4KD 3WS3B 3BGAA 3I85A 1T5XB 3X11B 3FQWA 5F6IB 2WWMC 4X4ME 1KT2A 2B7DT 2DI9A 3FO2A 5DLMH 5F70A 5TF1L 4RAUB 4X9BA 3O3AB 3O45B 4AT6B 3WIIH 4DUVA 1QRND 4YHNA 5F3HB 2APFA 2NX5D 5LQBL 2CRMA 4G7YL 4P57A 5IV2A 1UZ6F 4WU5A 4P4KA 5IFJB 1RJZB 1F2XK 4FFZL 1TPXB 1EFQA 1AXSA 1QSFB 5L7XL 3DVGB 1T7XA 4M8VA 4CJ1A 2Z4QA 4B7LA 3OMZA 1IL1A 2YEZA 1JGVL 1TLKA 5AZEL 3LKNA 2D7PA 4ZFFA 4LMQI 4CADB 1HHJB 2Q7YB 4LCUB 2BCKA 4ZAKB 3JV4A 4H0HB 4HT1L 4JM2D 1QRNA 2NX5A 1RJLA 4XMLH 5I17A 5ADOL 1UXSB 1J1XH 1HEZB 3BISA 5BO1L 1V7MH 4KK5D 5HSFA 2NLJB 1S9XA 1KIRA 4NT6B 3SKOB 5DK0B 1BZ9A 4NOBA 2YN3A 1JNHA 3ULVL 2FHFA 4H1LA 2XACC 3IDNB 1BX2B 1W8OA 1TTUA 1QSZA 4EBQH 3RVXD 5L0QB 5LJYH 5L2KE 3BD5A 3S96B 5GGRB 3BZFA 5DI8B 5JMRA 4PJAA 3MO1B 5GRYA 1XH3A 2NYYC 3DIFA 4N1HB 3LRHA 5F1NA 2YOCA 5IHLB 4Y5YC 3BWAA 1DQJA 5HYEA 2FBJH 1UB5A 5F97E 3ZDYE 2Z8RA 5JIPA 1YMMB 1WBXB 4LEOA 5K9JL 2FATL 3EFDL 3O3EB 4NKOB 1QKZL 5D71H 3HC3H 1IGFH 1MCWM 3UDWC 5IGXL 4GMSL 3ZDZE 5ALBL 4IRZL 2C1OB 4JRYB 3UP1A 1OSZA 5GJTL 1E28A 4G42B 1KXQE 1MH5A 3LKQA 2WINB 5T1KB 3C9NA 4N8VG 3TIDB 3GSNL 5E8PA 4M62L 1J7VR 4OZHE 4CNIB 3EJZC 5I30L 5IEHB 3GRWL 1BM3L 3H3PH 2DICA 2Q86A 4L8BB 4D94A 3IAGC 4X0KB 4XHJD 4ENED 4PY7B 5CGTA 3C8HA 1HSBA 5IKCB 2X9WA 2VDKL 2QV2A 2IFFL 1IAKB 4HKXB 2FDBP 1ONQB 2CXKA 4PGDB 4ERSL 4S2SB 2NY4D 2E7CA 5B4MC 4NFCA 4LLDB 1PVHA 5DD6B 3WIFA 1U8KA 3OXSA 1HZHH 3QRGH 1ZS8A 5T3XD 1Q1JL 1TMCB 2YA2A 1MHCB 2QQKH 4M7LL 3BIBX 1ZLVH 3RA7L 5IM7A 1A02N 1T66D 3HPJA 3ROOA 5E0QA 4MJID 3HUJF 3EGSB 1XF3B 3IJHA 4ELKA 5A16B 2EC8A 2R1WA 1B6DA 1BGXL 2E9WA 3S88H 4UOW1 4EN3C 4R26H 4HF5H 3X17A 3BKML 3LH2H 4QRQA 4WFFD 5D1ZC 3MRLB 3MC0A 1KPRA 5DC4B 4AIZB 2V9RA 4LRNH 1KSRA 4CU8A 3OKOB 5HHNB 5JTWA 2WMPA 2N56A 4QRRD 1MCEA 5C09D 4MJIA 5FYKD 3EO0B 3LS5H 2EDEA 3ARQA 5GSVA 3S7GA 3RVWD 3Q0HA 4U6HB 5D8JH 1N5YH 2W60B 5DTFA 4Z7UB 2D7NA 5IT2L 5A43C 1OAYL 3BN9D 3KWWA 1VESA 1T89C 1Z0NA 2HG5B 4EXKA 5JPNA 4JLRB 4EI5D 3GSUA 1ZLWK 4LCCA 3KPLB 1OSPH 1FZMB 4OFIA 3RVVD 4WHYG 1CGWA 4QRRA 4Z7VA 3ZE2E 3SE8H 5C09A 3VWKB 1ITBB 2XPGA 3OB0K 5BZDB 4RFNB 4LSTH 1KEGL 5DD5L 4QT5A 1JNJA 5J13C 1ULVA 1YEJL 4LMQE 2H3NB 4F7EB 3RZCB 1MCPH 4IHOA 5EU6B 1F13A 2E9JA 2C3VB 3UPRB 2VO5A 4WEBL 4OBRA 5F9AC 4ZUVB 4EI5A 2AKRB 3GMPA 4APQA 4U1LB 5DK3A 5EOCJ 1UJ3C 4EIGB 5ISZE 4Y2DD 3GHBH 2E7BA 3GMOB 5EIIA 1ES0A 1NDGB 1I7ZB 3O6FB 1DTUA 3HTLX 4JDTH 1JGLH 3U0WH 3MRQB 2Q6WB 2OK0H 5SWQA 3ZT5A 1OD9A 1OGTA 1Z0MA 4OD1L 1C5DB 4BQ6A 1BBJA 3PWUA 5H37H 3SDXF 1FLRL 1BFSA 4RCAA 5IQ7L 2C1PA 5M94B 2B4CC 3SGJC 1OTUD 4X4ZA 3ARDC 3QG6B 2VOTA 3BESR 4QRPB 4X4YB 4HWEL 1PG7H 4Y2DA 3IJYA 4Y4KD 3MNVA 5DEFA 4TSBH 1TJHH 1I8KA 4OCWL 1EGJL 4LARH 3IFPB 3MFFB 5DMKA 4PP1C 2XA3A 4M1DH 1RZIB 4J1UB 3OQ3B 2ARJB 1CQKA 4LVEA 3TVMB 4DKAA 3MRPB 4TPRH 3TA3C 3DX7A 3QISA 1NAML 2AJZA 1VACA 5BS0B 4EDWL 5FUOH 1K8DB 3IDMA 3IU3B 4HS8H 3WNOA 2XYCA 3C87A 3O9WB 2XIDA 3UROR 1SEBB 1UWGL 3VE0B 3TFKD 3NH7H 4R8WH 4Y4KA 3GSWB 5DD3H 3TM6A 1U91A 1CLOH 4Z95L 2VSDA 1MFAH 3FB5B 1AD9A 3BAEH 3V6ZB 2CLRA 1FC2D 5GISL 2IPTH 2BOCA 1AGEA 5E6YA 3P30L 2GYSA 4I0PC 5T1LD 5CZVL 1CXFA 3MLUL 2LVCA 3L5WA 5EU7C 1IGTB 4XXDB 3BW9A 3KXFE 3BO8B 3D48R 1KTLB 2APVA 4JFYB 4WW1B 5GGTL 3UTSA 1ZANL 5IHZA 1JPFB 1RVFH 3T2OA 4P0DA 3BEVA 2FECI 2H2PD 4LKCA 5ICZB 5AZ2H 5DJ8A 3WDIA 1YN6B 4Z8FL 1F4WL 2GSIB 3QIWB 2XZCL 1A6UH 5T1LA 5I1IH 4P99A 5CIPB 4XRCB 1KLGB 4FQIL 4KK6D 5FUCE 2XWTA 2P45B 3DNKA 3Q5OA 3TZVC 2LU4A 2BC4B 3P4OA 1CK0L 5FYLD 5JO5B 1CGYA 4JKMA 3AM8A 4MNGA 4JPIB 4QY8B 1TQCB 4U7SA 4YPGB 5GS1A 3PE9A 4YDIH 3V7AE 5MEQA 1WAAE 1YNTA 2XTJE 3MV01 2DI8A 4P9HL 2P47B 4WHDA 5FM5O 5HGAA 4NO2A 3EUUA 5BXFA 1S7WB 3VD5A 1A22B 4LAJH 5DA0B 1ACYL 2VLLA 4Q9QH 1RK0B 1DJSA 5BW7C 1Q9KA 2NXZC 4RNRA 2G75A 1NCWL 1U2CA 3MV7B 4LLYA 4YHYB 1KLUB 3DX8A 3DGGB 5D7JB 1XR9B 5DHYB 4DN4H 4JFHD 3S37X 3BGMA 4M48H 3MLYH 2A73B 1D5IH 3GO1H 3OZ9L 3DECA 3KPNB 1T22B 2Q8AH 5KN5B 4JHZA 5T1DL 2R2BB 3RWCA 2CIKA 1GSMA 5FHBH 1JTTA 1RV6X 1UM4L 4K94L 4KRNA 3KHQA 1W8NA 1KB5H 3VXNA 2QQLL 2KL6A 3VI4E 1G84A 3KJ4C 3GBML 1A6WL 4OLXH 3WS3A 1NUNB 4PJIF 2Y6SC 1A6ZB 5EUOF 4JO3H 4AQOA 5B3JE 1T5XA 3X3GH 4O5LL 1NDMA 3X11A 1QSFD 4DGVL 2WUBL 1I7UB 1WBZB 2O61B 4MXVF 1NLDH 4KPHL 1I7RB 3NA9H 4NRZB 4RAUA 5EOTB 1BEYL 1O7VA 3ZE0E 4UILH 4AT6A 4O9HL 3QXAB 5JW3L 2EC9T 5CJOH 1G9MH 2ZUUA 4RGNB 2VXVL 3WIHA 4OZ4A 4TVPD 1VGEH 4OF0A 1JPSH 2BXZA 1E27A 3O4OB 4YZFF 4N9OB 1RJZA 1Y6MR 1LP9B 2F58H 4GRWB 4ODHL 1MNUL 4P23B 1TVBB 1I3GH 1QSFA 4ZS6D 3DVGA 1U58B 3I3BA 4FQ1H 2R0WH 3LKSB 1IKFL 1LO2L 4Q0XL 1L0QA 3PP3K 5CWSB 4ZO6A 3RWJB 1DUZA 4GJTB 5SX5K 4CADA 4J3TA 3FFCD 1HHJA 2IG2L 2Q7YA 3CU1A 3ZT7A 1RURH 2FGWL 2X1QA 4M3JA 5IROA 6FABH 1JIBA 1UXSA 3LN5A 1HEZA 1RUAL 1IC7L 1NCAL 4WY7H 4AEHH 5IFAH 4NT6A 1S7XB 3SKOA 1MCKA 4R97C 3O0RL 2ZG3A 4ZPVB 1YMMD 1ZT4B 3IDNA 1BX2A 4G80B 2OR9H 5TGBB 3HMXL 5BV7B 5DSCA 1P9MC 4WWID 5DQJB 3S96A 4NQXB 5GGRA 5DI8A 4HEME 3OV6A 3HNVL 1W0YT 2HJLB 2FZ3A 3MO1A 1Y18B 3FFCA 1MY7A 1I75A 5E2JA 4R2GB 4PGBB 1PFCA 1OAUL 2R8SL 3MCG1 1RUKL 5DJ6B 1YYLL 2GUOA 3BDXA 2IQ9H 4ODWA 4KKAD 1YMMA 4LNRB 2WBJC 1V7NH 5D7LB 2EEAA 3O3EA 4YXLH 4NKOA 2P24B 1U3ZA 1NCDL 2I25N 5KS9F 3BDYH 35C8H 1VA9A 3SOBH 4OBSA 1F58L 4X6CE 4G42A 2FYYA 5GRJH 4FXKA 5JHDE 3GUTB 2HTKC 3IDUA 1BPVA 3LVEA 4TSAL 3WFEL 5IEHA 1FO0H 4OCYH 4L8BA 4HFWB 1QFWH 3VFTA 4PY7A 3HLAB 3V95A 1DEEB 1IAKA 4HKXA 5ENWB 1ONQA 3D1MC 4PGDA 3JBG7 1T0PB 5DHVH 3RWGB 4S2SA 1PAMA 4P9MH 1CN4A 4HX1A 4HPOH 5IB2B 4LLDA 1ZLUH 4BKLB 5DD6A 5IBLC 1KN2H 4ONGL 2KH2B 1N2RB 2E8YA 2A38A 5C0NC 5I75B 5EOCL 4BK5A 3LHPL 3T04D 1OAKL 5HPMB 4NBXB 2EDLA 2DMKA 1VDGA 2EIBA 2B4CH 1EXUB 4N90D 4AH2B 3ULUE 2GJ6B 5DRZB 5A16A 5E8OB 1XGYH 4WNQB 1DN0A 1T1XA 4KQ3L 4KUCD 4KV5F 1NGZB 4U33A 4M1CC 4LSPL 3WKML 2DM2A 4JGUA 2BVPB 2YUVA 2FX9L 3MRLA 1T2QH 3EDJA 3KPQB 4U1IA 3DOSA 1A5FH 1DBKL 4K3JL 4QNPF 2YKLL 4KKNA 3ESUF 4NJAH 4QRTA 4YX2H 3VD4A 1EEQA 5CHNB 3OKOA 2VL4A 1FRGH 5FO9B 3JVGA 4PGCB 1P53A 2UVEA 3EO0A 3WKNA 3BPNC 3ARBB 4GG6F 2ZUTA 1O5DT 5BVPH 1JRHL 2Y07L 1F6FB 4XPFL 4U6HA 4YDKH 2W60A 4P5MB 2V6HA 2HT2C 4Z7UA 3PGDB 3LEVL 2A1WH 2A6KB 4OLZH 4KRPB 2QHRL 1A47A 4JLRA 3VD9A 1PX3A 3CX5K 2NY2C 3AB0C 3ORJA 3KPLA 3HUJA 1OF2B 3O11B 3UJJH 8FABA 1FIGH 3O6FD 1RZFL 2VLJE 3VWKA 1NPUA 1TDQA 3SDCB 5BZDA 4NN7B 1A7RL 5D2LF 3CMOL 2H3NA 4F7EA 5EC1B 5LXGL 2VN4A 4P4KC 4U0RB 4PR5B 4L4VB 2C3VA 1HQ4A 1B0GB 1TENA 4G8GD 3EOBB 2AKRA 1MI5E 4U1LA 3GK8L 4N8VB 5C7XH 1A8JH 2IMNA 4NN5C 2VC2L 3QQ9D 2ZJSH 3GMOA 1MQKH 1NDGA 1I7ZA 3O6FA 4OZFG 4Q58C 3VFGL 4RGNE 4GUPB 2GT9B 3EFFA 3V7AG 1DCLA 5CILL 4YXKL 1C5DA 5FDYA 5DMJB 3TVMD 4NIKB 2AJXL 4M7ZB 5E99H 5IHUL 4RGMB 4GRLC 1OAXL 5F7WC 3LQAC 4G8GA 3SBWA 5BS0D 1MCDA 2LU3A 2CGRL 4XP6L 3L3KB 3QG6A 2VXTL 2MQ3A 4X4YA 3DUSB 4KTDL 1S5HB 5IB3B 1F45A 4LSUH 3WUWG 5F3BB 1D5BB 3IFPA 3OAUL 1RZIA 3S37H 3MGOB 4J1UA 4M02A 3TVMA 2IWGA 1DANT 4Z9KB 5ITBL 4KK5C 3L6FB 3VXTB 15C8H 5ITFB 1MFEL 4H88L 1BFVH 3V6FB 5FECB 5BS0A 2C26A 4GKNB 1SM3L 1NCCH 4TUJB 4JO2H 1FORH 1K8IB 4HJ0D 1SEBA 3EIFA 5FCUL 2RCSH 2CRZA 2D7QA 3SDXA 3GSWA 2P5WD 4LU5L 1BFTA 1EV2E 4MQXD 5SWSD 1ZK9A 3QHFH 5MENE 2P49B 1KBGL 2EDXA 4Y88A 2GCYB 5HYIA 1DQTA 2KZ1B 4N8CL 4Q97A 3QIWD 4NZTH 4LGPB 2AEQL 2DQIL 3HHRB 1Z9OA 3K3QA 1GPOH 2KQNA 4PRHD 1EUUA 1IGTA 3EZ8A 4XXDA 3BO8A 3BI9X 2HJFB 4P46D 1G7PB 1A9BB 3ZO0A 5I8OL 2LTQB 5K93A 2MOVA 2CDEA 1JPFA 1O0VA 2BP3A 1NC4D 2WAHA 3RUGB 2Q1EA 1S7SB 3CFBA 5SWSA 3IETB 4JHWL 4PJBE 4PJFE 5ICZA 3V9FA 2FR4B 4YO0B 3ABZA 5TQ0H 3DSFL 3L7EB 1YN6A 4MDIB 2GSIA 3QIWA 5FA3A 4LASL 1X4ZA 4XRCA 2IPKB 4XHJC 1SEQL 2GITA 3NAAH 5B3NA 5IR1B 2Y06H 2DD8L 2QADB 5B22A 2DQJH 2EKJA 4H8WH 4XH2A 3LQZA 1OD7A 5I1HL 3MV7D 1MJUL 2IBBA 3ZDXF 1MRFL 2BC4A 5JO5A 1NAKL 1V05A 1GYAA 4NKDB 1NC4A 4LCWD 4M93C 1H3WM 4JPIA 4QY8A 4TRPL 4ONFH 2ADIB 1YYMH 4S0TD 4YPGA 4GRMB 1MEXH 4F15B 1EHNA 1BZ7A 1I1FB 4UB0L 1IEHA 3W9EA 3W11D 5IESH 1CBVH 3U4BL 1OB1B 5HGDB 3H3BC 1D7FA 1DL7L 4FABH 1S7WA 5GQBA 1R0AL 1FLTX 2DYPB 1ZVHA 1NCUA 2W9DH 4HPYL 3MV7A 2OL3B 3VFNB 4IOSD 4UBDD 3NBNA 1KLUA 1FH5H 3DGGA 1B88A 4RGOL 4PJ5E 2DS4A 1GOFA 4LCWA 1WF5A 1QFOA 1XR9A 2OTWB 2Y7QB 2MKWA 4I3SH 1H3UA 5GZOC 4L29B 2A73A 4OD2B 5J4MA 1YJDH 3KPNA 1T22A 4LCCC 2HKHL 5KN5A 5E4EC 3MA7B 2BVYA 2OI9B 3A67L 4TTGA 3QQNA 1HYSC 1K9TA 1R5IA 3ZTJH 1N59B 1UACL 3GHEL 5C9KA 4LCIH 2J3SA 4AY0A 3BJ91 1NUDA 2EXWD 2X44D 3CLEL 4DGIL 2L0DA 2MMXA 1A6ZA 2B1HH 4P23D 3BIKB 4XBEH 1ZT1A 5F7HA 5D1XB 3W0WD 4EI5C 4GAYA 4HZLB 4NQDB 1I7UA 1VGKA 2NY0D 4HH8A 2O61A 2VXSH 4APQC 5DDHB 2EH7L 3MCKB 4PRDB 1KOAA 3CXDH 3RVVC 1I7RA 1CGVA 1ZHLB 4NRZA 5FGCB 5EOTA 4ZUUA 4GXUM 1EJ6A 3ILQD 5SWZD 4JGJA 1KCSL 3QXAA 1W0VB 5F7KC 1U93A 4UNTA 1SYVB 2H45A 1A4KB 1WGOA 1VFAA 1LP9A 4K71C 5KSUA 2OSLB 1AQDB 3QBTB 1INEL 2ICWJ 1VEPA 4P23A 4GS7C 1TVBA 3WHE1 3V4UH 2I9TB 3CVHL 3L3GB 3ZDYF 4OTXL 4M6ML 3W0WA 4H0GA 1U58A 2LQRA 5DURD 1KYOK 1GHFH 3CC5B 2Y1VA 3TF7C 2K3TA 4Y2DC 1G7QB 3RWJA 3WO3B 1MIMH 4GMTL 1DBAH 4K7PX 5I16A 5SWZA 3BOVA 2ORBH 3L5XL 1T3FB 1JGUL 1CDBA 1RFDL 1U36A 3DX9A 1J5OL 1V5JA 4G8FB 1S7XA 2ZCKH 4OZHF 4XXCC 3O2DA 4ZPVA 4QXWA 3UC0L 1ZT4A 3MBXL 5I1GH 1OTUC 2AQ1A 4YNYA 5TGBA 2Z91B 4FRWA 5HYFA 1F90H 2CUIA 1Q9OB 1ZVSB 3F65A 4NQXA 4Y4KC 4TOYL 2HJLA 3SDYL 1Y18A 2ENYA 1CD1B 2YD1A 5CEZE 1Q38A 1YEEH 4WHTA 3QUMB 3VXUE 2HVJB 5DJ6A 3SKNB 1U0QA 4PYGA 2X4OB 5LCVH 2D03H 5F9OL 4LNRA 5D7LA 4QYOA 3O6MH 3H42L 2LU7A 3R0NA 2P24A 3SE9L 1K4CB 4WUKL 4OSUH 3TFKC 4PTTB 2QEJA 4HIXH 5J1TC 2X1PA 3FB8A 2KUTA 3GUTA 3VA6A 4YDJB 4R0LB 1U9KA 2JTDA 4XCCL 1IM9B 4MJ6B 4U3XA 5DD1L 4H20L 2EYSB 3VXQA 2W9EL 12E8H 2R4RH 4HFWA 5I9QB 3GJFK 5A40E 2C7UB 1NLBL 4NFDA 1RHHB 5B8CB 2I60L 5E9DE 3RX7A 4ELME 2I07A 3BPLB 3G08A 4PRPE 3CH1B 2Y5EA 1F3JB 4YIQB 1I1CA 5DWUH 3RWGA 2NNAA 3HG1E 5IB2A 4W4NA 4X7TA 3AM8C 2ITDB 3KNBB 3GNMH 2BJMH 3HE6B 1IEBB 2H2PC 4FTVD 5DJYB 5INCB 1N64H 5HPMA