2AJXL

Crystal structure of cocaine catalytic antibody 7a1 fab' in complex with transition state analog
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
216
structure length
216
Chain Sequence
DIVITQDELSNPVTSGESVSISCRSSRSLLYKDGRTYLNWFLQRPGQSPQLLIYLMSTRASGVSDRFSGSGSGTDFTLEISRVKAEDVGVYYCQQFVEYPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Antibody 7A1 Fab'
total genus 47
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2005-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajxL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajxL01
1KN4H 5L2KB 2HFTA 1KIRA 2KKQA 1S5IH 4JJ5A 3BEVA 3SCMB 5D71L 4PRHE 1EO8H 1UCBH 2Y4SA 1I8IB 4NCC1 5TGBB 4P23B 4ZO7A 5B8CB 2Z31C 3KJ4B 2X1OA 1QR4A 5MHSE 1P4IL 5I71B 1SYVA 4KI1A 3GMQA 1P5UA 4G9DB 1U3HC 4QOKE 3WO4B 1ZVYA 4HQQH 2AVGA 3K2MC 3QUYA 1MEXL 1C5CH 3GKWL 3K8LA 5F7EL 3I2CH 5GS1B 3QEQD 4NQDB 5IW6B 3QXAA 2NY2C 4QY8B 3NBNA 4X6DA 1AGBB 4ZPVA 4GBXA 1HWHB 1AC6A 3L3JA 4G8GD 4L3AA 4D0DA 3L5XL 4YHYC 1DUZA 5FA4B 3C60D 2VXSH 5EIIA 1NCTA 1AQKL 4RRPG 4P2RD 3T2NH 1UJ3A 1IGCH 5HGBA 3D0VA 3MLUL 5I1JL 1B0GB 1H8NA 3S5LG 1DR9A 3VH8G 4OJFH 4NQSB 2C4XA 5DD0H 1HDMB 3PWPD 1FCGA 3HTLX 5HI5C 3VXQA 1JPSH 4JQVC 4CVUA 4GKZA 5AD0B 4M5YH 3MLUH 3MRMB 4F33B 4LLMB 3ZKNC 4C56A 1MPAH 4U1JB 3QH3B 4NNXA 4QXWA 4DGVL 1RD6A 4PB0H 3UBXI 1QSFE 1MHCA 5DD1H 3TC9A 4EUPB 3WFCH 2QR0A 3OKKB 2XQYK 3HRPA 3TBVB 3FQTB 4KK9C 3ELAT 1IILE 1BVLB 3X12B 5C0NC 5ESAA 1F3RB 4HZLB 4P4KD 2ZP0T 5HY9B 4GG6B 3C09C 5F88B 3BHBB 1KF9B 2R4SH 3B2UD 2AEIT 4QRTB 3U1SH 4WHYH 2ZOLA 3IJSB 3LZFH 4FFYH 4M7LL 4Z8FL 1BIIB 2XWBA 5EULV 3EOYG 1RZJC 3HPLA 4QGTA 2AERT 2NNAA 4K9EH 1KN4L 1NCNA 4YE4H 3O6LL 2R2HA 2VXVH 3C5ZC 4Y2DD 5DUML 2DM7A 3OAUL 4QWWD 2P48B 2KZWA 2HT4D 1S78D 4P2QD 4DGYL 5J13C 1WEJH 5C07B 4POZD 4FXKB 1QP1A 2NZ9D 4EZMA 3MCG1 3UTPD 4Y4HA 5E5MA 1RUKL 3RHWF 2R0ZH 4XBEL 3MLZH 5FOJA 3RY4A 3VMOA 3W39B 4Y2DA 3OXSB 3IXTB 1ZLUH 4H1LB 3D9AL 5D2LB 3W9DA 3OG6B 2WAHA 2FJGB 2NY0B 4MLIA 4DVRH 5JXEC 1FO0A 1PD6A 1ZT7A 4LRNH 3BUYB 4LHUA 4U6XA 2V17L 4Z7UA 4LCWA 4Q6YA 1U8JA 3U2SB 1KJMA 1YYML 1MEXH 3S3SA 5E4EB 2OP4H 4G42B 4MQ7B 1OAXL 1TJGH 4WI8A 3TP4A 1NFDB 2YKLL 3NIGF 4YHOH 2QSCH 3RVXC 3T8XB 1JV5A 4NQXB 3LQZA 5FKPB 1S5HA 1A7PL 3DSNA 3QUZD 5C3LD 1OSZB 2J5LB 4JO2L 1WBYB 2ZCLL 2RAMA 4YHLH 2B4CL 3H3PH 4IHOA 3VFTA 3BWUC 2XZQH 4XTRD 1C16B 4JKLA 3N1QC 1QSED 2R2BB 4WW2F 2KPNA 2ZUQB 2EE3A 3HG1A 4IMKA 5C86A 3L7FB 3RWCA 1X6NA 3KNBB 4XI5C 3JVGC 5CHNA 1P9MC 3QCUL 1IQWH 4LMQE 3W2DH 2Q3AA 5ID0B 3DIFB 3WFDL 4PUBL 3QQ9D 4YK4B 2FO4B 2NXZD 5HPMA 4OZGB 4I4WA 4ZD3H 2H6PB 2ZCKL 3PWUB 1F5WA 3MYJB 3HB3D 4QOKB 5DLML 3MV7D 1VFAA 3VWJB 1YQVH 3A67L 5E8PB 4R4FL 4XP5L 3NMEA 3V6FA 5CINL 5FECB 4NQDE 4WJ5A 1CIDA 5GS3A 4RFNB 5T5NG 3SGEH 5JIIA 3O2DL 4PJ8C 2CDFB 3S4SA 4E42B 3MJGX 4U1LB 2IANA 5IB5B 1VPOH 1EHAA 4MAYC 2X4RA 5HJ3A 5KG9B 4ALAL 3S98A 1TQCC 3NFSH 3VH8A 4Y5YA 3MV8B 43CAA 4RA3A 3NCJH 5DEFA 4GXUM 4ZYKA 4ZSOB 3GMNB 1E4XI 2IPKB 2LTQB 4G6KL 4S1SH 4P48A 4LP5A 5DHVA 1M71A 3EYQC 1HINL 2WP3T 2ZOKB 2F54D 3G5VA 1PKQB 5GRVK 1C5CL 3VD5A 3KS0H 5IR1A 1FLTX 2D0HA 4M02A 1KCSH 2EDXA 1T1XB 1LEGB 5DTFB 4JPKL 1UKTA 1MIMH 4ESKA 4ETYA 2BY0A 1XIWD 1NGZA 5ID1B 4PLJC 2AGJL 5CUSH 2OI9B 3FQXA 1U8NB 1RPQA 4TN9A 1PYWB 4ZOCA 4XPGH 1JZ6A 3N1FC 4QXGL 5B39G 5I76B 1MI5D 4HEME 1Q9KB 1PFCA 2J8UF 4YNYA 1EO7A 1OT2A 4FQ1H 3KPPA 2XPGB 4PJ5E 2OXHA 2UWEF 5GGSY 4PJAB 3O6KL 2VIRB 3WJJC 2AJXH 3WD5L 4OCSH 3VD4A 4JKKA 3LEVH 5LGJB 3RWFA 3LEYH 2EDEA 1GGIH 2PYFA 2ZOLB 4YDIH 1ACYL 3TN0B 4M7ZC 3QBTB 2QSCL 5DJAA 5T3XH 2D03L 1BHGA 5JXED 1BFSA 3N50A 3AY4A 2VZOA 5HVWA 1U8OB 2MQ3A 3CUPB 4NQEB 2CLVA 5HDBF 4HCRH 5J12C 5DMGD 3O3DB 3CFCL 1AXSB 3ILQC 1JNHA 1MFBL 2IWGA 4LARL 4HZLA 3LQAH 5GSRB 4OBSA 2DYPB 4RFNC 3SCMD 1JMZA 1SMOA 5ISZD 4X4XB 3NABL 4JM4L 1XF1A 4X98B 2VDRL 2HFFA 2BNQA 5F8RC 1R3HA 1PX3A 5HHQB 4NBXB 1KCUH 5FUOL 4QRSB 1KC5L 3KPNA 1H0DA 1X5HA 3O6FA 3O4LE 3OKOB 4XNQB 2VDPH 5ISZA 2FR4B 4X99B 3HZKA 1S7RA 5E70A 4OCLC 1LK2A 3SCMC 2ZG1A 5BV7L 2NNAB 4PLNC 4NN5B 1B9ZA 4KRNA 4XBEH 1I1AD 4IRJB 5E6IC 2Z8RA 1BQHA 1OTTC 3V79C 2CLRB 5I8OH 2R29L 2FEEI 2WQ8A 2EYRA 5FGBC 4YGAB 1BZ7A 2NYYD 4GRLC 1C08A 1MIEL 4YHYB 2VISA 3JWOL 2BSED 4ERSH 1F2QA 1L0YA 2HRPH 3OGCA 4OUUB 5D1QA 2ENSA 2JB6B 4NZDA 2BHYA 4YXHL 3VXSA 2EC8A 3MV8D 2HFGH 1KG0A 5IKCA 4TQEH 1GRWA 1E4XL 2P45B 2VITA 1DP0A 1KTDA 4YR6B 4BZ1H 1QLRA 2H8PB 1TCRB 3BMVA 1Q72L 2I26N 3HS0B 1KN2L 1EDQA 4Y89A 1JPST 4LCYB 4DKFL 3MREA 4FXGB 4S2SB 2D7OA 5BZWB 5GRYA 4XPTH 3I2CL 1FZKA 5SWSE 5DD5L 3G6DL 3LEYL 3BVNA 4JFZL 4F57L 1T4KB 3HHRB 5DJ6B 3DUUA 3MMEA 2FO1A 3D87B 1I1CA 2VDML 3BKYL 1KCKA 3OKNA 1MELA 4WRLA 1OGAD 1A2YB 1F45A 5EOCL 4CRPA 3S35H 2VLJD 1IGJA 3LQAL 1ZOXA 2FX9L 3RVTD 2X2YA 3ALPA 3O9WC 4ZUVA 1L9MA 3C8DA 2G60L 5EOTB 3M17A 1NGXB 1PKQE 3KVQA 4JM2F 5D7IB 2AK1L 3LV3B 4WTXA 4M3JA 4YEFA 3PWPB 2EECA 3Q3GA 1IC5L 5HHMD 1P1ZB 3CH1B 4HKXA 1GZPA 3MRRB 1XF3A 2HT3D 1JRHL 2Y72A 4OF8A 1CCZA 1CS6A 2VN7A 3KPQA 3UDWC 1N0LA 1KB9J 4OM0L 3WFHA 2XZCL 2O5XH 3EYOA 4J6RH 2YEZA 5D2LF 2ZJSL 2NR6D 3AXLA 1JNJA 2NY0C 1MRCH 5CGYD 3MQIA 3VFRB 4EIZC 4M3KB 5IVNA 3IS1X 4HWEH 2R8SL 1AHWA 5TH2B 3CGTA 1QRNA 4U6HB 5FO9A 5JXAL 4H88H 3TNMA 1F4HA 3TBWA 1XF5A 1JZ4A 4UDTA 1H5BB 3AS2A 2Q8BL 3E0GA 5F7EH 2NY3D 1NFDF 2Z31A 5F9JB 3DVNB 3VXPA 4G8FB 5TDOA 1X5JA 1DN0B 3E6HA 4YXKL 1ND0A 4NWUH 1QFUL 2HMID 2PUQT 3CVIH 3GO1H 4KZEH 2P4AB 4MA1C 4RGNC 4JJ5B 4NJAL 4NN7C 4U1SB 2G5BB 1AXSA 3GSVA 4N8CH 1CQYA 1LNUB 4NKMB 3UJTH 8FABB 3MLXL 5T1DL 3HN3A 3V7MA 3MO1B 1OP3H 3P0YL 5D7LB 3OV6A 1XR8B 35C8L 3RTQD 2IAMD 4QTIH 3STLA 1YPZA 2VLJB 3TN0A 3OG4B 3KPNB 3M1BB 3GKZA 5CIPA 5FV2A 5DUBA 1FYTD 3WFEH 1JGEA 5DD5H 1QLEL 5I1JH 1S7TB 1GZPB 3BT2L 3PP3H 5JR1H 3WFBH 5CEYB 1HHIB 5I17B 2ZPKH 4Y4FB 4I9WE 1IEBB 1N2RB 3B8SA 5HVHB 1R3KA 2F9BT 4JO1L 4EQ3A 2PTTA 1T5WB 1LO2L 4NPYA 2DIJA 4RGOL 1D5ZB 5J1AA 2D2OA 1R3LA 2LV4A 3EJZC 5HYJD 2GJ6B 1A6WL 1NCBL 2OR8A 4OFYD 4PLOB 2ILLA 5KVDL 3LQAC 1T7WA 4ZFFA 2BJML 3M45A 5FHBL 1HH6B 3CX5K 2JB6A 4JANA 3RX8A 4UOW0 3SY0B 4PJ9D 5DEGA 1KCRH 5L9DL 1UYWL 1YNKL 1FFPA 5C2UB 2J7LA 2KL6A 3V0AC 3KDMB 1QSEB 3QCTL 1A6AA 1G7MA 2ZUUA 2NY4C 4RZCA 3ZL4L 4XNQA 3QCUH 4I2XE 1I1AB 3MRKA 3QI9C 3AREC 4R7DA 1I7UB 2R29H 1VENA 3LAFA 4JQXC 2NXYC 4YIQB 1KLGB 3QDMD 3RWCB 4N0UB 1LO4L 5LBSH 5HHPB 4IJ3C 4WFHE 3A6CL 3CFEA 4Q2ZB 5KOVC 1T89C 2R1YB 2HVKA 1R0AL 4HWEL 2R8SH 3MNVA 2P5WE 1LILA 4O9HL 2FBOJ 1BZ7B 2XY2A 1DBBL 1QKZH 2V7NB 3I6LE 4MNQB 5GSVB 1FZOB 5BV7C 4R4BB 5GRZA 2QSTA 2UY7A 1J87A 2O5XL 2QADC 4HG4K 4HWZA 3D48R 5DHVH 2Q8BH 3EYVB 5DSCB 2WUBL 1CXHA 1VFAB 4X9FA 5LGHH 4Y4FC 4D0BA 2CRIA 4V1DB 3MRPB 5KSVB 5D1XC 3D3VB 3V5KA 2KBGA 2UV3A 3UEZA 3DURA 3A6BH 4Q7DA 3T3PF 5I1GL 2EDHA 3MZTA 2VSDA 4MNGA 4N0RA 5B39A 1OARH 1HILA 2HT2D 1RVFL 5CP3H 3BKJH 4Z0BH 3TA3A 3BPCB 3NFNB 5IHZA 3KPSB 1WQVT 2I9LB 3NZ8A 3BQUA 1BJ1H 4MNHA 2GTZA 5T3XE 4WU7A 1S7WA 4NIKB 2YC1B 4J2XA 3TFKC 4YWGL 1VKXA 4PJDE 5F9WB 3TIEB 4E5XB 5L2KE 5SWQB 2FEDD 1HXYB 3QEQA 4QWWC 3ZYZA 3MR9B 5HYJB 2XTJB 5DJCA 1FL5A 3UBXA 3O6MH 2F53A 2HN7B 1S9YB 3FQRA 3MRBA 2E8ZA 3T1FA 4L4TB 4XB7A 2HTKC 5AUMB 5ACMA 3FFDB 2DL9A 5J4MA 3IDIA 4NQCB 1KPVA 3ARGD 3ETBF 5C0CA 1NGWA 4Q9RH 5L8JB 3KPPB 2X9WA 3HC3L 1JPFA 5GJTH 5LJYH 5DMKB 5H8DA 2P5EB 1P7HL 4YPGA 3QPXL 5MEOA 1VADA 1J1OL 2X5PA 1FFNA 3BP7A 2DQGL 1JYNA 1U8HA 1MAJA 2OJEB 2ZSWA 3HPJA 4JFQB 2G2RA 1YC7A 1J5OH 3EJYD 1YJDL 3VFVA 2APWA 4X9GA 1JGVH 4HKBA 1NEZB 4RGND 5D7IE 3MOAH 2FH8A 1X7QB 1WEJL 3TT1H 4GRMA 4LCCA 5IB3B 2FX7L 4JKPH 1A4KB 1CDYA 1H3GA 4HPOL 4X6CA 5KN5A 1YECL 3JWDH 1TZGH 3BN9D 1FZJB 1A3QA 4PS4H 1NC4A 3IFNH 3FT4B 4RGMB 5HDBE 2GKIA 3H6JA 5IHZB 2F5BL 1JGVL 2YN5A 3SGDI 4YHIA 1WZKA 5IBLD 4O9HH 1CTNA 5GZOD 3OKDB 3PHQA 5FYKD 2DI9A 1CFNA 3QNYA 4F2MB 2R15A 5FA3B 2H3NA 1YN6A 1T1ZB 5EU4B 1PG7W 4XPFH 5DGRA 4Y4FA 4UTAH 3S37X 4U1LA 1P7QA 1X4ZA 1A3RH 3K8KA 4J7RA 5I1GH 5I30H 2P7TA 4PGEA 1I7ZB 4BFIA 3H42L 5KJRH 5DI8A 5F89A 2IH1B 3CK0H 4K3HA 5DHVB 2FJFA 3CLEL 1H15A 3C8KA 2MCPH 3CDGA 3VXMA 5F21B 4JANB 1QPXA 3TN0D 4HQQL 3VA2C 3TVMC 4PJ7F 2BK8A 3QUXB 1P4LA 4XAKD 2VDNH 5FO7B 5F6IC 1A6UH 3RWIA 3LKRB 3AY4C 1M1SA 4RGOH 1PYWA 1DQJB 2X1WL 4FTVE 4CMMB 3G5YB 4GMSL 1UJTA 1KACB 3L95A 4Q2ZA 1EEZB 4JM2B 5K33A 1L6XA 2VDKH 1MH5B 2JELL 2VXTH 3QDHA 1NLDH 1R3IL 5EWIL 5B22A 2ATPA 1RULH 2RCSH 1UJ3C 1WZMA 3FQTA 1FZOA 2BXYA 3QUZB 2X05A 1LO3H 1OWRM 3A0OA 2APBA 3MACH 4XCNB 2V9QA 1GGUA 1PSKL 5HBBA 2YD9A 3WLWD 4ODTH 2MHAA 5IMOA 3B6SB 4JFOB 5SX5H 1IJ9A 1UZ8B 3BHBA 1X6LA 3KDMA 2AKRA 1CL7L 4L5FH 2BVOB 4HX1B 2GCYA 5T1MB 5K93A 2QBWA 4OGXH 3MCLL 4C56D 2RFXB 1IM3B 3OMZA 5IG7B 3QQ4B 1U3HD 4PP2B 4LVNC 5D93B 3ZE0E 4ACPA 4DKDC 3F7YB 1F13A 1NEUA 4ZUWA 3R8QA 4H26B 3MBXH 4UNVA 1U8LB 4BYHA 3KYKH 4L8DA 1W2KT 3DJ9A 1HHHA 5DEZA 2ITDA 4LVOB 1ZSDA 4MJIA 2A6IB 1OVZA 2XA8H 3FQWA 1FNSL 2DDQL 2OBGA 4UMGA 5D9SA 5FCUL 5DSCA 4R2GC 3FB8B 4P4KB 5C0ND 3MLXH 5T1DH 1F90L 4EBQH 4OM0H 4JHAL 4ENEC 3OJ2C 2K3TA 4MNQE 3MRLA 2P24A 3BAEL 4OQTA 1WCBA 1B0RB 2H2PD 2QKIA 2UVFA 3QIWD 3TJEL 2H2SD 4IOSD 3HI1A 1MVUA 1J86A 1DE4B 4H25A 1TVBB 4DVRL 3PP4L 5HHXH 2D03H 5T3ZH 5ENWB 2F54A 3QDAA 3V7AE 3LQZB 3CMGA 3UDWA 1AKJB 3QZWA 1YNTB 4IIQB 4XP4L 2QSVA 5IB2B 4YDKH 4L4TD 5IM7A 4HUVB 3QG6B 3U0TB 5JDSB 3EFDH 3VXNB 1JCKA 2PYEB 3E6HB 1PZUB 2IPUG 1OGTB 3C60B 4Q97A 4X7TB 5JHDE 3G5ZA 2OMNA 4LIQL 5EWIH 4LLVB 5L0QB 2IQ9L 1B2WH 5C0DA 1S7UA 4PJAF 2ADFH 3H9SB 4U0RB 5HY9A 4GG6A 3DUHA 5E00B 1NDMA 4ODHH 1MCPL 4R3SA 1JZ8A 1MI5A 5KSAD 3U7YL 5LKNA 1KB5H 3FOLB 3TO4B 1L7IH 1ONQB 1T2JA 3DMMA 3O2WH 1MFCH 1XF2A 1AQDB 2A77L 2FNBA 4KQ3H 5SWZB 4POZC 2F19L 3QUZC 1CIUA 5DVLA 5IJVB 2Q8AH 1AFVH 1JVKA 4CJ1A 2FD6H 5I19L 4M1GH 1HHKB 4JY4B 5GGRY 1R5IB 5ESQA 4KROB 1IGJB 3SE3C 3TCLA 4ZTOH 5DJ0B 4PYHA 1ZA3B 5I6XC 3ARXA 3ZKXC 3RKDC 1U8IB 3NACH 4JN2A 5KOMC 2RHEA 4YE4L 5IVXA 1FFOB 1HCVA 4P4RA 3QCTH 5C09B 2C7UB 4ZTOL 2ATKB 1KXQE 2IBGA 4G9FA 1U95B 2A83A 4M43L 4J3WA 4U33A 1T03L 1OWWA 2GSGB 5CSBA 1A6AB 1G7MB 2ESVD 1T21A 1LO5A 1NFIA 5ILTH 3QCVL 5EZIL 3PDOB 4ZNEE 1ZGLA 3GSWB 4PRPE 4W68A 3EFFA 4NRXB 5C0FB 3SDYL 2V5RA 1BAFL 2HLAA 5D7LD 2AV1A 5L6YH 4OD3H 3GJEB 4D2NA 4IJ3B 1MWAB 5CEXA 4FFVD 1JYVA 3HKFA 5IBUG 3IDJB 1F6AA 4Q58C 1LEIA 1KEGL 4C58B 3OTTA 2VL4A 1V3LA 1IC4H 4G9FD 1Y6KR 3P4OB 1J10A 4OFKA 2WLYA 3O6FB 5B38A 3HC3H 5JW4N 5I1HH 2B4CH 3KPMB 1YA5A 4FNLH 4AT6A 5IJVA 2EYTB 5F7DB 2PO6D 5D1QD 2FWOA 3FT3A 1I1FB 2VISB 4RRPA 2DQEL 4JHWH 1B2WL 5EPMA 3C6LD 1G7LA 5ACZA 1HXMB 2BOBB 2X4UA 5FYJE 4NGHH 4JFDA 5ALCH 5I74C 4O4YH 1OTSC 4MDIB 3MUJA 4L5FL 2BNUB 5IW3A 4UIMB 3MBEB 1MQ8A 2OZ4H 2J4WL 1J88A 4OJFL 4HWBL 1X9QA 1D5BA 3GMMA 4LSRL 1A3LL 4QHUB 4RFOH 1NCDH 4FQLH 2BVEA 2WWMD 2P5WA 4BH7A 1XGYL 5B3NA 1QFWL 2HKFH 5JUEH 2WZPD 2KH2B 3HR5A 5IMLA 5DZLA 4U31A 3O4OB 3PABB 4FFWD 1FZKB 4OQ1A 4TVPL 2EH8H 5I1DB 5M94B 3B9AA 3RUGA 1EHNA 5AYQA 2E5EA 5A40E 1ZSDB 4N5EC 1DBKL 4CU6A 2D7QA 5D7IF 1ORQA 1UQSB 5IM7B 4HUVA 2NMSA 3MOAL 4JN1H 4HW6A 12E8H 2NXYB 3BVNB 1F3JA 3FQNA 4E41A 3WS6C 4O2FB 1QKZL 1IQDA 2D7TL 2PYEE 4N0FB 4PJ7B 4HMEA 2V5YA 5JO5A 1B4RA 2Y7QB 1TPXB 5HPOA 2OJZH 1JNLH 5JHDB 3T0AA 4J3OC 3VDAA 1RJZB 1CICC 2YKLH 4QRRB 2K1MA 5DRWB 2Q7YA 4M7JL 3RI5K 3QIUD 5HVFB 5KANI 3GGWB 2GW5A 1S3KH 2PYFB 15C8H 4RX4D 3Q2CA 1QPPA 4JFEA 5T1LD 4BSJA 4F8TA 3EOAB 3MXWL 5A3IC 4FZ8L 1NLDL 1MCOL 3EJJX 3WDJA 4Z7OE 3QDGE 4YFLF 1HI6A 43C9B 4HK3J 5D2NA 5ICZA 4IOFD 4GW5A 5L8LB 1MHEA 1RZGA 3ESVF 3WIFB 3W0WD 4HG4J 5KJRL 3IJHA 3H9ZA 4XRCA 3WLBA 4KI5D 3WXWL 1FBIL 5ADOL 2F8VA 1I7ZA 1MUJB 3FRUA 5IT2L 5BS0A 4PJHB 2OTWB 2X89A 5CJOH 3AC0A 1E6OH 4TVSa 3Q48A 3LKOB 4LVNB 1QA9B 3GHEL 3FO9B 3BGMB 2EH7L 4RAHA 1IGFL 1UM4H 4QRSA 1DANT 1A9BA 3LPFA 3I6GB 5FO7A 2Y06L 1IC7H 1ORSB 5FYJD 4I13B 2YD4A 3O3UN 4RGNB 3T1FB 3MLVH 5DMIH 1FH5H 2XFXA 3GBMH 5I8EA 3BH9A 3PV6B 4MJ5B 3X3GH 2VLJE 3HE6D 1G9MC 4N0FA 1AE6H 5D72H 1H5BC 4KJWC 4DN4L 1WAAF 2ARJB 4KPHH 1MHPH 1AJ7L 3QNZB 4ZO9A 5LVEA 1J5OL 3TWCL 2DD8H 1T1WA 3L1OH 5GS2H 1N6QL 4M6OH 2VR4A 4K7FB 1NMCC 2Q20A 2OL3H 4O2EB 3CVHA 4YFLI 5E8OB 3TZVC 4M8QB 4DW2H 1OTSD 1G7QA 3HPJB 2F74A 2H2SC 1P4BH 5GGUA 4JKWA 1I4FB 2R69H 2WBJB 4XPFL 4APQC 4JLRB 4GRWH 1T7XA 2DQUL 4XXCC 4KFZC 1WBZA 3KYNB 5JMRA 2IFFL 5A16B 3U46B 4Y1AA 1INEL 3F6LA 2EXWC 4F37F 1NAMH 1KEML 3ARFA 1NC2B 1HH6A 4FXKA 4DGYH 5C7XL 1OW0A 1JNNL 4MCYB 3NFPB 2VR9A 1F58H 4I0PD 1I1YA 4NKIH 4EI6A 5HI3C 1A9EB 1W0WA 1QLFA 2Z92B 4GUPA 5C3TA 3BGMA 3BKML 3KHQA 4WDIA 3BRDA 2IPTL 1UB5B 1P7QB 3RNQB 4U1GC 1PY9A 4WHDA 1FIEA 4YIQA 4FZ8H 3LKSA 5DHYB 4JFFB 1LO0H 1I3GL 5JA8B 4P9ML 3VE0B 1YY9C 3NCMA 5CP7B 5HGDA 5DI8B 3HPLB 2CMRL 4OGZA 5C8JB 5IEHB 2R1WA 5E9DD 4FRWA 5DHXB 4XP6H 5AYUH 4TRPL 4IRZH 1QFWI 2X4PB 4Q9RL 4LSTH 3ZDXF 3RIFK 3CAFA 1LE9A 3PL6D 5T1LB 1VGKB 2EKJA 4D0BB 3MROA 4KHTL 5HI5D 3IYLW 2VC2L 4R97B 3BW9A 4NO3A 2DQDH 2HMIC 4LHUD 4LPCA 2AJSL 4G7YH 5CIPH 1WVZA 1P9MA 3JV4A 2CJUH 5BXFB 1XGPA 5EIVA 3VCLA 4PRID 3OKMA 5AWNL 1X5FA 4ORGB 2DWEA 1REIA 3BQUB 3ZYOA 4LLQA 4MA7L 4U1IA 1I9JL 4QXUL 1RU9L 4L4VD 1MRCL 1A6VH 1FHGA 5TDPB 1JN6A 1I8KB 3VWKC 3L1OL 1QSVA 1DZBA 2VXUL 3CCHA 1MWAH 2R1YA 3DRTA 2VN4A 3EOAA 3D39D 5I73B 1K9TA 3MR9A 4XMLL 1ZVSB 5BVJB 2I5YH 1FLRH 4L4TE 3LKNB 5GRUH 3GMQB 3QWOB 5CINH 1MHPL 1SYSB 5F9JA 2XTJC 4L3ED 2HFEA 1V3KA 1JTTA 1F6LL 5BQ7B 1DN0A 2EYSA 3T65A 3DI2B 3HG1B 1FRGH 1CGWA 1GGTA 1P53A 1HYSD 3IXAB 4XMKH 4CVWA 2IADA 4I3SH 1SJHB 1LP9E 1KPVB 2OJZL 5JO5B 2BMKB 1ZWIA 4MA8H 3U9UB 3L3KA 2X9YA 5AUMA 2ERJB 3DX7B 1YDPB 2F54E 4JM2C 4HS8L 1KB5B 4OKVA 4JGUA 4ZSOE 1MLBA 3QDMB 3L3GA 4UOJA 1A7QH 2AXJA 4NT6B 1S7XB 3NAAL 4RSVA 5CEZE 1HZHL 1U92A 3T0BA 5CIPB 4NM4H 1ETZA 3IFOB 1JGEB 1DQQA 3OZ9L 1EMTH 1BLNB 3WO3B 5D1QB 4UOW1 1F2XK 3HR6A 3BEWA 1LO0L 2YK1H 1V3MA 4GRWB 4PGCA 2HKHL 3IAGC 4ZTPL 4NZRH 4N8VB 4H0IA 2FBJL 1UGNA 4LGSB 4UB0H 4KUZL 4BK5A 2VQUA 5EO1B 1R24B 4OLUL 3VG9B 3WN5B 1I8LC 4HPYH 4APQD 4C83A 3WXVL 2A6JA 4O2CA 3QIWB 1FVDB 1V7MH 1QRKA 1DJSA 1MCSA 3O8XC 2AJZA 1ZHKA 4POUB 3QZWB 1AKJA 4IDJL 5ESAB 1MFEH 4OCWL 4Z7NE 3PV7A 3P77B 3MJ9A 1ED3B 1B90A 3PP3K 1T22B 3CZFB 4PLKC 1KJ3H 4RZCB 2JJUA 4PJHE 3K1DA 1IFHH 2GJJA 1T4KA 2Y9RT 4RMUA 3V0WL 3U36B 1BEYH 1JWMA 1VFBB 1YEGH 3FFCA 4JRYE 4P46A 1IGTA 3U48A 1G7PB 1FYHB 1U91A 5EN2B 3FO1A 4PB9H 3PL6B 4MA3A 1H3PL 4X7DC 3TV3H 3WCYA 1DVFB 3EDDA 1J1PH 5JNYB 3QUXC 3CFJA 2YUWA 1FFQA 2FLRT 3QR2A 1R3JA 2Q8AL 5BV7H 3T77A 4NT6A 5TE6H 4HIHA 5GS1A 5EA0H 1U92B 1XF2B 4TUJB 3SGKA 1ETZB 4C4KT 4H0GA 2FJHB 2Y5TA 2VABA 4X99A 3L3JB 2XACC 1RZJH 2JE8A 5I74B 4L3EE 2OLDA 5CMAB 4MAYA 1D5IL 2XIDA 5CJ8A 3SDXF 1U3HA 5IB1B 2CIKA 1QFPA 3QCVH 1DBKH 2Q3ZA 5GISL 4A6YH 3HNVH 5SWZD 2Y5EA 3X13B 1UM6L 4Q0XL 3PHSA 1TNMA 2I07A 4Z7VA 5INDB 4LBEB 1L4IA 2EYRB 3QZWG 5SWSA 3QFJD 4AK1A 1NMAL 3OR7A 4NC0B 5HGGS 4F7EA 4YBQC 1E4XH 1FSKB 1VEPA 3CC5B 4UU9B 3F5WB 3NCBB 4JFYB 1T83C 3MOBL 5JW3H 4U6HA 1AO7D 3VXSB 5ADOH 2NY5C 4FQXD 2NY6B 2LAAA 1T04B 1BBDL 1H0DB 3DVFA 4ORGA 5T3XL 2GJZA 5GJSH 3LDBB 4YPJA 1NLBH 2ED9A 4GRLD 4GAGH 5I0DA 3QI9A 4NRXA 1FZMB 1KLFA 2MQ0A 4PTUA 4XVSL 1JWMB 1VFBA 2Z4QA 4M7JH 2P43B 5TE4H 4CMMA 1X44A 2G5BA 5LQBL 1QZ1A 1BF2A 3G04B 2WIMA 4NNPL 5D1ZC 3RIFF 3SPVA 1LNUA 4NKMA 4DN3H 4K94L 4PJCB 5HYEA 3O2WL 1CGXA 2GI7A 4G8EB 3FRPA 1OAZH 4DUVA 3HFMH 3EDKA 2VLKB 5DA4A 3QPXH 3SDAA 3VRLF 1XGQA 3RGVB 5SV3A 3FQWB 2BNRB 3P9WB 3H3PL 2Z8VC 1F4XH 2PR4L 4X80L 2Y6SD 2VOTA 4HLZG 5BV7B 5D1ZD 1IZKA 1ZV5A 3CSBA 5C6TH 2UZIL 1MPAL 1O0VA 3TWCH 2FDBP 2BSRB 4NBZB 1LP9B 2FGZA 5EU5A 1KBGH 1B0WA 2DQJH 1YDPA 1WF5A 2E7HA 1ZTXH 2CH8A 4PJFA 4GG8B 4TSBH 5FK9A 5D7JA 3A6CH 5D1ZA 5T5FL 4X6CB 1XGUA 5EBMA 5CJOL 4LNVA 5MP6L 4V2CB 4YDJA 4WV1C 4N1CA 1TTFA 4L8BA 1J0YA 4I48A 4LSRH 3DRTB 2IPKA 4HS6B 2AABL 3IB4A 2R4RL 1M7IA 2QSQA 3KWWA 1VCAA 3QWOA 3QJHB 5AAMA 1QQDB 2J3SA 4HJGB 4F7CA 2ITDB 4J3SA 3IU3B 4QO1A 3R1GL 3L5WA 1S7QA 2VRAA 4ODUA 2R1XB 3QEQE 3BZ4B 4YXLH 4DGIH 4D9RE 5H2BA 2DJ4A 1KC5H 4LSVH 5F89B 3UTPE 3STZA 4HEPG 1DTUA 4P2RA 2AJZB 3RKDD 4NJ9H 1IKNC 4KROD 3TYGH 2A6DA 5DVOA 2J8UE 3RGVC 5LXGL 4LHQB 1GIGL 5EO0B 3L3GB 4ZXBA 4KVNL 1D5IH 2VJXA 4OZ4B 5SWZE 3C60C 5FYLD 3GMRA 4LCCC 5FCSH 4TYUA 1T1WB 4ZO8A 4FN0A 3KPOB 4JPKH 4ODXA 2E7CA 2NY2D 5DUPL 1P4IH 4LLYB 4PJEF 4U6VH 35C8H 4NUJA 5JOFA 3PL6C 4HJJH 1JPTL 1NC2D 1MJ8H 2HJKB 1BOGB 2EDNA 2FLBT 1MCJA 3JV6B 3UO1L 2KUTA 5D7SH 3WIIH 2AJYL 5EC1B 5F7KC 1ES0A 1JNNH 4KAQH 2A1WL 1OTUD 2NXZC 2YHGA 3ZE0F 5LQBH 2M2DA 3PWUA 4GRWE 4QXTB 3V0WH 4I77H 1QBAA 1WSST 2EEAA 4P9HH 4OT1L 1J7VR 3MRDA 3ECBA 2P8MB 3HE7C 3TBYB 5BZDB 3GSNH 2J88H 1PLGH 2HJLB 2CIIA 4NWTL 1VEMA 3T0XA 4KK9D 4G6AD 1U93B 4YHPB 4JFXB 1S7QB 4LCIH 3QEUA 4ODUB 3GMLB 1G6RA 1HEZB 3HMXH 4M6ML 3FRUB 4TULH 4K3JL 2ARWA 5DEFB 4ZYKB 1CTOA 2BSTB 4GW1A 3UJJH 1YECH 5BO1H 3T04D 2ZOKA 1FL6B 1RHHA 5ICXA 4XH2A 2IAMA 3LKQB 1OP3K 3S35X 2J88L 5C0CB 4R4FH 4BFGA 1EBPA 3N9GL 4JRYB 1UH3A 4LCUB 1U8PB 1Z9SA 1RUAL 2CR6A 2QQQA 1S7VA 3SGJA 3NIDF 4JZJA 1BZ9A 5C0JA 4KDWA 3OHXB 3O41A 4RMVA 4X8XA 4XCCH 5AAWA 2QV2A 4OBRA 1DN2A 2BY2A 2BVUA 2DDQH 1CDIA 3T0EA 4PRIB 4PJIA 5GGRA 3INUL 1YMMD 4WI6A 4OQTH 2XPGA 4GXVL 1X7QA 1UACL 2H45A 5D71H 2DM4A 3EO9H 3KYOA 4WEBH 3JWNC 3P73A 3BJ91 4AEIH 4OV5B 3O3BA 4LVEA 5TJWK 1RUMH 2DM3A 3BMWA 2VLKA 1Q0XL 4UIMA 3CVHB 2EE2A 1T0NA 2ZUYA 1CG9A 1KTKE 3ULSB 1GAFH 4KJQC 3RAJL 3WDHA 5D2LA 3W9DB 2EO9A 5JIHA 4V1DE 4G80A 2YA0A 5EORH 1FAIL 5BZDA 1C5BL 2N4IA 2HRPL 2J6EL 2OTUA 5TF0A 3VWKA 1HSBB 2BVPA 4OB5L 4KTYA 3D2UA 4N0UA 4YDKL 1IE5A 1JV5B 1MJ8L 4YHNA 1YNLL 3KPSA 5FAAA 3VFMB 1HEZA 3F62A 4JY6B 3GB7A 3MC0A 4I48B 3C5JA 3NFPA 4OZFH 4XT1C 3MNVB 3IDGA 5TFSH 5E8DH 3SKNB 3T8XA 3WIHH 3UTOA 1TZIB 4G8FA 1K8IA 4NZRL 3DUSA 1OT1A 2R2BA 4HHAB 1EUTA 5HYSG 1N5YL 4HFWB 1UM5H 2R1XA 5IGXL 1RZKH 3QO0B 5F1NA 1FVEA 3GSNA 4MJID 2CRZA 3BH8B 5I1CH 2VSCA 4XI5D 3FFDA 4P59L 2ZCLH 1HQRB 2DQHL 2DB8A 4NQCA 1WWWX 5D70H 1E4KA 3NPSC 3QXWA 5GS0H 4I4WB 3QEGH 5HGBB 5BO1L 2ZUWA 1N26A 2X7LB 4QRRA 1TVHA 5L8KB 3FB6A 3RWGA 4WI4A 4ZOAA 1C8PA 5IMKB 2VDPL 1HN1A 3PABA 3BP6A 4P4RB 5JPMA 4L1HA 4FQLL 5TQ0H 5ANME 5E03A 5HSFA 5L2KD 4NUJB 4BZ2L 3MRMA 3D69A 2X89D 2Y36L 4AM0A 3SDDD 4GOSA 1TVDA 2J5LC 4XAWH 1KCRL 2IFFH 1T7ZA 1ZGLB 1QBML 1Y0LA 3HZVA 1GGCH 2YUZA 4XRCB 5F8QC 4GH7B 3IU4L 1XIWC 4R6UA 3I75B 3X12A 2FSEB 3ARFC 4PGBA 3ZKMD 3HUJB 1BQSA 3HC4L 5CFHA 3WS6A 4L8CA 4F7PB 3V4PL 4EUPH 3QSKB 5H35B 4AG4L 5D8JH 1RJZA 4PRDB 3G5XB 1SJEB 4ZPTA 5HDOA 2H2PC 4MXWH 1OSPL 3BIKB 2M8XA 1RIUL 1KYOK 3EW3B 4X6FB 2VTFA 3L9RA 1T80A 2CMRH 5EU6E 3X3FL 3BEVB 3SCMA 1UWEH 3M1BA 3RAJH 5HHPA 3FCTA 3MGAA 1KEGH 4N0YL 5DK2B 5ICZB 1DLHB 1EVTC 1BQLH 3BI9X 5J13B 3S5LB 3C5ZD 3HE7B 4TSAL 3G6AB 3VMPA 2X70B 4HIEA 5IV2A 3ZDXE 3BPOB 4PP1C 3LMJL 4JPWL 4LCWD 4LEXH 5ACZB 3DX9B 3VRJB 4AZ8A 4MB5A 3LRHA 2ED8A 3REWB 1LP9F 4QY8A 4F7EB 2NY5L 1QNZH 4ZPVB 4LLDA 4BKLA 3NCYS 3CH1A 4HKXB 4S0TD 1WUNT 4ODBD 1DQLL 4QRUB 4G43B 4GJTB 3HMXL 3SY0A 4F8QA 3GM0A 4UQ2B 2VZSA 4JY5H 3EGSB 5HI4D 3RVUD 3LVEA 3RVUC 4DZ8A 3ZT5A 2PXYD 2YEZB 1PJ9A 3MFFA 3ZDYF 5IT2H 3ALXA 1OGTA 3BT2H 4PIRF 4NNYA 4XC3H 3AU1B 3HUJA 3HA0A 4YBQD 4MDJA 3EYSL 2DLIA 1ZLSH 1ZVHA 2ADJA 3U82B 1P84J 4DKEH 3VFGH 3QUMA 1MAML 3QUYC 4I3RL 4U1GB 2BNQB 1DL7L 3L3IB 4DN4H 3CSPA 4JAMA 3LN5B 5JXEA 1XGQB 3RGVA 4H5SA 2NX5A 5H37G 4P46B 5GZNC 4JPIA 2AS5M 3FCTB 2QQKH 4RDQG 5F7UA 2IG2L 3EO9L 3TESA 4WI7A 2CGRL 3NN8A 4JB9H 4HWNA 4FG6C 1UWXH 1RIVL 2XXCB 2W59A 3IRPX 4S11A 4PRNA 3MRGA 4AIZB 1Y18B 4DFIA 3KYKL 2MPAH 2FGWH 4NP4L 3BP5B 3BXNA 1ZGLM 5EFIB 4UUJA 5DRNA 2GQHA 3H42H 4QTHB 1FNSH 1V05A 5E2UH 1YEIH 1A22B 2B2XH 3B5TA 4TUJA 4L9LB 1IGMH 2VABB 4I1NB 4I9WD 4LSVL 4DQOH 3ARZA 1WBXA 1HINH 2BRQA 1IC4L 1C7SA 2ZNXA 4APQA 1WFUA 4MAYB 5EU3B 2ATKA 4G9FB 4XBPA 1X5LA 4LLQB 1WCBB 3QDGD 5DWUL 1ZLUK 1A7NH 4PGZA 4AENA 4Q6IB 2E9BA 4NPYB 1M7XA 1DQDL 4HKZB 1ZT4A 1E4KC 3MJ6A 5F96H 4UDUB 3S3PA 5DZOA 2IQAB 2IGFL 2E9IA 2QADB 2YD1A 4LLAA 2EDDA 1L0QA 2ZSVB 5DT1H 4FQ1L 2EIZB 5IB2A 3B9EA 3NH7H 3IXAA 4LSQL 1NGZB 3K80A 1R5WB 4PJFE 4JAMB 1JL8A 3U4AA 3FZUC 4GRWF 4X7TA 4LASL 1SJHA 3RX7A 3C5ZB 2FSEA 4YX2L 3PWLB 4KAQL 3KPRB 1CFQA 3R4DA 1MLBB 1G9MH 1OM3L 4E41D 3K7UA 1S7XA 4OLWH 4PP1D 1J11A 1CN4A 3L6FB 1N7MH 4ZXBD 2YN3A 2JJWA 4P46D 3IVKA 5H94A 3MUHL 4K7FA 1Z3GH 3KYAA 2DQJL 4MXQD 3VFGL 1RJYA 1SY6L 1RJCA 4KTEH 1J0IA 4ZNEA 4JLRA 3FO2B 3P4MA 4Y4HD 4QXUH 2AK4A 4LAJH 3SGDH 5E08H 3LH2H 1WISA 4DEPC 4EDWH 2E6PA 1CE6A 4PJBE 4N9GB 1LWRA 4DCQB 4Y19A 2RJMA 3D9AH 4KK8D 4MWFB 2AEQL 1D3CA 1UG9A 1DDHB 1XGRA 1BX2A 1V5JA 3UTSA 2BCKA 4ONGL 4S1RL 1FPTL 1G9NL 5JUEL 4NKQB 2NY4B 3DRQB 4OLVL 4N68A 3VMNA 4KH2A 4JQXA 4QRUA 3MRIB 2Z92A 1A7RL 4LGRB 4QT5A 3B9DA 5F7NC 3TPUA 1IM3A 1D7FA 2DRUA 4Y5VC 3RNQA 3FFCB 5DURD 2BVQB 5DQ9B 5DD6A 2ADGA 2OL3B 2XTLA 3RZCC 3AGVA 4DQOL 4ZUWB 2CK0L 1DQQB 1U8MA 3QYCA 1YC8A 3VE0A 1YEDA 2VXVL 2CUIA 2B2XL 2C26A 3JBG7 5T3XD 3IFPB 3MRCB 1A7NL 3NAAH 1QSFB 3IFLL 4PRPB 1PKQA 1QNZL 4QRPA 1YUHB 5C0BB 4MJIB 3CLEH 1T3FA 2HYMA 3QRGH 4M93C 3UC0L 5EZOL 2IF7A 2FECL 3HFML 5EB9A 3QUZA 5C6TL 1FFNB 3BP7B 4TRPH 1ZK9A 4ELKB 3OX8B 2ORBL 1NUNB 3LN4B 3SDXA 2BFVH 1NAMB 4NO3B 1VB9A 4QOKA 4QRRD 4LNRA 2Z31D 3ULUE 1ZGLP 4XNXL 2AEPL 2OXGA 4Z7QE 4AEHH 4MHHI 4PG2C 5F97E 5IIEA 3ARRA 4OFPA 1SY6A 2GCYB 2D9CA 3MA9L 4GW5B 4CW1B 3JVGA 5L9DH 4J12A 4XVUD 1MCWM 1WC7A 2FX8H 4U1KA 2QHRL 5KSUA 4P3CL 2FECI 2AV7B 3GJFA 4IMKC 5IB5A 4P57A 1F42A 3DXAB 3CXHJ 4YDLB 4G8GA 4GBXD 3VFMA 3H7LA 3AVEA 5BS0B 1Z9MA 1HIML 1VGEH 1EA9C 2OTWA 4E41E 4NFBA 1U8LA 2OL3L 4KGLA 4YO0B 2ZUSA 1IVLA 3AAZA 2V2TA 2B1AH 1CICD 4BUHA 2WINA 2Y25A 2P8MA 1IFHL 2X9XA 2Y6SC 4HHAA 3BUYA 4LHUB 4P2OD 2QQLL 4PJDA 3GHEH 2VLMD 3DYMA 3R06B 4GBXC 5A2LH 3P9MB 2P5WB 4Z95H 4BH7B 3GSRB 5D70L 4XGZB 4EDXA 3U9PL 1BD2D 5DJYA 3X3GL 1MIEH 2BOCA 3RX5A 4QOKD 5EZJB 3VGEA 4ZFOA 4YNYB 1JGLL 4GAJH 4R8WH 3SKOB 5DFWH 4AEIL 5F3HB 1F00I 5E08L 5J12B 3E8UH 5L88L 3SDDA 2JCCB 5JMOC 4FQPA 5GIRA 4K8RD 4V1DA 4HBCL 4HXBL 1CLCA 1PQZA 1HH9B 3RTQB 3V5DA 4OF5A 4Y1AD 5LGJA 1R5WA 2C3WA 3P0VH 1OAYH 4ELKA 2C4FT 4X6BA 3GSOB 4P23C 3UO1H 1KGCE 1CDCA 4XP1H 2IFGA 1RJLB 4Y4KC 4PJ7A 1KXTB 3AS0A 5GGUB 4DVBB 3GFUA 4Y4KD 3L95B 4AEEA 3D85B 1A1OB 5DD3L 3WL9B 1NCAL 4NCDA 1CBVH 4PV9B 2CKNA 3VXUE 3KJ6L 1B0GA 1RIHH 3E2HB 3G6DH 4WHYG 5FK9B 1MNUL 1S7WB 1WJ3A 2C3GA 3KLHD 1IM9A 2JK5A 1KUMA 2GITB 5B3JF 4P57B 1NC2A 1IT9L 5FM5M 4HZAA 2EZ0C 1EERB 2Y1VA 4OGAC 3WLWC 3UX9B 5F7LB 3QEQB 4NQDD 5GPRA 1OSZA 2BRRL 3FTGB 4M62H 1FGVL 1U0QA 3BD4A 5L6YL 4NWTH 3ZE2F 2AJUH 1Z0NA 4E5XA 2X42A 1MRFH 1ZLWK 3EHBD 5E9DA 2WUCH 5AZEH 3RVWC 1TJIL 3L3DB 1NAKL 4L4TA 1OOAA 3O6FC 2DI8A 5C0FA 3DYPA 1IT9H 4KKAD 1CE6B 3LOWA 3WNPA 1RK0A 3MACL 2F53B 4WFED 4HCRA 4PPTA 2VDKL 4Y88A 5D6CA 3TZVD 5T3ZD 3ILPA 3KPRA 1MREL 1WT5C 2AJYH 1X5ZA 5DK0B 5E99H 1SY6H 5HHOA 5FUCC 3VI3E 3T4YA 4NN6B 3W11D 1F6AB 3QG7L 3L6FA 4PJFB 1A3LH 3AROA 4QRTA 4BJLA 3T0WA 1EUUA 4KKBD 3AB0B 1XGUB 5EBMB 1D9KB 1IAIH 5D4QA 1YEKH 3IRZA 5FO8A 1T1XA 1RURL 3GNML 3EO0A 2QHRH 5CJBA 4LL9A 1ORSA 4M6NL 4JY5L 2O26U 4YZFE 1D6VH 4HKBB 2OYPA 4JB9L 4Y1AE 1I9EA 2X10A 3QJHA 1H9VA 1ZEAH 1RZGB 4M4RA 5FV1L 2PCPA 2CD0A 4PGDA 4YH6A 1VESA 3FN3A 1OHQA 4XVUC 1JK8A 4WGWB 4Y19B 1DEEA 5CGTA 1T21B 4L29A 2I07B 2IH3B 3HAEB 1BOYA 1K5NA 4XVJH 2ICEA 5IUSA 1IKFL 4YUEL 2VZUA 2VWEC 4M7ZB 3ZYIA 4OCNC 3S34L 3W39A 1MAMH 4PJAE 3BESR 1NAMA 4ZUSA 5KVGH 1MCQA 5E8NA 3IDUA 3IGAA 4Z7WF 3FMGL 4DOHE 1A6TB 3AREB 5ITFA 3MREB 1PGRB 1KEMH 5A43C 1QFOA 3S6CA 3JWDL 4PRBA 2PETA 5EBWB 2MSPA 4RGMC 5IMMB 3M07A 2J2ZA 3BWAB 3H3BC 5KSUB 3OGOE 1CBVL 5DYOB 4R90L 3IJYA 3PWJA 5TGBA 1KJ2L 4K7PX 3FFCE 4B7LA 4YJZL 1ORQB 1UQSA 1VFUA 4LKCA 2VLRE 3PUCA 1QYGL 3QJFB 3SDCB 3PP4H 5HHXL 4R3SB 5HI4C 1INQB 2Z31B 5FXCH 1BWMA 5D7JC 1LE5B 2XQYG 1ZS8B 4JZNA 4HT1L 1EXUA 5BCAA 1A8JH 2A73A 3FB7B 3N1GC 4KJQD 2H26B 1NGXA 3QXAB 3QIUA 4U1SA 4LSTL 4MJIE 3GIVA 1BBJB 3CJJA 1CK0L 2B4CC 3V5KB 4RAUA 5KANG 3V6ZA 5HYSA 2C1PA 4NN6C 3GJFH 3VGGA 1RZKC 4P99A 4HH9A 4UV7H 2XZAL 4KQ4L 2X70A 5AYUL 4EXPX 1JE6A 1LDSA 4ODHL 1G1CA 4YC2B 5KZCD 1AGCA 4I0PA 1J1PL 3U6RA 5I0ZA 2UZYB 3O2DH 3QIWA 5IWLA 3SBWA 1WFTA 1HDMA 4D0CA 4NN5C 3HNSL 5K9OB 3VXQB 4WI9A 2KZ1B 4HS3A 3OWEA 2HWZH 3I50L 4MA7H 1WWBX 3ARGA 3GSNL 4IOIB 3T3PE 4P23D 4RWYL 4Z95L 2GSGA 4XNUH 4C54A 2IPUK 1R3LB 1F3JB 3QDJD 5E94A 2AK4D 1A1NA 5JIPA 1QLRB 2H8PA 3V4PH 3JUZA 2E3VA 2R56L 5CZVL 5FUCE 3D5OF 4PUBH 4NNYB 1CGSL 4Q9CA 4XNMA 5TDPA 3RJDA 4DJMA 2X4PA 3DTXB 4RISL 5JZ7D 3CCHB 5E2WL 4H26A 2IMMA 2ZCKH 1HOCB 3TCXA 4KJWD 4CAGA 1HHGB 1DBJL 2F58H 4X6EB 1KCLA 5EA0L 2VQ1B 1YPZB 1UWGL 5EUOE 4FFYL 5FF6B 4H5SB 1U8KB 4HIHB 1TJHH 3LDBC 2XZZA 2X4SB 4P2QA 3RFZC 3DLQR 4LKXB 5IW1B 3JV4B 1JHLL 4JGMA 2AJXL 1F4WH 5IESH 1NKOA 1F8TH 4EKXA 1VEOA 2XA8L 4XVSH 3L5HA 3T0DA 4YR6A 2W65A 2HA1A 4BFEA 4U0QB 1DBAH 5ISZE 2ORBH 4HJ0C 5F6HJ 4GMTH 4X9BA 3VFOB 4OZHF 4NUGH 4OAWB 2F54B 2CKBA 3DETC 3H0TA 4CL7A 4YBLC 5EOTA 4WFHD 4LCYA 4NQDA 4LDLB 4QTHA 4L8SA 3MPCA 3U7AA 3LV3A 4ETQB 4KY1L 1JBJA 3FTGA 3MV7A 3TEUA 2D0GA 1ZKAA 4PJXA 3GO1L 3TGXA 3VXNA 3SDAD 2HT4C 5BQ7A 5HDQL 5EC2B 2EDKA 5DFVC 1S9KC 2LVEA 4PGCB 1Q0YH 3LS5L 3TH3T 1G9EA 2APFA 3V95A 5FYKU 4B7IA 4HAGA 1BBDH 5JOPE 4KRPC 4OF7A 5CLTA 4X9HA 1U6AL 3MUY1 2Z35B 1D9KD 3DV4B 4GSDH 3G5ZB 3CMOL 4DKEL 3HC0A 4U3HA 5IVZA 4Z5RB 5KSBA 1LO3L 3DVGA 4PBXA 1R3HB 4BA8A 3TVMD 4U6TA 5FO9B 5ERWA 3WFBL 3MODH 4HXAH 4R0LA 3VWJD 2AABH 5C0AE 3FN0H 7FABL 3RWGB 2C9AA 3O4LD 4JZJB 5CGYC 5EBWA 4I0CC 3O41B 1RZ8A 3F58L 4NRZB 4F7MA 5FB8B 3OF6A 5JPMB 1LK2B 1BLNA 3P40A 1S78C 1DQJA 3HCVA 3G5YA 3MLVL 5LAXB 3ZTNH 3EDFA 3UTSE 2BX5A 4UV4L 5DJDB 3K4DA 1IC7L 4L29B 4XVJL 1FNEA 1HE7A 4QKXB 3WEXA 3QXDB 4CVXA 4W70A 4Y1AB 2Q86A 4C83B 4LLDB 3Q6FB 2WM0A 1UZ6E 5DVMA 3I75A 4KDTC 4GQ9L 5D7LE 2X4OA 4FQXB 4OZFG 2HP4A 3DX9A 4MA8L 4Z76B 4KU1A 4L8CB 3GUTB 3VWJA 3ULSA 2O5ZL 1F02I 2A74B 4KMQA 4XC1H 3QUYD 5KVFH 2EDFA 2DQFB 3MRNA 4DZBB 1SJEA 2EKSA 1EO5A 2UY6A 1MCLA 3ZMRA 4PRBB 3UTTB 3LS4L 4HSQA 5LCVH 3BPLC 3U9PH 2MJWA 4JFHE 3D0LA 4XXCA 4HH9B 5KSBF 3NA9L 4E42A 4WFGD 1DEDA 3P4LA 4PBVC 2OTUB 5EBLA 32C2B 3B9KC 4L3EB 5TPWH 3IJYB 4ODWB 1BFVH 1K2DB 1JN6B 2OR9L 3S88L 2JTDA 4Y5YB 1OAXH 4YHIB 2MQCA 5CP7A 5HGDB 2BNQE 5AZEL 3X11A 1IKNA 4MSWB 1DFBH 2YS4A 2DWDB 4H1LA 4Y5XA 2GJ6E 4WWKA 2UWEE 4NQVB 1T1ZA 5EU4A 1QVOA 4JO4H 1AD9B 5K9JH 5E6YA 3KYMB 2DLGA 3V7AG 4U2YA 4OCRL 2A0LC 2PO6A 4KI5E 4P4KA 4AEFA 3VD3A 4KK5C 2JIXB 3L3OA 3BW9B 3CLFL 4UIKL 1EVUA 3O9WB 4JREB 5K9KA 1S9WA 2JB5L 2O93L 4HUUB 4OKVB 1MNUH 1BWWA 3RZCB 4KV5E 2DAVA 2ZKHL 3S35L 4CADA 3T1WA 2C5DC 3Q0HA 4L4VA 5IHLB 4HUKB 4HIIA 4UAOB 1NFKA 4F9LA 4G9FE 3BP6B 2D4DA 4QNPE 3OXSA 5C92A 4TVPE 3PQYD 2BC4B 3VGAB 5CZXC 3MODL 4ZO6A 2APXA 2VLKE 4JRWA 1YPZE 2NW3B 2XZCH 1TZGL 1NFDE 5D2NC 4RISH 1G7IB 3LEXB 3WUWG 4X4YB 3U46A 5A16A 4WUUB 1I7UA 1NSNL 4FZEL 4NQEA 3OB8A 3ZE1F 4UINH 2W0FB 3H9HA 4YDJB 4FQCH 3GMLA 1DUYA 3JTTB 5E2WH 3T08A 2VAAB 4G42A 1N8ZA 3GDBA 5FYJL 4OSUH 3RGHA 3KPSE 4LSPL 3OXRB 4WJ5B 5HHMB 3CDGB 3RWEB 1HXYA 3SE9L 4PJ8B 5IQ7H 5HYJA 2FZ3B 3V0VB 4TNWK 3KNBA 2Y7QA 5C0JB 3MRPA 5KSVA 4Z8FH 1UB6A 4XHQA 2DKMA 1UH2A 1H3UA 3G6JF 5TPWL 3ULUF 4M48H 2BVYA 5IROA 4D0DB 3GZKA 3TZVA 2GFBA 2R1WB 5J9PB 4PJIB 5GGRB 1TTUA 2R2EA 3G5VB 3EZ8A 3E6FB 4OFVA 3JV5A 1N64H 4HD9A 4X7CC 2DN7A 2VLJA 1RJYB 1JPFB 2IAMC 1P6FA 4NQCE 3DIFA 2Q7YB 2I9LA 3NZ8B 2D7NA 2IMNA 2DM2A 2VLME 4WU7B 1HH9A 1NCUA 5C0AB 1OAZL 2B5IB 3OKYA 2XTJD 3EOTH 3U0WH 5H37H 1CD9B 5E24E 1LD9B 4YZFF 3RVXD 5I76A 1T7YA 2AP2A 1CVSC 4LRNL 5JDJA 1R3KB 3B3IB 5FYKL 5I8KH 1D5ZA 3T3ME 4MWFA 5HHOE 5K9JL 4F7TB 1ZHNB 1KJ2H 1MHCB 5EC1A 4GAYA 3WIFA 1JPSL 5BOPA 3GEWB 4LPWA 4P2RB 5DJZA 3FT4A 2G9HB 4OZGF 1JUFA 3MLTB 5DMIL 2OCFD 1YNLH 1V7ML 1Z0MA 3ZL4H 3CNKA 3GRWL 2BVQA 1X3DA 1M71B 5GRWA 4OIBA 5CS7A 1QA9A 1XCQA 1N59A 3Q5OA 1R3IH 4EI5A 1C5DA 2ID5A 4HC1A 4OZIF 4QHLB 1RU9H 5E5UB 4H8WL 5E4IA 3BISA 4JFQA 4OCXL 4UT6L 5I8CA 1PLGL 1A5FL 4M7KH 1K4DA 2PW2A 5JOFB 5BMFH 1PAMA 2EZ0D 3G04A 1V7NL 1LO4H 4WCYH 3U1SL 1EH9A 1U8QB 3AUVA 4GQ9H 2FHCA 3D2UD 5ECJE 3WKML 5I1LB 1T2QH 1A14L 4PFEA 2NY7L 3U7WL 3FT3B 1J0ZA 4WWKB 4R4BA 2Q86B 4OD2B 5BS0D 4WV1B 3QUYB 3UBXG 3EYUL 5F7MC 4HV8A 4QXTA 5C0CE 3UPAA 1UXSA 3S8WA 3UTSB 5J8OA 5MHSD 4MDIA 2WANA 3TV3L 5D1XD 3VRIA 4KJYA 4XCCL 1V3JA 4NUGL 2VNCA 5IVXF 3IAPA 4NHCH 1FO0B 1UH4A 4ENED 5MENB 3QI9D 5D7JB 1T04A 5IBTH 5BS0E 2ZCHH 3WFHB 3FAXA 5E94B 2QL1A 4L8BB 3ROLB 2WW8A 4MNHB 2HG5A 1NBVH 1INDL 3X14A 3LEVL 2EC9T 3CVIL 4F7CB 1KJVA 4JHZA 4LOUD 1FNLA 4PY8I 5KVMC 3K4ZA 4O02L 4PYGA 4GS7B 3WUWA 1LO5B 1NFIB 2HJFB 2DOCA 4MS8C 5ELIA 4F9PA 1KTDB 1NAKH 3VA6A 3FOLA 5DC0A 4XMPL 5H2BB 4AIOA 4LSSL 4N8PA 1W0VB 3STZB 5I2IB 4R26L 3ARBC 2NY6D 3GKWH 2GYSA 5BJTA 4KRPD 4PTTA 3IDNB 1LP9A 2WQRA 5FYKE 1CFTA 1DLHA 4U3CA 4G6FD 3VXRE 3BGFC 1M6OA 5CEZD 3H2WA 4XNXH 3VFOA 3Q1SH 1Q38A 2PTUA 4HWBH 3GNMH 3L5IA 2MTPA 5DUBB 4XP6L 3LS5H 1AGDB 1MRDL 3HI5L 5LWYH 4BKLB 2MKLC 1S7TA 5I1AA 2P24B 4KJYB 1FL3A 2VITB 1CT8A 1EJOL 3DX8B 5EC2A 1N0XH 4XPAL 4UZGA 1U95A 1ZA6B 1JGDB 1ZLWH 4N8VG 1F4XL 3GBML 1KIPB 2ZG2A 4MAUL 4XCFH 3UTZB 3NIGE 3MRQB 2PN5A 4FXGA 4LF3A 1TVBA 4U1IB 3F7QA 3D1MC 1MHHB 2HLAB 3K2UL 3KLAB 5KSBB 3JWDC 1T03H 2OMBA 7FABH 3MUGB 4I18A 3WHE0 1VPOL 4WUUE 1TZIA 3QHFH 2F53E 3EIFA 1NJ9B 5E6ID 2V7HA 2H9GB 1FG2A 1PDKA 3U0TA 5HDLA 1QSFD 3IT8D 1OW0C 2HJFA 1D6EA 3SOBL 2R0ZL 5F9WC 8CGTA 2WBKA 5F9DC 1J8KA 1FZMA 1I9RH 3HNTH 5HHME 1KIRB 2Z4QB 1AR1C 2DTSA 4JPIB 5D5ME 4XNMB 5JW3L 1DBAL 5TH2A 2VLRD 3VGFA 3WNMA 3L3KB 4R2GB 1MVUB 4OUOA 5BRZE 2EYTA 5F7DA 3P0YH 1E28B 4U6YA 1DE4A 4W6XB 2MPAL 4TNVK 4FMKA 4RMWA 1IM9B 1WK0A 5HYQA 2ESVE 3IKKA 4GQPH 4W6WB 5M95B 5D1XB 5EFIA 4JPVH 3ARUA 2VE6A 3QISA 1FORL 1BGXL 1JYWA 1OAUL 3V8OA 1EEZA 4LU5H 4DK6A 2W60A 1CWVA 4Z7QF 2ZUXA 1FYTE 2R23B 4XPGL 5EU6B 3BKYH 1GVIA 1M05A 5F9OL 4Z0XA 1IEHA 4XBPB 4BZ1L 2VH5H 1JGDA 4LIQH 3VFRA 3QRFM 3VFNB 1A64A 1FVDA 3FQUA 1KIPA 3K0WA 1KOAA 4WY7H 4HV8B 1EEYB 3SO3C 2V5TA 5C71A 1MJ7H 5IFHL 4PJ5A 3TO4D 1E4WH 5HHOB 2OP4L 2DQHH 4ISVB 4P9HC 1A6WH 1NCBH 1KELH 1NJ9A 1JFQH 3MGTA 4PD4K 3BWAA 1FG2B 1I9IL 1JRHH 2AQ1A 3Q5YA 3D2UB 2BHUA 1AQDA 4Q9BA 1VFMA 2X4RB 5HJ3B 5FYJH 1MJ7L 5MENE 4KKCD 4NZUH 3H3KA 4NZTH 3GB7B 3ARBA 3HZKB 5BVPH 1I3RA 1CF8L 2GSIB 3U36A 1AFVL 4BUGA 5F1OB 5F7WC 2VDQL 3CPLA 2V6HA 3MGOA 2D9QB 4WW2B 3LY6A 3PXJA 1GGCL 2DMCA 1HHHB 2FX9H 1QEWB 1I1RA 5C70A 4XAWL 5I1CL 2IH3A 2H32B 5EOCH 2JCCA 5L2JB 3SDCA 5CCKH 3WUWB 5SV4A 4GG6E 3ULVH 1SJXA 3VJ6A 3T77B 3F7VA 5HHVL 3HZMB 5SWSD 5CILH 3GIVB 2M1KA 5CLWA 3SJVB 1EO8L 3WL9A 3EYFA 5E6ZA 1CFTB 2D0FA 3O81A 3J8F7 1Q9WB 4MCZB 3N06B 2DWEB 5ICYA 5C0EB 4RFEA 3WSQL 2R0KL 2COQA 3N1PC 2EXYC 3RPIB 2FGWL 1I9RL 1MCNA 3C6SA 3GSQA 1CE1H 3O3EA 1F3DH 1FVCA 3VI4E 4I2XB 3QXTA 2NW2A 3B5HA 5B4MD 3T2NL 4MHHG 3P4NA 2HFGL 1MFAL 3GM8A 3O9WD 1EIBA 3P3YA 1GSMA 1KJMB 1J0HA 4YHMH 1AGFB 2AXFA 5CWSA 1HKFA 1ZWIB 2YR3A 1JF1B 4JQIL 1U8MB 4LMQI 2A9ML 4J3XA 2CLZB 1IGIH 5EUOB 2P46B 3VG9C 2I25N 4MZ3A 4OZIA 3CFEB 4J1UB 2X41A 1UWXK 4CNIA 1CFBA 3MXVH 3QNZA 4KUZH 5DRXA 2X7LA 4Y4HB 4X0KB 4A2MA 1KELL 5CD3B 2A9MH 4KDVA 5I75B 3F7RA 2VDLH 5ETUB 5FHAH 5ISZB 1GZQA 1KLUB 3FONB 2GIYA 3HZYB 1YMME 3O9WA 3L7FA 1G7QB 2FJGA 4JCMA 3FOMB 3BGAA 1R5VB 2J8OA 4JDTH 4Q6IC 2AK1H 4K55A 4YX2H 1ZAGA 3GHBL 5C9KA 5GS0C 1UM5L 3CFBB 3BPCA 3NFNA 4PJ7E 4AEHL 4F7TA 4CW1A 1MCHA 1S9VA 3UJIH 4OV5A 5ICYB 2GTZB 4KK5D 1WCQA 3VXUA 1WWCA 4OZGA 1A47A 5HYJE 1MAKA 1H3PH 1PZ5A 4HJGA 1EHXA 2GK2A 1N6VA 4S1QL 3GHBH 3U4BL 4UAOC 4X5WB 1D5MA 3B6SA 4JFOA 3WKMH 2YSSA 3KWWB 4MD4A 3LD8B 2FL5A 3OSKA 1EHLL 4TTDC 1CDBA 5EOCJ 3EBAA 1G7IA 3LEXA 4I5BA 5E7FA 3TO4C 4EN3D 2VERN 1MY7A 1YEHL 4DCQA 1MCEA 4G5ZL 4ELMA 1NC4B 4KKLC 1J8HE 3GSRA 3VH8B 4PJGB 1MCKA 1N4XH 3C08H 3QWRD 1EHLH 4NHUB 3SDXE 5TDNA 3WSQH 1I7RB 4Y0GA 3VFUA 2FO4A 1YN6B 3BZFB 5H94B 5DDHA 3KPOA 2NPLX 4YXLL 4IM8A 4KI5C 1LGVA 1FG9C 1U58A 2VXQH 4MJ4A 4IBLT 2VE6B 4DEPB 4DK3A 2OL3A 4QHKJ 1NMAH 4JHAH 4RMSA 2A1WH 5LAXA 2W9DH 1CFVH 4KUCD 2AGJH 5IWLC 4NQTA 5IFJA 2YPVH 3RVVC 3FOMA 5KBNC 4JHWL 2CIKB 3WYRA 4WHCA 2ARJA 4FQXA 3AS1A 3EDEA 1ZLVK 3TT3L 4YHKH 5ADPH 3L7EA 3UC0H 1N5YH 3GK8H 3UXFA 1MFDL 3DMMC 5IVZB 3MA9H 5GRXG 4HLZH 2XN9B 4M8QA 4Y8DC 1MJUL 2H3NB 3FO9A 2CSPA 4N0CC 1RZ7H 4HBQA 2HJLA 4QHUA 1QFWH 1TCMA 1NPUA 4YHPA 1T0PB 4HKZA 3D39B 5HVHC 4ZAKD 2WK2A 3SKMB 4MMZC 3NA4A 1G0XA 4JRXA 4KKAC 4KMTL 1RZ8B 4F7MB 1NGYA 2FIRT 1I3RB 2GSIA 3KPTA 1CU4H 2XFXB 1TJIH 2EDRA 4KHXH 4MJ5A 5CCKL 1SEBB 1UM4L 5T5FH 1OPGH 3MCLH 1OY3B 1MCBA 5K9QG 2ZSVA 4WEUD 3SE9H 3MJ9L 4NM8H 1I3VA 4NC1C 4H20L 3DXAE 1U8PA 3VWKD 1FV1B 2Y36H 3WEXB 2VC2H 3BFOA 4ONGH 1J1OH 2JIXA 4WFGE 4OI7A 1QBMH 1TENA 2EIDA 3UYPA 1AD9A 3DMMB 4O2FA 1U8KA 1FE8H 3DSFH 5DO2D 3ULVC 4WW2C 4LNRB 4WNQB 2A74A 3P9MA 3T0VA 3U0PA 4ZODA 4M9PA 1DBBH 3BZDA 2DQFA 4X7SL 1U41A 1FO0H 4FQQA 5I19H 3MBEC 4G5ZH 4MD5A 2NZIA 1WIOA 5J3HC 3B5GA 5DJ0A 1X4XA 1UJ3B 2H6PA 1EMTL 5I66A 1OQXA 4UBDC 1YEFH 3QAZC 4XHJD 1H3XA 5LXGH 3OL2A 1GZQB 3O2VL 5IQ7L 4JFHD 3K81A 3S3JA 1K6QH 3W11C 5CUSL 3HMWL 2NY4D 3NVQA 2DI7A 3IU3A 3BDYH 4LIQE 4IRSA 3L5WB 2QHLA 1MCWW 4Z7VB 1ZANL 4M48L 4PY7A 1VA9A 3G6JB 1P2CA 2RR3A 1KIQB 4NO0B 2CLZA 3L5XH 4NNPH 4NKOB 3LB6C 1OTTD 4J8RA 4MB3A 3F6IA 1T1YB 4JFYA 2H32H 3E3QE 2DL2A 3PWLA 1G7PA 3VXTA 4LPUA 4RX4A 1CFSA 3CXDH 1ZVSA 4L9LC 1J05A 3QIBA 1MOEA 4OB5H 3QFJE 1HKLL 4P3CH 5JW4Q 4PR5A 2PYEA 2AJ3B 4CN4A 3T0EE 3CXHK 3MRKB 4M7LT 4PJIE 4R7DB 5L2KA 3F7PC 3CIQA 3O8XA 5HD8C 4QTIL 4F9LC 1JI2A 4KPHL 2UYLB 1RUPH 4Q9QH 4P5TC 2VH5L 3ZHDA 1AXTH 1S7UB 5J1TC 2Z91A 4HUMB 2FJHA 2R23A 5EU6A 4KMLB 1MFCL 1FNEB 1RMFH 5DR5L 2EE9A 2FH6A 2AJSH 4ZUVB 1A6ZB 3VFSA 1KIUA 1UA6H 3MJ7B 1Q1JH 3HRZA 4BZYA 3PJSB 1TVHB 2EH7H 4IRJD 4DUWA 5EUKB 1AGBA 1HCFX 3IFOA 4JFED 5D1QC 3TA3C 1NMBH 3HG1D 3OJMB 2O5YL 3LKNA 3ZYJA 2ZCHL 1G7HA 2DICA 4TOYL 1X5KA 4WGVB 5FA4A 3PWPE 4HS3B 5L7XL 5ALBH 1KNOB 2G75A 2QQKL 5D5MA 1FH5L 2V9TA 4I3SL 1ITCA 2PO6C 5BRZA 2NTFB 2PW1A 2DQIL 3AXLB 1KFAH 4B50A 3TJHD 2EH8L 1G9NC 1NBVL 2ITCA 4GRLA 4F58L 4X7SH 4ZXBC 3BKJL 2C7UA 3SDDC 1RUKH 4LOUC 4GUPB 5IB4B 3FZUD 3PDDA 4PJ5D 3TO4A 3SEPA 3FMGH 5H35A 2V7HB 1J8HB 3TBWB 1FYTA 3R0MA 3MUZ1 4LEOA 2BRRH 2W92A 1ZXQA 2YMXH 1XCQB 3LKRA 5C0AA 4TVPD 5T33H 5T5NF 1P7KB 2ICES 3CZJA 1GGYA 3C6LC 3RP1A 3V4UH 2SEBB 1FIGL 4HIXL 3B8YA 2H1PH 2UVEA 1UENA 5ESQB 4F37K 2GY5A 4D9QD 4PG9A 5DXWA 2YXMA 4N8VA 5E56A 4U49A 1BF8A 1U8QA 5CJ5A 5F1SA 3K4AA 3RVTC 3REWA 1NCWH 3WN5A 4K7PY 3MROB 3G6AA 3CFJB 1T7VA 2HKHH 4GMSH 4WV1A 2YBRB 4P2CG 3W81A 2RB8A 4LRIA 4JN2B 1RZ7L 1IAIL 5MENA 5EUKA 3VFPA 4TSAH 5MI0B 4G6ML 2XKNB 3QG7H 4UDTB 3JTSB 4GLRI 4HF5H 2YWZA 3O6FD 1Q9LB 2E7LC 1EFXD 2F19H 1I3GH 4GKSB 1BEYL 4PG2A 2X40A 1A6VL 1WT5A 3QQ4A 2FRGP 4U7SA 4YHZL 2BVPB 1DLFL 5CJXA 1IGTB 3AU1A 3ZDZE 4M00A 2F8XC 2APVA 5MEPA 1AY1H 3ILQD 5J6GB 2CXKA 3RY6A 1EAJA 1RUPL 2GUOB 3D39E 3IDGB 2DS4A 4KRLB 1PSKH 3R1GH 3ES6A 4TVPH 3AB0C 5F7YC 2AJVL 5E2JA 4XMLH 2LABA 2VWEE 5FHBH 3KPRD 5DJ6A 1EXUB 3QWQB 4IOIA 2N56A 3V0VA 3DROA 4OSUL 4OCXH 1ZHBA 4XXDA 5GS2D 1VGEL 1PKOA 3IETB 3GSUB 2X4TA 4MD0A 1QSEE 2YZ1A 3KLDA 4O51B 1NDGA 2IH1A 4OTXH 4UILL 1RJLA 2R4RH 3C8KB 2VAJA 7CGTA 5FKPA 4JE4B 3BKCL 1EV2E 3CFBA 1CR9L 1G0YR 3PGFL 4GKNB 3RNKA 3IKCA 5E0QA 2RIKA 4CJ0A 5FDWA 3PIQB 5FGRA 1QR1B 3MX0A 2X09A 4FQ2H 4S1DD 5F3BA 1R0AH 3CDCA 2D31B 3TJEH 3BO8A 1RZIA 1KJVB 1ZT7B 1BGXH 3T0EB 1NL0H 2VB5A 1LMKA 3LIZL 5F9OH 2I9TB 3O11B 2XRAH 3D3VE 1XGTB 4CKVX 1AR1D 2YRPA 4M1DL 3IDYB 4GW4A 4R2GD 1X5IA 4QCIA 5TE4L 2CO7B 4ELMB 1KT2A 2DJUA 2QEJA 3NCCB 5GGSA 3MYJA 5FUZH 3TA3B 4DKAA 3OPZL 1T6WA 2W9DL 1QBLH 3IDXL 3BGFB 4MCYA 1IM9D 4UTBL 4Z7VE 2HLFC 3H9YA 4GAFB 43C9A 4HC1H 1FL6A 5ICXB 1SM3L 3V4VH 5JPNB 3BDBA 3O45B 5DDHB 1A0QL 4PLKD 5E1AA 2YXFA 5HHQA 5IGXH 4Z77B 4PJDB 4M5ZH 2AI0L 3VWKB 1IGCL 3L3HB 2YPVL 3QB7C 4UTBH 1AGFA 2AXFB 3RL1B 2XTJE 3STBA 1BM3H 3E2HC 4OZGE 2BOCB 4LSQH 4WUUD 1T0MA 4UT7L 3VDBA 2E27H 5ADPL 5IK3B 1QBBA 5F3HA 2NLJB 4LLWB 3DUSB 3B83A 3RWJA 1DEEB 2CK2A 1G84A 5KW9H 3I6GA 2P5EA 5FGCE 1EFXB 1RI8A 1KB5L 1AH1A 3V6FB 1HI6B 4HK0A 3RVWD 5CZXD 1GOGA 4Y4FD 4GXVH 2DJSA 3TO2A 3PV6A 2QLVB 4O5LH 2VLKD 4M61B 3T09A 2GAZB 5JW5A 1KFAL 3CFIC 4Y4HC 3S4SB 1N7ML 3ABZA 4YDVB 5DJCB 2HJKA 3VCLB 3DPBA 1S5IL 4UV4H 5FM5O 4CUCA 1A7OH 2OS7A 3NCJL 4FQHB 1S9VB 4D8PB 5IB3A 4X4YA 1GH7A 1JZ7A 1BJ1J 3ULVF 5DS8B 4AL8H 4J3VA 5BOZG 3IDIB 1KT2B 1JHLH 1P7QD 3MRIA 1P84K 2F74B 5CD5D 1MCCA 4HBCH 4HXBH 4EUPG 5TQ2H 1BX2B 2VL5A 5DFTA 1T83A 1A9BB 1CFNB 4HH8A 5IEKB 4ZOBA 1WITA 3GMRB 2CR3A 2NR6C 3RWEA 1WBZB 1B3JA 3ZT7A 4PJ8A 1T6VN 5C0BE 3UTTE 4ODWA 2DBJA 3VFVB 2DKUA 5EG6C 1G6RB 5GISH 4HUXB 5GGQL 4I3GA 1NEZA 2XNAA 1NUDA 3TNNA 4GW1B 4HJ0D 4K8RL 3IFPA 3MRCA 4KKNA 3T4YB 3MGOB 3D3VD 5GSVA 1FQ9C 4XH2B 1QLFB 4QRPB 3FO0L 4HWZB 2XG4A 1T66C 5DVKA 5C1MB 5GS1C 3Q6GL 3DROB 4WUKH 5L2JA 3OZ9H 4KKLD 1K6QL 4JZJC 4YEEA 4TTGA 1JHTA 4D3CL 4G3YH 1ZHLB 3BZEA 2BSRA 4GKSA 2GAZA 5I1HL 5JW5B 4ZD3L 1HHKA 4JY4A 1PY4A 1J0KA 4NGHL 1N0XL 4XPAH 3DXAA 4IMLB 4KRPB 1YN7A 4K3JH 5C08A 1Q9WA 4MCZA 4KQ3L 1I75A 4UDUA 4MQ7A 2PYED 1WC7B 2AEPH 3U7WH 4HS6A 3RDTC 3S97C 3UTSD 5GJTL 2MCG1 2P1YA 2N7BA 2Q76B 3BO8B 4TUOA 4BSWB 5KSAC 1AXTL 1B88A 2MWCA 3KYMA 4HFUL 2OZ4L 5JIKA 1ERNA 3EGSA 4S1DC 4F33A 4P2OC 2HAZA 4RAVA 2ADFL 3UJJL 4U1JA 3BZ4A 3CDYA 2FHFA 3HC4H 4KJPC 1IAOB 4WFEE 5DK3A 3UZQA 5EH1A 1LEKB 1I8LA 4ZG1A 5FF6A 5IROC 3PGFH 5IOPA 5K9KB 1WIPA 5AG9A 4PREA 3TIDA 1EFQA 3SO3B 4JKPL 5CWSB 4QGYA 3OF6D 1XIWA 1I85C 4DAGL 3MJ8A 4BZ2H 1AIFB 4XPHH 3FB5B 5ESVB 2VDOH 2WV3A 3CFDA 3IDMB 5TQ0L 2Q87A 2WIIA 1A7OL 3U4BH 1NCCL 2CDEB 4NBYB 3DUUB 3MMEB 3MJ7A 2V2XB 4AY0A 4EIGB 4JFEB 3MV9D 4LLYA 4HGMA 3KLHC 1D5XB 3KPMA 5DJDA 1TIUA 5GHWH 1HSAB 3QUXD 4FA8A 1NBYB 3E8UL 3LMJH 4JO3L 4JPWH 3KXFE 3HNVL 3QXDA 3MLRH 1I1FA 3BAEH 4G6FB 1NQBA 4NDMA 4KK8C 1FGNH 4CDHA 3I02A 5INDA 3QFJA 3PWNB 5AZ2L 1KCVH 2BCKB 1KPRA 3G9VA 3ZHLA 1NBZB 1F11A 1WIUA 1U2CA 4ISVA 4X6DF 3LKPB 4NO5B 3KAAA 1H8SA 3VG0H 2DF3A 3KHOA 4M4PA 4GAGL 1G1YA 1OD9A 1OF2A 4N0YH 1XF3B 1CD0A 2P49B 3PDGA 4L3CB 5IB4A 5EU3A 5K9OA 5KZCB 2X4NB 3L5JA 1NGPH 3CFCH 3KPLA 4R0LB 1XT5A 1D5BB 3GMMB 3KPQB 4WW1A 1YY8A 3HE6B 2A38A 3R0NA 1PW3A 4LSUH 5GQBA 4MQSB 4WO4D 3Q6GH 3HR5B 5IMLB 1P7KA 2Z93A 3QO1A 2FATL 3NABH 4JM4H 2IADB 2D7MA 1IGFH 3MNZA 3CX2A 4JVUA 4BQCA 5C0DB 3BQUD 3V6BR 4CU8A 3BQUC 1WWAX 1ACYH 3IAQA 1W8NA 4OF0A 4F15B 5I1IL 4XNUL 4P5TA 4G8EA 1NSNH 2UZIH 1CXIA 1HHGA 3H9SE 2AJ3A 2VLRA 1KPUB 2YUXA 4X80H 1ZLVH 3TYFA 1EBAA 3EO0B 4IIQC 1TQBB 4ODVL 2ESVA 2NY1C 1U91B 3DGCR 4YAQA 1RZJL 4FP8L 4U1MB 1MRDH 4MQTB 5TQ2L 2VYRE 1FJ1A 3UJIL 1R5IA 1ZA6A 2C3HA 5GGVH 1W8OA 1EJOH 4HK3N 5DO2C 3ULVD 3RWHB 3AFLA 2W0KA 1ZHKB 3I02B 2W07A 1Q0XH 5FDYA 3ARSA 3ORJA 3MV11 3BE1L 4F7PA 1UXSB 2GY7B 5E9DE 2KDGA 4XPHL 3L7EB 5E8EB 4PRDA 5LBSL 4RCAA 4C56B 3V6OE 4NO5A 4ONHB 4LK4A 3SO5A 3IGAB 5K59F 1N64L 2EIZA 4KTDL 2GT9A 3BYYA 1CZ8L 3OR6A 4NJAH 4YHOL 1YY8B 3GI8L 2NZ9C 1T22A 2IG2H 4N5ED 1WZLA 4JFFA 4XP9H 5GHWL 4ONOA 4JRXB 2XQBH 3ROLA 3NGBC 1W0YT 3CC5A 2ITCB 3RY6C 2XWTB 4PJDF 4HPYL 5KAQG 2AI0H 2Q76A 4TUOB 4HIEB 3DOSA 3O8XD 5EN2A 1FBIH 5T1LA 4YDIL 3WFEL 2B39A 1VACA 1NGPL 3DO3A 3QP3A 1RULL 2LU3A 2Y5TB 1LEKA 3LB6D 1MQKL 1ZHLA 1OAKH 3MCKA 4RAUB 5JR1L 3BZEB 4M8VA 3W2DL 3O2DA 3VRIB 4GSDL 3FRPG 3QIUB 3BPOC 1IAKB 1PEZA 2X1XR 4YHKL 4Z7VF 2DLTA 3BIBX 4KXZH 4PTTB 2YPKA 1CLYH 2A9NH 3D39A 3VXRD 4YLQT 1IC5H 1GC1H 1OB1A 1FJ1B 2AAVA 3N0PB 2D7PA 2RBLA 4OD1H 3MFGB 2JK5B 3S7GA 1MCPH 5E95B 4K3EL 5A2KH 5I15H 5DJAB 3U6RB 3G6JE 3OKDA 5BW7A 1QACA 1WAAE 1FV1A 4ZDHB 5KS9E 3D69B 3NOIA 1J12A 1KTRL 3DGGA 1HK6A 4YBHA 3H9SD 4N0UE 1JF5A 3LRGA 2EYSB 2FB4L 3QPQC 1D6VL 1OQOA 1W0VA 3KXFB 3PGCA 2HTKD 2NY3B 3UPRB 4Z78B 3QFJB 4M1CC 5JTWA 5DK0A 1KJ2B 3V9FA 4MLSA 3ULUH 4F3FB 4H8WH 4EXKA 2XOTA 3NN8B 3OAZK 1I7RA 3VFUB 1N59B 5JW4M 1AO7B 3QDMA 4X6FA 4OTXL 5KSBE 4WDIB 1U58B 4QHLA 3AS3A 1LK3L 5FO8B 1OCWL 1A14H 4OZIE 1BECA 3W0WE 4XCEB 1H3TA 3E1F1 3VFTB 4UNTA 4XWGH 5C7XH 4XP1L 5HVGB 5B21A 1FAKT 2NY1D 4HK0B 2WMPA 2YA1A 4QXGH 4TQEL 2BNQD 2XWJB 5CZKA 3FHQA 4KDTA 4ZFOB 4JR9H 3DMMD 2XQBL 1YMMA 3C5SB 1JK8B 2VZVA 4ZUUB 3HAEA 2R0LL 4Y16C 1CZ8H 3ZHKA 1JPTH 4YXKH 4J4PA 4X7EC 5F44A 3RTQA 5I73C 1ZT1A 1XZ0A 2FHBA 3MLYH 2AV7A 3GJFB 3OJDB 3SBWC 5GGTA 4XCNA 3WIIL 3O2VH 1JWUB 1F4WL 3NZHH 4ZUSB 1IAMA 1U8HB 2OJEA 3RPIA 4Q74A 2R0KH 1JUFB 3MLTA 5IVOA 3UZVB 2VL5B 3PF2A 3SHSA 1E27B 2IANB 3B4NA 3UAJC 4WY7L 1DBML 1W72H 4FG6D 1DQMH 4O58L 2I9TA 4IHOB 4XCYA 1U36A 3AAZB 2DQDL 4YQXH 3SKMA 3W9EA 5KG9A 5T1MA 1CD1A 3O11A 1C16A 4LCCB 3LRSB 4EI5B 3QIBC 3S36X 3NZHL 2J8UB 1LVEA 1IQDB 2NCMA 5CJXC 4P2OA 1A0QH 4ZS7H 5CHNB 2P5EE 1CDUA 2EDYA 1N8ZB 1ULVA 4ZXBB 5EZOH 2J4WH 5EO9A 5HYFA 2OSLA 3CX5J 4J3UA 2RGSA 5C9JA 4NRYA 3LKOA 1VADB 5E9DB 1BM3L 4OD2A 4JG1L 5IBLC 4P2QE 2VXUH 1YZZA 5J89A 3C9NB 1AI1L 3WJLC 4H20H 1QOKA 4XAKE 3U0PB 1H3WM 2HWZL 2R0WH 3I50H 3RL1A 3QO0A 1QHOA 1PVHA 3ARBB 4YC2C 4L8SC 4EN3C 5ITBH 1M4KA 3LHPH 4GRMB 4MNQD 1I1AC 1RHFA 3GMOA 1HHIA 3I9GH 3P11L 1U3JA 1BVZA 1TNNA 4M7LH 2WUBH 3HAEH 3O6LH 4KWUA 2ADIA 3IF1B 3MV7E 4ZUUA 2CPCA 5MP6H 1FNGA 1NH6A 3RRQA 3TH4T 4OM1L 2BOBA 4AH2A 4S1RH 5D72L 4PJ5B 2DD8L 2DIAA 1CXFA 3RWFB 5DRZB 2CO6B 4W6YB 4ZUTA 3UTTA 1VSCA 4QT5B 1I7TA 1NL0L 1DBJH 2F58L 3CSYB 3GMPA 1P4BL 3N1MC 4J3TA 2VMFA 3B3IA 4RAVB 1JNLL 5IESL 4ZOEA 3SJVE 1I1AA