2AJZB

Crystal structure of cocaine catalytic antibody 7a1 fab' in complex with ecgonine methyl ester
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
EVKLSESGPGLVKPSQSLSLTCTVTGYSITTNYAWTWIRQFPGNKLEWMGYIRSSVITRYNPSLKSRISITQDTSKNQFFLQLNSVTTEDTATYYCARYDYYGNTGDYWGQGTSVTVSSAKTTPPSVYPLAPGTAALKSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Antibody 7A1 Fab'
total genus 42
structure length 219
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2005-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajzB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajzB01
1TQBC 3Q48A 4JFED 5T1KA 2GW5A 4GKNB 2FGZA 3V9FA 3LEYH 5EU6E 3WXWL 2IFGA 4S2SB 4CNIB 4HJ0D 1TZHB 3IDYB 4WTZA 1W2KT 4ZOEA 2I24N 3RHWF 4I77L 3BZFB 3QJFB 5DD1H 4G6JH 3K8LA 1LO3L 3HG1D 5IROC 2BNRB 2D7TL 1AXIB 3MV8E 3GRWA 5IBUB 4KXZH 4IOSD 4L4TA 5HDQL 5DVMA 2W9EH 3BPLC 4AIZB 4NZUL 5EDXA 3RL1B 4XMPH 5DZOA 2YMXL 5CZVH 3FB6B 4YPJA 2FH6A 4C59B 4MCYB 4QXUL 4Y2OA 5HDBE 4JVWA 5FYKE 3MRBB 5IQ7H 4OI8A 4KRPD 4EN3C 5DJYB 1T0NB 2F74B 3L95B 3SKNB 1T5XA 5TDOA 2DQCL 3IU3A 5SWZE 4O4YH 1F11A 1G7LB 1G7JB 1A6TA 1H3UA 3GSUB 2GSGA 25C8H 3UYPA 5E7FA 4OZHB 1SY6L 2FD6H 3GMMB 3WS3A 4PTTB 3L3GA 3N06B 3TYGL 5JTWA 2VKXA 2YKLL 5IJVB 3I3EA 3CH1B 3NACH 1ZLSL 3DXAE 4HIEB 1G6RL 5TQ2H 1OPGL 3IT8D 3VFUB 1M7XA 3I2CL 5DJZB 1P84K 3OKMA 5TFSL 2XA8L 4AZ8A 1R3KA 3BRGC 3C9NA 2EKSB 2BVYA 4W70A 2D7PA 2C3GA 1BLNB 3W2DH 4OD1H 3RU8L 2BOBB 5IB3B 3RIAF 4G6KL 5KTEH 4PB0L 4R3SA 3CK0L 3VXMA 5I15H 1RK1A 5FXCH 2VE6B 3BI9X 3U36A 4OD1L 3KPQA 3Q6GH 5GHWL 1ACYL 3CMOH 4JLRA 1PG7H 3FT2B 3REWA 3MLPA 5L7XH 1FAIL 2VXUL 5EPMB 1YNLH 2ZUQC 5I15L 3HZMB 1W72B 3PWJB 4N8VA 3VFPA 4M9PA 2HWZH 3QFDA 3O45B 2VDLH 4KJQD 3MLXH 1BZ7A 3MYJA 5KVMC 3L9RA 1LHZA 2CJUL 3EO9L 1EK3A 1D5IL 1FNLA 4IDLA 1S7TB 4P5MB 4V1DA 3MLYL 2VXVL 4XNZB 1E6JH 4RAVB 4U1MA 4Z7OF 4LVNC 4Z7UB 2HKHL 5DYOA 3QUYB 1MFBH 3QULA 5D5MF 4XMLL 1I4FA 4ALAL 2AK4E 3KPSA 4ZTOL 5BZDB 1YC8A 4M1DL 5BVPL 2VLME 3EGSB 2DQHL 15C8L 2PCPA 4PG9B 5HHVL 3TO2B 3BDYL 3PNWA 3ARFA 3OX8B 4HK0A 2IAMC 5I18H 5H37H 1TZGH 2GEEA 4PJHB 4PD4K 5GS0L 3DTXA 4NFCA 3ET9F 1MI5D 1SEQH 1MWAA 1A6AB 5FHBL 1CFTA 1CQKA 4H1LA 2R1XA 5AYUL 3G08B 2NY5C 5TF1L 2VISB 1R3HB 2X4RB 3K4DA 3UBXA 1ED3A 4P9ML 3VWJB 3MJ9L 2XN9A 3LQAH 2Y23A 2V2WB 2GFBB 2GKIA 4LHJB 2J7LA 1WVZA 3BPCA 3U83A 5FF6B 3AREB 2GYSA 4ZOBA 3GZKA 4H25B 5LXGH 3JUYA 5E8DH 3IKCB 3RWGB 2PR4L 1Y6KR 4KV5F 1LP9E 3QNYB 2G75A 4CVZA 4J7RA 3IJHA 4Z7VA 2XZAL 1C08A 3UDWA 1FJ1B 2X4SA 3VRLF 1U8IA 1IGYA 4JN2B 5DK3A 2ADIB 3MRIA 3P0YH 1VFBB 2FJHA 2IJ0C 4BQ8A 4GAFB 1J5OL 2PN5A 2YEZA 1D5XA 5TE4H 2UY7A 3VFOB 4KY1L 2EO9A 4IDJH 4GG6F 3IDIB 3MUGB 3BH8B 1FIGL 2OI9C 3PGDB 3VFTB 5ICYA 2ENSA 1MHHA 1X5JA 1IGTB 5JPMA 1KCUH 2IPTH 4LF3B 2O5ZH 1NMAH 3OPZL 4K2UH 3QG6A 5T33H 3LPWA 3FZUC 3RUGB 5IESL 1BGXL 5D5MA 2P5WD 1NFIA 4M7ZC 4B53A 2FECL 3W11D 4KMTH 5CP3H 4WO4B 3D39D 5IMOB 5D7LD 3WV0A 2Q3ZA 4JFEA 5T1KD 1M4KA 2Z8RA 5A2FA 4MAYD 4YXHL 1EGJA 1FNGB 4ODTL 2NX5D 1RZKL 5C0IB 4B7LA 4XX1E 3SE9H 4LFHG 1AGFA 1F13A 4XC3L 1JK8A 5KVDH 1ND0B 1CF8H 1S8DB 4PRID 3MV7B 4ODBD 3UJJL 4Q6YA 1YY9D 1HK6A 5CILL 4ONHB 2AJYH 3MRCB 1CLOL 5EOTA 2CDFA 3RRQA 5CD3B 5J4MA 1XCQB 3MGTB 1AGDB 3MMEB 4AEIL 4HKBB 3V5KB 2Z4QB 3LS5L 4JFDA 3EUUA 4JAMB 4TVPL 4F7MA 1HOCA 5D1ZA 3LH2H 4GFTB 2NCMA 1JGDB 3DV4A 1A6WL 5LGHH 1NPUA 4U1IA 1E4XI 4W4NA 3OGCA 3QUZB 3SPVB 1IFHL 4X6DE 4WUUB 1U8MB 3S34H 4PJFE 1RHHA 3AS1A 3M1BB 4RISH 2RIKA 3C08L 4OIIL 4PJIA 4PLJC 5BMFL 1BLNA 1LEIB 4X7CC 4XCFL 4WI7A 3QCUL 4K3EH 4NQDB 1WAAF 4ZSOA 2I07A 1SJHA 4RIRA 5TQ0H 3ZLQC 2Y7QB 2HG5B 4JE4B 1IZKA 5J89A 4HDIA 3P4LA 1KIRB 1T0MA 3R06A 4KHTL 5BV7L 1MCEA 4AJ0A 4WU7B 5ENWB 3PUCA 1I9IL 3BGMB 3BX7C 3GGWA 1QBBA 2Q76A 5HYIA 2LAGB 4HZLA 4O51B 1F4YL 3IGAB 1QNZL 1NDGA 1S9WB 5IHZA 3VFWB 1YA5A 2ID5A 1KN4L 4E5XA 5EBMA 3QUZC 1BVKB 5B21A 2Z91A 3HC4L 2BOCB 1QYGL 1BQLL 1NFDB 1E0OB 4N0UE 3PGCB 1BIIA 2YPLD 1J8KA 4H1LB 4WFHE 5DRZB 4PREA 2COQA 3SE8H 5CBAA 5I1AA 2VDLL 3OKOA 4H0IA 1RUMH 2O61B 1LDPL 3LB6D 2CKBL 3SDDB 4P99A 4QHUA 1JYVA 3OKOB 1KUMA 3SDAC 3L3DA 3MRKB 3MLUH 4NUJA 2AXFA 3PQYB 3LHPL 32C2B 3QO1B 4FQXD 4GKZB 5C3TA 4R4ND 4GG6E 3RWFA 2FYYB 1IRAY 5IMKB 4I0PB 3Q6GL 5GHWH 5BMFH 4PP2B 3CVHL 4N0CD 3O6FB 4ZD3L 1DQQB 4KMTL 5IWLC 1QBLH 2DJSA 2J88H 1OAXH 2Z91B 2HJFA 1J1XL 2F8VA 3MROB 1C5BH 2F19L 1S7QA 3R0MA 4JPWL 5E0QA 4HZLB 4O51A 1J8HA 1WFUA 2WUCL 5CEYB 5T33L 2OZ4H 5IQ9B 3LMJH 1L4IA 5F6IC 3GIVB 2DQEH 1LQSR 1VFUA 2EYTA 4MD5A 4PS4H 4ZPVA 3U7AA 3BPNC 3ULUE 1IAII 4X83A 2HT4D 1KLGB 5DMIL 3B3IA 1SJHB 2CLVA 3TJHD 3ZL4H 3DYPA 2X4OA 2AVGA 4OM0H 3TBWB 3S36H 2EIDA 4TSCH 1VEOA 1TNNA 4N8VB 3VFPB 4JRXE 2Z9TA 4ERSL 1G0YR 2E9IA 4M6ML 1KJVB 3TBYB 2AP2A 5KG9B 5E9DD 5F7NC 2MSPA 3FQRB 2N7BA 1NCDH 3AGVA 4Q2ZB 3G6JF 1ACZA 2E7CA 4YEFA 4ONFH 4LCIH 1QR4A 2BVPB 2WIIB 1NAMB 1EVUA 3QQ4B 4NP4H 4PJAB 4KJQC 2FJFA 4HG4J 4LCYB 5FAAA 2Q8AL 4WFFD 1VADB 5HVFB 1BQHG 3BKCL 3EYVA 1X3DA 3BDXA 3RWJA 1S7VB 3WIFB 1WZKA 3MX0A 2IH1A 2EKSA 4HX1B 3CVIL 3RTQB 2IPUG 4J3WA 1FH5H 5JXEA 2F58L 5KJRH 3EOAB 4K3HA 4HT1H 1VFAB 3WKNA 2CIKB 4M93C 3MLTA 3MUZ1 1CGSH 3RFZC 3T1WA 4X7EC 3OF6A 3MV9B 5ACZB 4XWOD 1TJIH 3HNSH 1WBYB 4LK4A 1CGSL 3UTSA 3LKRB 5A16A 1TENA 1Q9KB 4JRXB 3BZEB 1RUAL 4QRTA 2DOCA 3GSUA 3UX9B 2D3VA 5T1LA 1IGJA 3CFIC 1CIDA 1P84J 3OF6D 4P4KB 4HIJB 3VGHA 1K8IB 1P2CB 4J3VA 4D94A 2WQRA 3TT1H 1NCCH 4PJ7A 3R0NA 1MUJB 3KJ6H 5EORH 2YPKB 5J11B 2ARJQ 4J6RL 3IJYB 3TCLA 4P5KA 4B0MM 3DRQB 3IFPB 1YDPB 3HR6A 1INDH 3GSRA 1JNNL 4I18B 2PF6A 3EDKA 5SX5H 2EYSA 4KPHH 5DJDB 4M8VA 4FTVB 4OZIF 3LEVL 1CGYA 4RFNB 2DRUA 4ZPTB 2CLRA 2NTFA 1C1EH 3S37H 1KENL 1F8TH 1ZA3B 1LMKA 1JMXA 1NLDH 2MHAB 1KT2A 3ZL4L 4I48A 3S88H 2CJUH 3BZFA 1DVFA 2B0SL 3GMPB 1PD6A 2H32A 4UINL 5ESQA 4CMMB 4NN6C 5EOCJ 3OZ9H 3O2VH 1E6JL 4JKWA 5BCAA 3C5ZA 3RY6C 2ZUYA 3QWRA 4LHUA 4RWYL 3JTTB 5LQBL 4O00A 4CDHA 3ZKNC 5I75B 5LGJA 1T04A 4KKCD 1CZ8L 4RNRB 2VIRB 5CJOL 3N1PC 2NY3C 4JO4L 5MEOB 1I7TA 3H3PH 5IG7B 1P5VA 4XAKE 4LLMB 4WFED 1R24A 1YEGH 2RJMA 2FR4A 5FF6A 1KIPA 3RAJH 4Z7WA 3DV4B 1JGDA 2AABH 3NCMA 3AFLA 1RUML 2I26N 3EYUH 1WJ3A 2Q8BL 1F2XK 1BJMA 2CKBB 3RIFF 3SO3B 5F3BB 2WAHA 5H35B 2VDOH 3SGKA 5D1XD 3X12B 5B3JE 5CWSB 1GGBH 4ONOA 1LEKA 1CFSA 2AI0L 1GOHA 4AEHL 2P49B 4X5LA 3KPPA 3P0GB 4Z78B 3VXPA 4X4YB 3OB0K 3QUMH 1EEYA 4CJ0A 2IH3B 5AAMA 5TDNB 3GB7A 2A0LC 3QUYC 5C2BH 1KXQE 1AE6H 1UXWA 1OGTA 4JFHD 3CFCL 3JWOC 4HLZG 4U6HA 4JJHA 5D7KE 1A6ZA 2YPLB 5T1MB 3RPKA 1OP5H 4P4RA 1X6LA 1D9KC 3EFDH 3E8UL 2JCCA 3MODH 5CZKA 4YC2C 4ZS7L 3KDMA 4RGMB 5I76B 4Z7VE 4XBPA 4M7JH 5GS1A 4I18C 4Q0XL 5ISZD 2NY2D 1G9MC 2ZJSL 1QP1A 1JI2A 2V2XB 1F58L 1A1MB 5DJ2A 2E6JA 4JZNA 1JWSA 1JI1A 4PJEA 4NJ9L 2EDTA 4U1KB 5EO1A 3S34L 3ULVE 4JO2H 4HV8A 5CINL 2RHEA 4DN3L 2VZOA 3GJFK 3UMTA 2CO6B 1CBVL 3LKNB 4S1SL 3DHMA 3E6FB 5B4MD 2KZ1B 1GGCL 4QTIL 4WI6A 2Y72A 3HPLB 2P7TA 3FCTB 4MWFB 5C0CD 2F58H 4LEOA 5KJRL 1DQMH 3V4PL 4N5ED 4GW4A 2MKWA 4IHOB 3CFEA 3U4BH 5GSVB 1ETZA 1K85A 1L7TL 1LWRA 5HHXL 1NJ9B 5ID1A 1AHWC 1XGPB 1MCSA 2VZSA 1J1OL 3IJHB 4Z7VB 4AM0B 1QR1A 1T22B 1R3IL 4HS3B 1ZHBA 4P2CG 4Z7UE 4N8PA 5D96C 4FQLH 5TH2A 4RGNC 3M45A 2VUYA 3TVMC 1RPQA 2JF1A 4H25A 2GK0B 2AK4B 2PO6C 4P23A 5FOBA 4EUPB 1Q8MA 4KI5E 5E2VL 4XTRD 3BD5A 2WSKA 1DR9A 4WU5B 2GFBA 4UT9L 3MRDB 3ZDZE 3EYOA 2BHUA 2HN7A 3I6LD 4LDEB 1EMTH 4QOKA 2P48B 2NTFB 1YEDA 3B4NA 3NA9L 4ZUTA 1DQJB 1TTGA 1MWAL 1WC7B 3VRIB 1F11B 4ESKA 4LCCB 1OSZA 2YD8A 2NTSP 1RIVL 4R6UA 4RMWA 1JWSB 3KYKH 1ZHNB 5CLTA 3NA9H 1ZHKA 1KCRH 2EDOA 3Q6FB 1ITCA 4XPFL 1CWVA 1G7PA 1NGXA 3QDGA 3TZVB 4MVBC 3LMJL 4OFPA 4K8RH 1YJDC 1DUYA 1KPRA 5I76A 3VJ6A 3WNKA 1JZ3A 3IDYC 1IGJB 4D0BB 4MX7A 1KN2L 4ZUWB 3V6OE 2FX8H 2I9LA 3LKRA 2PXYD 4D0CB 5FKPA 4M3JA 5CD5C 5F21B 3O9WB 3MJ9A 3WNLA 3C6LB 1U93A 4CBPA 3BHBB 4XVSL 3VGFA 3UTSD 5IW6B 4Y2DD 3WIHH 2X4QA 4AG4L 3NABH 4X7SH 3MLTB 3QZWA 4PGBB 3RTQD 5FYJL 2JTDA 5MEQA 3P30L 1M05B 1UG9A 4Z95L 3ZT5A 2QJDA 1Q38A 2J4WH 4HK3N 4NHCL 4Y2DA 3OXSA 4G7YL 2ZCLH 1G6VK 3VFMB 1QPPA 4NQXB 1N7ML 5SWSB 4CVXB 3RZCA 5GRZA 4L8SA 1KG0A 2A6JA 2B5IB 3EO1B 1MAMH 3GHEL 2YSSA 3F6IA 4JKPL 4MD4A 4RBPH 2Z8SA 4AIXA 3N85H 3FN0L 5I1HL 3MLVH 2BOBA 3MSPA 3HC0B 1JFQH 3KPRE 4X4XB 1KEML 2ESVB 4OLVH 3I50H 1I1YB 3TBVB 3TBWA 1OGAE 1HILA 1DQDL 1T4KA 2OJZL 1BJ1J 1FZMA 2HFFA 1A6WH 4JQVC 2E7HA 4CADA 3VXUD 1T6WA 5D7LE 3J7HA 1AR1C 3BMWA 1VFMA 5C2BL 4YHIA 3VI4E 4ETQA 1KB5L 4TSAL 4LLVB 3HZVA 4YJZL 1G1YA 4PTTA 2F5AL 1B0WA 3SDDC 5HPMB 5JIPA 1VENA 1QYGH 1A1OA 3EOBB 4TQEL 4Q9QL 1I9RH 5L88H 2Q7YA 4NJ9H 1GGTA 3LV3B 4NDMB 1AHWA 3CCHB 4YAQB 4M43H 3MREA 2XZZA 1OTUD 1KPUB 3ARBA 2ZJSH 1TCRA 3RL2A 1HN1A 2L7UA 3K74B 2VDQH 2BERA 3L3OB 4UV7L 4CMHB 1YC7A 3O6MH 1J1PH 2H9GA 3ARBC 1FAIH 1CYGA 3UTQB 4JFDD 4EOWL 2ESVE 4LSQL 3CCHA 1DTUA 4R7NA 4XNUH 4MQXC 4KRNA 3RVXD 5CJOH 4P2RB 5J1TC 1ZWIB 2X1QA 2QSTA 4KZEL 3NCEB 1FVDA 1JP5A 4GMSH 4PRIA 2AJSH 4ODXA 4P23B 1FL6B 4HC1L 1DBKH 1UYWH 4ZO9A 3A6CL 1DJSA 3N1MC 3CGTA 2H8PB 2ZCLL 3O8XC 4CNIA 1I8MA 1HHIB 1B0RA 1HXMB 2DQJH 2FCBA 2DM7A 3ARXA 3D5OF 4I0PD 1TVBA 3DUSA 5E24E 3BIKA 1FL3A 2WBWB 5T3ZH 4X4XA 2E6QA 1AY1L 4IRSC 3B6SB 4Y5VA 2IANB 5J3HD 1H0DB 5GXBB 3I85A 5FKAB 4KGJA 4DWHA 1K4CA 4WUUA 1DL7H 2IC2A 3V8CA 4R4BB 3FQTA 5DLMH 3ROLA 2CMRL 4JDTH 1BPVA 4TRPH 5HYJB 3BPOC 3WS6C 4QY8A 2CRYA 1NFDE 2FATH 2YXMA 4X6FB 1WIUA 4LQFL 1OF2B 4J23A 5IF0A 1NBZA 3K1DA 4CU8A 1XCQA 3SJVE 5L2KE 1E4WL 1LO5B 2DD8L 4NNYB 4NHCH 5D9SB 2VDML 2FDBP 2SEBA 4WFFE 1CFQB 2CK0L 1FNEA 1NLBL 2GTZB 3ZMRA 4KUCD 1E28B 4M9OA 1PX3A 5LWYH 4PRAB 1B2WH 2R0KH 4OF0A 4BUHA 4AIOA 2ADJA 3MLRL 1UVQB 4HWBH 1AIFB 1NCAL 1S9XB 3ZHDA 3UBXG 3HAEH 2BNUB 4UT9H 1Q94A 2YPLA 4NBYB 2IQ9L 4DKFL 4O2CB 5C6TH 4QKXB 3H42L 3FONA 1CL7H 5IFHL 3TYFB 1UXWB 3WFBL 4R96A 4C57C 4HBCH 4LPCA 1OTSD 3WNNA 3WFHA 2Q86B 5IHLB 3HI1B 2V5TA 4YBLB 4U2ZA 2CMRH 4JDTL 2GI7A 1OCWL 3P2TA 2YPVH 5ERWA 2C1OB 3AXLA 2VRAA 3K2MC 1DBML 4C56D 4U2YA 4G3YH 3VRIA 2IPKB 5L6YL 1C5CH 3WUWB 3STLA 1KTLA 2YD9A 3S36L 3T0ED 1UZ6F 1A02N 5DUPL 1CGTA 3VXOA 5DI8A 4ERSH 3EYFA 4L4TE 4PJAE 4NQTA 4HEPG 3MZTA 3IAGC 1P5UA 4UT7L 1KJ3L 2HFGL 4WRLA 4Q58C 3GSNH 3BGFC 4GAGL 4GW5A 1EA9C 4PJHF 2JJSA 2FJHB 5GPRA 2X70A 4YHNB 1JL8A 2I07B 1PKQB 2HLFC 3VXRD 3RPIA 2D7NA 3TPKA 2F19H 3KLAA 1ONQB 1S3KL 2OS7A 4ZAKB 1LEIA 2DI9A 2XYCA 2EE3A 1R3LA 1X5XA 5KVEH 3JWNC 4YBLC 3TH2T 5J11C 1AI1H 1RHHB 4I3SH 2HH0H 3I9GH 4RA3A 4KKBD 1Q9WB 1NCDL 2D7QA 5ESQB 4CMMA 3HTLX 1GAFL 3S4SB 4PIRF 2XTJC 2EDHA 4OLXL 4J8RB 5M7QA 5C7XH 2MHAA 4WCYH 5D1ZB 1HOCB 2NR6C 4R97C 3UJIH 2VLRD 4UV7H 5IB5B 4FG6D 5I8KL 1EEZA 3GJFB 3VG0L 1QSFD 4X99B 2VXTH 1LDPH 4JREB 1UZ8A 2F53A 4HHAA 4LLDB 4ZQKA 5GS0D 2QQLL 1MCPL 2XZCL 4JHAL 2J1KA 3O81A 3HAEG 1BVLA 2IG2L 4QYOA 3VXTA 1PYWA 4I5BB 4NJAL 5F7HA 2B39A 4GRLC 4HH9A 4BQ6A 4KQ4L 4FTVE 3WFHB 3DUHA 4NZDA 1CU4L 1UCTA 3K1KC 4JO1H 4OD3H 3CUPB 2VZVA 1QQDA 1XF3B 1Q0YH 2X40A 3HNTL 2LABA 3K0WA 1J8HE 3NN8B 5D6DC 5LGKA 1EZVY 3GSOA 4PJXE 5FYJD 4JFYB 4HFWA 1NC4D 3EGSA 5IW1B 4LPUA 2YK1H 4JREC 2VDRH 1V3KA 3LRSA 4OLVL 4M02A 1BX2B 5DJ8B 3BZ4B 3GB7B 1U2HA 3C5ZD 5CEXB 4JKPH 1WEJH 1PYWB 4NQCD 4G6ML 4YE4L 4EIGB 1KCKA 3N85L 4JJ5A 4UB0H 4E41B 1DN2A 3BDBA 3WUWG 1N64H 1GZPB 4UDTA 4UU9B 1Z6JT 1NBZB 3ARGA 4P2QD 4PJFA 3QFDB 4FFVD 1UZ6E 2AEWA 1FN4B 4X6DA 1MHHB 1RK0B 4ZNEA 5IJKC 2V5MA 1MCPH 3MBEC 3NBNA 1AO7A 4J8RA 3WXWH 3GDBA 2VITA 2MPAH 2LAAA 4XP6L 1BQHA 4XHJD 3ROLB 4G8GD 4DKAA 5C2UB 3WL9A 3ZDXF 3LY6A 4IMKC 5D72L 1Z5LB 2D03L 4OB5L 3HFMH 1JHLH 1C1EL 2AABL 1WBXA 4BQ9A 5E8NB 4OZFG 3ARZA 1U8IB 1G9MH 1AC6A 4DKEL 2GJ6D 1ONQA 3I75A 3ZTJH 5HDOA 4AT6A 3DX7A 4OFYD 4UQ2A 5HD8C 1IM3A 2FX9L 5I1DA 3BKJH 4YDVA 2UUDH 3O2WL 3GRWH 4X0KA 4QWWD 2E7BA 3FN3A 5IQ9A 3OAUH 5C0DA 4E41E 4HS6A 4ODHH 3ULUH 4PRIB 4MJ4A 3Q3GB 3QB7C 5GISL 3HC3H 2JE8A 3GSNL 1ZWIA 1XF2A 5ID0A 2ZCHH 2GSGB 1DQQA 3U46B 5GGUA 1ZS8B 4L8SC 1QRNA 3HNSL 1T5XB 3F7RA 5F7MC 3TIEB 5DT1L 1C12B 4I77H 4MAYA 4UIMB 4ODSL 4KUCF 3UTPD 4P4KD 1X4YA 1M6OB 3HCVA 4TUJB 4U0RB 4YXLH 4KZDL 4YHOH 4PRHE 4NCC2 3MGOB 2E7LA 2V6HA 5A43C 1IEBB 1A7PL 3JSSA 5DD0H 3FB6A 3FONB 1P7HL 4UOW1 4HK0B 3H2WA 2CSPA 1AFVH 4YAQA 1MCWW 2YBRB 4ELKA 2BNUA 3WEXA 4QGTA 4GRWF 5K9QI 4JB9H 5KSAD 3PDDA 4QNPE 3S35L 4WUKL 4AY0A 5EBMB 5HI4C 4NM4H 2O5XH 3GMQB 3LD8C 3GI8H 4Q9RH 1UXSB 1WLHA 3Q3GA 1IKFL 2GTZA 1MVUB 1V3MA 2XWTB 3K81A 4TSBL 5EU7E 3KXFA 1FFPA 7FABH 2ZUTA 5C0BA 3ZYJA 1MFDL 1CS6A 3L5WB 4XCCL 1PEWA 3P4NB 1A1NA 3AU1A 3P4OA 3U7YL 3EOAA 1EFXD 1MFEH 1FZMB 2NW2A 4K94C 4LOUD 2EDQA 2D7MA 4ZSOB 2CK0H 1Z9OA 3NZHL 5I19H 4DVBB 1NMCC 3GSVA 2N7AA 3V4UL 4MA3A 4N5EC 3J8F7 4KI5D 1XGTA 3C60A 2H32H 2ADGB 3TV3L 5HYJA 5DRXA 5DC9B 3UTTE 2QV2A 1U8LB 1CD1A 2J2ZA 3CFJB 3QXDA 3PHOB 4M7KH 5E00B 4XVJH 4HEME 5TPWH 5C07D 5KG9A 5SWSA 3CH8A 1NEUA 4HIXL 3BESR 4XP9L 4OKVA 4LCWE 2MCPL 3OAYH 4X6EA 2DQDL 3VRLE 3DUSB 4H26A 4MMZC 4JG1H 1W0VA 1IC5L 1LEGA 3DLQR 1I8MB 3QQ3A 2WBJC 5DZLA 2FEDC 4M03A 1PSKH 5KSUA 5T5NG 1PVHA 1TMCB 2X4QB 3F7YA 5DDHA 5EIIA 1CU4H 1XCTB 2EE2A 3PWVA 2P8MA 1WZMA 2C4FT 2DQJL 4HXBH 3P4MB 2A1WH 4DOHB 3O9WA 4FOMA 4DCQA 4HUUA 4XVUC 4YXLL 5F70A 1J05A 1MLCA 5LBSH 2V9RA 3TT3L 3RVVD 3RJQB 5IMKA 1TPXC 1N8ZB 3UPCA 3OTTA 2XNAA 5L2JA 5FGRA 3UTQA 1T80A 3T8XA 3QFJE 3UTTA 4LNRA 4HCRL 3L3KB 4FZEH 5L7XL 1RZGA 3MGOA 5E8OA 2GT9A 5DD5H 3D25B 5CBAB 1NGYB 4LCWB 4KTEL 3CVHB 4AMKH 3BQUD 2H2PD 3NZ8A 1OSPH 2W59A 1ACYH 5FA4B 4DTGL 1GJIA 4X80L 5J9PA 1TTFA 3H3PL 5E8PB 4XPBL 3QFJA 4YDJA 5DR5L 4DGVH 5C3LD 5CFHA 1P7KA 4F7EA 5DVLA 1OM3H 3S97C 1MCJA 2VL5A 4GXUN 4YBQC 2RGSA 1A0QH 2QHLA 4CU6A 4JZJB 1Z3GL 4ZFFA 2CXKA 5DJ6B 2AQ1A 1I9RL 1OAYH 2XZCH 1NCTA 4N0RA 5TFSH 1QLFA 1FFOB 4GSDH 1LK3H 3MV9D 1FORL 3O11A 3QT2A 5HGAB 3NAAH 4ZG1A 3ZE0E 1ZEAL 3QNXB 3RVWD 3M17A 4WY7H 1FJ1A 4P46A 4V1DE 1IBGL 3ARRA 4KKAC 1O5DT 3DX9B 5EUOB 4KRPC 1CICA 4PJ9B 2B7DT 4Y5XC 3U4EA 3FFCE 4OF8A 4P46C 1NCWL 2I60L 2DQDH 3OKNA 5I16A 3GI9L 5A1AA 2K7QA 4XC3H 2MFNA 3AAZA 2QSCL 1QZ1A 2BP3A 3VXUB 1VA9A 1L0XA 4JPKH 5IKCB 4Y2DB 1MCIA 4NRYA 3Q1SL 2M1KA 4KKNA 3ECBB 3VD9A 1CT8A 1G6RH 3C8DA 2HFGH 5F3HB 1UC6A 4URTB 5LCVL 5H2BB 1IARB 3MJ7B 2VO5A 4YLQT 1MHCB 4I4WB 1HNFA 3FO1B 3MCLL 3OR6B 5E4IA 5FECA 3LRSB 1ORQB 1D9KA 4NKMA 4OCRL 5DEGB 3IF1B 4KQ4H 5ALCL 2OL3A 2J12B 1PG7X 2YUZA 3BAEL 1WTGT 2PYEB 3OV6A 4ZYKA 2NZIA 1HHHA 2VQUA 2DQCH 1NKRA 3PV6B 4C56E 3SN6N 4WFGD 2PETA 4JFEB 5CEZL 4LMQI 4Y16C 3BFOA 2FATL 1QSED 1KF9B 3Q6FA 2P46B 2ZPKL 4OBRA 3U30B 3MLZH 3ARVA 3QJHB 3PIQA 4DZ8A 5ACLA 4NO0B 2BVQA 3PF2A 5CSGA 4DUVA 2P8LB 4HWBL 1EXUB 4PGEA 4NOBA 2W60A 4HLJA 1NMBL 3BVNB 2EC8A 4HWNA 1NLBH 4ISVA 3MRDA 2Y36L 2HT2D 1ZVYA 2KKQA 5JMOC 2UZXB 2DM2A 1K9TA 1G7HB 3FT4A 4LARH 3QCVL 3QPXH 1K4DA 4J3XA 1DBKL 1IC7L 4PJ5B 3HMXL 4H88H 4C56B 1Y6MR 4Y5VB 4OGYH 1RZKC 3GKWL 3KYOA 4AM0A 1MFDH 2BSRA 2IFFH 2FH8A 3W0WB 1T3FA 3UZEA 2IGFL 3OAZH 4P2YA 2ATPA 4PLKD 2QSCH 1IGML 2E27H 3AUVA 1SJEA 3RBGA 4YFEA 5EBWA 1FFOA 3G5YA 4TVSa 5HGHA 3P0VH 3RWGA 3NIGE 2A6DA 2F8OA 4HWEH 2DJ4A 4WUKH 4EEEA 4M6MH 3V52H 3EIFA 1W0WA 3MCKA 3BP7B 3NCYP 3JWOH 1P4IH 1AFVL 3ZTJG 3TN0C 1KJ2H 3OJVC 1WWCA 2P5EA 4XNQA 1H3WM 4L5FH 1YJDH 3X3FL 5AZ2L 4PJDF 2VISA 4HUKB 4TULH 4YIQB 1UA6H 4R7NB 3W9EB 2EEAA 1IC7H 1BQLH 5JOFA 1J86A 3DXAD 3EDFA 3PIQB 3EFFB 5CMAA 1CFNB 2H9GB 3G6JE 4F33B 1JGLL 1FIEA 3DUUB 3G6AB 4KC3B 3QUXD 4PJHA 5C0AD 3VD3A 1S7WB 1RULL 4KK9D 4R96B 5KS9B 1YEIL 2MTPA 1XF1A 4CGTA 3U6RB 1SEQL 4WW2B 2BCKA 3D85D 3W0WE 1HHGA 3AM8C 4XPGH 4L4TD 5E2UL 2UYLA 5FO9A 2FL5B 5HJ3A 2IEPA 3EYQC 1YY9C 1FZKA 5GRJL 5FYLL 3O6ML 3TF7C 3VDBA 2OL3B 3D2UD 3OSKA 1VESA 3MRJA 2OSLA 4XCEA 5GGSY 2J8UB 5D1ZC 1MHCA 3FO1A 5FECB 4N68A 3R1GL 2XTLA 2YXFA 3VWKC 1NBYB 4M1DH 4X4YA 4MQSB 2P5ED 3RU8H 4RWHA 1NL0L 2VLJE 3WO4C 5C0CA 4XPAL 4GKNA 1N7MH 5HY9A 1H5BC 2IMNA 1NC4B 2BVUA 3T2OA 4YHZL 4TNWF 1KOAA 4K94L 5INCA 1TCMA 1CE6A 2DTMH 1W72A 2EDBA 3PWJA 5I9QB 3HLAA 3WSQL 5EU5B 4HAFA 3OB8A 1T2QL 2DKUA 2ZOKB 3QXWA 5E2WH 4A6YL 1G9EA 2DMKA 5K9OA 5DS8B 1A14L 3P73B 3CLFH 4EKXA 5EN2A 1QLRB 4BFIA 1U8OA 5MEOA 3IS1X 4Y4HA 3QEGH 3ORJA 4NZTL 1MJ7H 1DUZA 3IJSA 3V0VA 3JWDL 1XMWA 1S9VA 2CDGB 5D6CA 4YK4C 4LHUB 5CHNB 5H37G 5SX4I 2N56A 2DQTH 1MF2H 1XGRB 3C5ZC 2DLEA 2J8UE 3LVEA 1LO0H 3OKLB 3PWPE 4M7KL 5D2NE 2H2PC 1A1NB 1DLFL 3AU1B 4OJFL 1BZ9B 5MEPA 3GO1L 4BSJA 2BVOB 3CIQA 5CS7A 4YXHH 3KXFB 4LSSH 3D39B 1RJYB 1J8HB 5L8LB 3BYYA 1N4XH 3O4LE 3GK8L 4PJXB 3H6JA 5CIPB 2HVJA 3BP5B 1G84A 4ZUWA 2C1PB 5IV2A 3O0RL 1A9EA 3INUH 5HYEA 2H3NB 2A9ML 3H7LA 4PRPD 1MQKH 3N1GC 4X9BA 2EYSB 3NH7H 4FP8L 1IT9L 4XVUD 4EN3A 5DJYA 1MCQA 1ZGLP 3L3DB 3BKYL 3DI3B 3ALXA 4OUUB 2AI0H 5F1SA 4TULL 4YHYB 3I6KB 1MVFA 4XPTL 4Z76B 3SKJL 4FFVC 2ZNXA 3OJMB 2UZYB 5TJWK 1YEEL 4QXTB 5F72S 3B9DA 4NRXB 5D2NB 4ZUVB 4GG8A 2F15A 1FCGA 3AS2A 3H9SA 2D4FA 1XF4B 4PV8B 5F97E 3HE6A 3SBWA 3S8WA 1BOGA 3IGAA 5DD5L 5BS0B 3D39E 4G42A 5E6IB 3EJZC 2MJWA 2E6PA 4HDIB 3O3EB 2AQ3A 2ZUSA 3SQBA 4EZMA 1D6VL 2Q3AA 3CFDA 5GRUL 1CDGA 5CBEA 4M1CC 1WT5C 4HS3A 5LBSL 3ARED 1HILB 5EBGA 1M7IB 2VDMH 4S1SH 3WBDA 4XP4H 2FX7L 3U4AA 3M1BA 4GS7B 1OT2A 3ZYZA 4XBGA 1RU9L 1K4DB 3G5ZB 5IMMB 2HVKB 2DBJA 1H3XA 3GMNB 1FBIL 1U92B 4OQTH 1SJXA 1ZSDB 5KVFL 3HLAB 1UWEL 2XWBA 1QRND 4L8BB 1JNNH 5GSRA 1LD9B 3KGRA 3V95A 1FBIH 4OQTL 4J3SA 4FFZL 4FQQB 4UDTB 4UU9A 3G9VA 3VXNB 1OAQL 1JJUA 3HNVH 5GRXG 4YFDB 3G5VA 5GS2H 1GOGA 4JM2C 5CEZH 3L6FA 2VR5A 3D3VA 2DF3A 4WHTB 3GMRB 3V6OC 4DEPC 4XP4L 4EI5A 3BHBA 4HKZA 3WFEH 1ZEAH 5IBUG 2CXGA 4LDLB 4FQXB 4YX2L 4S10A 1I7UB 5I0ZA 3ZZ1A 1N0LA 2VABA 4JRYD 4L9LA 5HJ3B 4LASH 5F1IB 1CXHA 1H8NA 3DGGA 4G8FA 3BWAB 3IDNB 3SE4A 2BCKB 4LEXH 5KBNC 2OTUB 5J8OA 32C2A 3QO1A 4QGYA 3IF1A 2D9QB 3P40A 4MAYC 1IEBA 4G43B 4YDLB 1J0KA 3RWDA 2UVEA 3Q2CA 3WN5B 3AB0C 4BK5A 3O3AA 4DUWA 4Y4FD 4NQSA 5L8KB 4E42B 4P48A 1VCAA 1NFDA 2DQUH 4KTDH 1XIWA 5F7DB 5HVGB 5FB8B 5JPMB 5F6HI 1L9MA 1YEKH 1A7OH 5EU4A 1IM9D 4OZ4A 3WCYA 1UWXK 2VJXA 4L29B 4CN6A 1YYLL 3B83A 1VB9A 4NJAH 4ZOCA 4BZ2L 3LSOA 2GTWA 1RJLA 4RZCB 5E9DE 2V7HA 4JY4A 3UDWC 3KJ4B 4AYFA 1GIGL 2DYPB 4LPXA 3TYGH 4QRSA 1KB5H 3REVA 4QF1A 4NQDA 3EYUL 2DTML 4L3EB 4Q74A 4CVZB 4ZDHB 1AP2B 4MNQB 4RGNE 1B4RA 4MJ6B 2ERJC 1QFHA 1IGIL 3C60D 1GAFH 3U0TB 3GO1H 4YDKH 3HUJB 2XTJD 1JRHH 3S4SG 1GGUA 5F7YC 4PUBL 1OWRM 4PGJA 1C5DA 1QSFB 2X44D 2APVA 1JHKH 4PLKC 5DR5H 4KRPB 4Y1AD 5D7IA 5I1HH 1J88A 2YC1A 3SCMD 1L6ZA 1MCHA 4RMUA 4JAMA 3LKNA 2VDRL 3TA3D 3DYOA 3STLB 1AGBB 4F7EB 1S7RB 1TQCC 3JZ7A 4ZFOB 3VFVA 4YGVA 1S9YB 4PB9H 2R4RH 4H5SB 4HF5L 4JJ5B 2K1MA 4HH8A 1AD0A 5DJ2B 4OLEA 3D0LB 3K8MA 1HINH 3BT2H 5B8CC 1ND0A 4S1DD 1T20A 3RVVC 3TZVC 4J1UA 1T2XA 3PV7A 1V3LA 4LPTA 1JTTA 1AGFB 3LOWA 4LSRL 2KL6A 2EYRB 3ARFB 1F4WH 4AEHH 3HUJE 4R8WH 5IGXH 4ZXBA 2VOTA 1PSKL 5ICZB 2AGJH 3AMKA 4WWKD 1I7UA 4HJGB 4OM1L 2FX8L 3ISWA 2MCG1 4JRYB 1FO0H 4J1UB 3P4MA 3WMSA 4OAWA 2BDNH 5F96L 1DANT 1MFNA 1RUKL 3OR6A 3ZKSD 4QRPA 2W65A 4FFYL 3B43A 1A3LH 5D5MB 2FWOA 4C83B 2DKMA 1OTUC 4XCFH 4EIZC 4DKFH 5E2UH 4P5MA 4V1DB 4XXCC 1YYML 2DLIA 5IB4A 1OW0A 4G9FD 3Q5YA 3CXHK 3K2UH 2JJTA 1Q72H 5CWSA 2AEPL 5IEHA 1Q9LB 1CR9L 2ADFL 1T7XA 1OW0C 2IFFL 5DQ9A 2C9AA 1U36A 1MRCL 2F53D 1V7ML 3E2HB 3S4SA 1A7NH 1FRGH 3WFZA 1FV1A 3VXUE 4MJID 1KELL 1XAUA 3QXDB 3B9KC 2EDXA 4U6YA 3VXMB 1DBBL 4UINH 2I25N 4K7PY 5CKGA 3VFRB 3MR9A 3ARDD 5KOVC 5CJQH 1IC4H 5EUOA 4MA1B 1YMME 3ULVL 1D5MB 5EG6C 3VWJC 5C1MB 3LAFA 1JPSL 4LSDA 4W4OC 1I85C 2EH7H 3GSNB 3MRMA 4APQC 1UM6L 3KPSE 1FL6A 2BFVL 4LU5H 4OI7A 2X9WA 4UAOC 2PYEE 4JB9L 1CI5A 2VWEE 2K3TA 4FQJL 4MXQC 4HZAA 1U3HD 3F12A 4K8RC 3ROOB 1F5WA 1KBGL 5J3HC 4JFEE 4MCZA 5JNYB 5DQJA 1LE5B 1T1WB 3AVEA 2DIJA 4OGYL 3JBG7 3LDBB 2BJML 4NHUB 4G6FB 3TESA 1G7LA 5CIPH 3FQNA 5E8PA 4P2QE 2VZ3A 5IHUL 2D9CA 4QHMA 5KN5A 4P5KB 3GSXB 2R2HA 5HHOD 1T1XA 5BXFA 3LQMA 3L3KA 5DVNA 2EZ0C 4Z7QF 2O5YH 4PRHD 5KSAC 1QBLL 2J88L 1YMMB 5I1CH 2UV3A 35C8H 1YMMD 5L6YH 3A67H 1X5GA 3BWAA 3LV3A 3R4DA 4IDJL 4PJCA 3SDYH 4C4KO 4EVNB 1NH6A 5D1XA 1EHNA 2W92A 3MV01 2C1PA 3WNMA 4PGCB 2OQJB 3LHPH 1G0XA 5KS9F 4R4NC 5A16B 5I18L 2JCCE 3O8XD 1FYTA 3L7FA 4YDIH 4ZS7H 5C0AE 4LQFH 4LSVH 3BUYA 3QUYA 5DUML 3SBWC 4HS6B 5IWLA 1CICD 3KG5A 4PJ5E 1CFQA 5DDHB 1J1OH 3L6FB 5F7WC 5HHNA 1A6UL 1IGFH 3H7BA 3QEUA 5EH1A 3OKLA 4KV5E 1D6EA 4JQIL 4WTZG 1L7TH 3T3PE 4P2QB 3CLFL 5EZJB 3OHXA 5HGDB 2DLFL 2BVTA 2CDGA 4B41A 1S7VA 5LWYL 3VDAA 5CKAA 1T2QH 4WWID 1ORSB 5IT2L 1VFOA 3MRNA 3QHZH 4XB7A 4PB9L 2EC9T 4JGJA 3IDJB 1QSZA 3EO1A 1ORSA 3O6FD 3LRHA 4X6BA 1CF8L 2ADGA 1OLZA 4BZ2H 5JW3H 3VFMA 2ICEB 1RK0A 5HYSG 4YE4H 3RIFK 2IBGA 3FL7A 3F58L 2QADC 4WHCA 1IAIM 4WW1A 1WBZB 5DJZA 1NEZA 5KAQG 3CFDB 3VA6A 1I9JL 3FMGH 4OCXL 1OSPL 4NFBA 1Z9MA 2W65B 1B90A 3L3JA 2P1YA 1BX2A 5DJ8A 2C4FU 4MNGB 4NZRH 3ILQC 1FC1A 1Z0NA 3NAAL 1AY1H 43C9A 1JV5B 5C08A 1VKXB 4A2LA 4X9FA 2ARJB 1I3UA 4OF3A 5DFVD 4D9LH 3D2UA 5T3ZE 1Q9OB 5FUCE 5HGBB 3CXHJ 2X4PB 4MX7B 3NN8A 4NO2A 3QHTC 4PJCB 4EVNA 2YBRA 2XI9A 5D1ZD 1YUHB 4F2MB 3NABL 3RWEA 3MRLA 1QRKA 4GJTB 3CUPA 4NN7B 2E7MA 4EUPH 2IQAB 4XXDB 1SM3L 3F7VA 4HIIB 1YYLH 3V7AE 2P42B 1MELA 5F6HJ 4NQVA 5E6ZA 4TUJA 3DX8A 4ZNEE 4UQ3A 3NIFF 3VXSE 1HXYA 4S1QH 4PJGB 2R2CA 3QSKB 3W9EA 4AIZA 2YD7A 5D2LF 4HJ0C 4OZHF 3IXTB 3WFBH 4Y8AA 4O2FB 3LPGA 5I1IL 1RY7B 2LVEA 2HN7B 3T0VA 4B7IA 2BK8A 1IEAB 4XPFH 5ISZA 4E9LA 2VXQH 4NQCE 2HT4C 3MLVL 4EDXB 3QBTB 1B2WL 2A6DB 4KJPD 1TZHA 3B9EA 4RWYH 5BV7C 1HH9B 5LQBH 1EPFA 4N9OB 1EV2E 2DAVA 4PJCE 4OIBA 4MJ6A 2W9DL 3SEPA 2D7OA 1KCUL 1E27B 4LGRB 1QR1B 3MJ9H 3PWUA 3PWPB 2CKNA 3OZ9L 3HN3A 2PXYB 4YGAB 3IFOA 2HRPH 5L0QB 3NGBB 4MJIB 5I6XC 4IOFC 2YSSB 4IIQA 1F8TL 3VXSB 4HUXA 3MBED 1JGVL 2GTWB 2R0LL 3SKUD 2D0HA 2W9LA 1T5WA 2GITB 4JFOB 1YEHH 3DSFH 2B4CC 4EI5C 2XZAH 2VN7A 4U1JA 4F7MB 1BBJA 3ALPA 5INCB 5IEHB 1CXEA 4EDWL 3BQUB 4LCIL 4X4ME 1BFSA 3ARGB 1S5IH 5IR1A 1AGDA 3H0TB 1WAAA 2Y07H 4L4VA 5HTSA 1QOKA 2BSSB 2X89A 3SHSA 2PW2B 5EOTB 1CLCA 4R2GC 4PJ7F 2A6KA 5DO2D 3MOAL 5DRWA 4OAWB 4E0RB 4JFZL 2HLAA 1FGVL 5HHPA 3FB8B 4JANB 4NQEE 4XBEH 4Y16A 2UYLB 5T1MA 2HTKD 1JGEA 2Y5TA 1T7YA 1SEBB 4XB8A 3S3JA 1AGEB 3TZVA 5DYOB 2D31A 4M1CD 4N8CL 5C07E 1FG2A 4Z77A 4F33A 1JPFB 2X6MA 1FO0B 3ULVC 1A7BA 1MCCA 1FHGA 4NCDA 1HI6B 1JPGA 3T0EC 4D3CL 4HPOL 5D1QB 3SKJH 1OWWA 4U1GB 5HYSA 2DQHH 2VLMD 4FXKA 2WINB 1LEKB 3SKMB 2VLKA 1S7RA 5IB5A 4C54A 4WGVB 2ITDA 4XAWH 2R2BA 4I9WE 3CX5J 1RZIA 4JFOA 3BEWB 5GJTH 2XWJB 4EQ2A 5HVHC 1I3VA 1JIBA 4PV9A 3QO0B 1S78C 1TZIA 1X4XA 1RK1B 3FO2B 3I02B 5TDPB 1LE9A 4G6FD 3HC3L 1R3LB 2YD5A 5C86A 5LGJB 4GRWE 1V7MH 5I17A 4P9MH 3RWCB 3V4VL 1BVZA 1HQ4A 4JHWH 1NUGA 5K9QG 1HHIA 2EH8H 3VMPA 1NUFA 5DA4A 1NCUA 1I1AD 5BOZG 1LE9B 1QLFB 3FO2A 3I02A 5E70A 3WDJA 3UTSE 1OAXL 3RUGF 2YN3A 4NWTH 3IFNL 4DVRH 1G9ML 2R9HC 4NO0D 4NN5C 3RWIB 5GJSL 2YMXH 5CZVL 3O2DL 1U2CA 1B6UA 1IAOB 1XIWB 5F7DA 5BRZB 5MENB 4YDJB 1KB9K 2ED9A 4R0LB 3TN0A 1MI5B 5E08L 3NACL 1ZLSH 1HI6A 2DWDA 4QEGA 3DRQA 3IFPA 3JVGA 1A9BA 1JTPA 3P30H 4OD3L 4MDIB 2CIIA 4YHZH 3HC4H 3UROR 5F7KC 1XIWC 2GCYB 2NY3D 3M8OH 4RX4D 5KSBA 1DDHB 2R23B 2RB8A 3GSWA 4GRWB 1IGFL 3PG2A 4Z7NE 4NT6B 4OZGF 2C5DC 4I2XA 4A6YB 1JWMA 1U8HA 3TA3A 1J05B 3S3SA 3BO8B 5IV2B 4F58L 4JRXA 4JVUA 3TIDB 4G6AC 2FHBA 4ODWB 5E9DB 5EZLA 5HI3C 2RFXB 1NSNH 2ZUWA 1ORQA 4NKMB 1WBYA 5E5MB 1YQVL 5BQ7A 3DV6B 1A4KA 3B2VH 3WJLA 1XCTA 5DUMH 2IADA 3X3GL 4YUEH 3NCJL 3V52L 3A67L 1DFBL 1Q0YL 1LEGB 5IM7A 4HCRH 3TJEL 2J6EH 5MENE 3WJJC 1T4KB 1HHJA 3BMVA 2XTJE 3K4ZA 1I3RB 2D0FA 4LVOB 12E8L 2P4AB 5E4EC 4HUVB 1HYSC 5D2LA 2R4SL 2V2TB 4NPYB 1T83C 4ZXBD 4F7TA 5GZNC 4UBDC 3BJLA 3E3QE 1Z9LA 5D7JA 5K9KB 1KIPB 1D5ZB 4JM2B 4WJ5B 5KSBE 4HGKC 1D5ZA 4KDVA 5E95B 4DW2L 5DHYB 5JZ7C 5EU5A 4RA0C 1BFVL 5E1HB 3ZDYE 3LKSB 1MY7A 1A5FL 4JRXD 4FQJH 2YRZA 5I8KH 1E6OH 4UILL 4OZGB 5HGDA 2BY3A 3OHXB 2VLRE 3CFBA 2HTLC 5FYJU 4PJ8A 4KUZH 4O9HL 3MOBH 1OARL 3GBMH 3IKKA 4OLUH 5EIVA 5IW6A 4LCUA 5BQ7B 3T4YB 5ISZB 4IRSD 3T2QA 5HHQA 2BNQA 1GC1C 4KMLB 3OKDA 5MI0C 1FZKB 4ENEC 1M7DA 1N3NA 3DECA 1JPST 4U7MA 2FX7H 4AENB 2FJGB 4NKOA 3UZVB 5TDOB 4QHKJ 1KPRB 1JCKA 4I18A 2GCYA 5KSBB 1U8NB 3FKUS 3NFNA 1I7RB 2BY0A 2YRLA 1RJZA 2YOCA 3GMOA 4KKCC 4Y19A 5IW3A 1TLKA 5C0CE 1PEZA 5IIEA 1IM9A 2UWEB 2B8OT 4JPWH 1C5CL 3BP4B 3HZYA 1U8NA 1N5AA 4XNMB 5B38B 2X4TA 4MMXC 4X5WB 3T0AA 4OZGE 1YUHA 2VMFA 1YYMH 5JOFB 2FJGA 2VLRB 1J9CT 4NKOB 5EC1B 2FNBA 1R3JB 3NCJH 2ARJA 4M7LL 1KSRA 3PWLB 4PG2C 4N1CA 4WW2F 1C16B 3V7MA 5HHQB 4P2RD 3BP7A 3BSZL 5J13C 3GGWB 5J1AB 1R3IH 1QHPA 2P5WB 2KDGA 4Z5RB 2HLFD 4X0KB 3RWHA 4EUPG 4TUOB 3PL6A 2HG5A 3HB3C 3ZDXE 1BD2E 1BZ9A 1EBAA 4N0FB 1RZ8A 1VFAA 1QBML 3FQWA 4HKXA 2F54B 3DVNA 1SJEB 3MLRH 2NY5L 5AZEH 5I17B 2W9DH 3SY0A 4APQA 5ADPH 3C2SA 1HZHL 3V5DB 1XGPA 1DUZB 3IJSB 3RGVB 5AWNL 4WV1B 3MFFB 2AJ3B 2C3VA 1HDMB 2XQBH 5EUKB 1RUPL 1H8SA 1BHGA 2JK5B 5FYKD 3MA9H 2O93L 2E9BA 4PS4L 2GSIB 4UOJA 1VPOL 5BJTB 2ZOKA 1L7IL 2JIXD 3BEWA 4LVHB 4MAUL 4N5UA 4XH2B 3RAJL 2AJSL 1RD6A 3WKML 1CE6B 3HMXA 2W0KA 4JHZA 5F8QC 3DNKA 3MRHB 1HHKA 1QRNE 4S1RH 4HKBA 3RDTD 4K3JH 4OGXL 4WNQB 5I66B 3IU4H 4IS6B 4O02L 4Z0XA 3TA3C 3KLSA 4HW6A 1XF5A 4GW1B 4CKVX 3TBSA 1MJ7L 3EJYD 4NYLA 1MHPH 4DQOH 1MFAL 3HFML 1QKZL 2BRRL 1MRFL 3RNKA 3CPLB 3FFDB 1QSEE 1U3HA 1BD2A 1QG3A 1D3CA 5FDYA 1K8DB 5E9DA 1X5FA 4HWBA 5ICZA 5DSCB 2E8ZA 4S11A 4JO3L 4PGCA 4JFYA 4UIKL 4DW2H 4JFPA 5C9JB 2YR3A 1N6QH 2BVEA 5I1EH 2EYRA 5CCKL 1HZHH 2AJYL 4P49A 1QQDB 1XF3A 3GSWB 1NFKA 1CXIA 2DQEL 4IIQC 1MREH 1KENH 3MLSH 1A64A 3RX7A 3LIZL 4MDIA 3NIGF 1I1CA 4QHKI 5ETUA 3UC0L 4GBXC 5KANG 2DQUL 4KPHL 2H1PH 4HS8H 5EIQA 4GUPB 3SGJA 4F8QA 1N26A 3TIEA 3ZT6A 3KPPB 1RZJL 4HD9A 3UJIL 3A6BH 1IAIH 3IS0X 1OSZB 4PP1D 4LCCA 1QKZH 1DN0A 1L9NA 4QXUH 5GGUB 1QFWI 5C09A 4ZFOA 1KTDA 3DBXA 2VDQL 1XEDA 2BOCA 1MNUL 4XI5C 1MLBB 3V0WH 4PRDA 4RDQF 4WDIB 5IESH 2CDEA 4JO4H 1BD2D 3SDCC 5I1CL 5ANMB 4IIQB 3VXSA 5EC2A 5CGTA 4LP4A 4IJ3C 4RMSA 3G5YB 3UZQA 2WLZA 2A6IA 4RIRB 3CDCA 3TPUA 2WZPD 1HQ4B 2ZKHH 1UH4A 4XCNA 3WO4B 3CX2A 2VIRA 3W0WA 2FO4B 2XT1B 1I1AA 3VD7A 2HP4A 5I19L 1T7ZA 1CD9B 4HMDA 1EUUA 2WWKT 1EAPB 3D85A 4ZFOL 4FFZH 4ZUUB 4JQIH 3THMH 1CXLA 3C5JB 4I48B 4ODVL 4EI6A 4GQ9H 4UT6H 1AGCA 4U6XB 5DQ9B 3IDGA 3SGKC 1BFOB 1FN4A 1KEMH 4X7TA 4JFDB 4NM4L 3V5KA 4MNHB 3PDOB 1KEGL 4X5XB 1MIEH 3SGEH 4X6CB 5CD3A 1WUNT 4PJGA 4U1KA 5EO1B 2NY4B 5GRJH 1TNMA 3S35X 4GUPA 3VXSD 1MWAB 1MCLA 1ZA6B 5C8JB 4HWZA 3SDYL 4ZFGH 4QRPB 2Q86A 5LJYH 4LSUH 1DEEB 5GGQH 4U3HA 4HJGA 1BGXH 5GGSB 2UVFA 4TPRL 2H2SC 3M07A 1MRCH 2AXGA 1NGPL 4G6JL 1RIVH 5C9JA 2R4SH 4XNYL 5C08B 2OMBA 1KACB 4XCCH 3U7YH 4PRAA 1FL5A 4HUUB 1ERNA 2XKNB 5CZXD 5DEGA 2QBWA 1GHFL 2B2XL 4YHML 1UM6H 3LZFH 1CLYH 3QHFL 1CDJA 4RAVA 4OCWH 1KJ2L 1FLRL 3GMRA 1HYSD 4KUZL 4O9HH 3VXPB 4Y4FB 3QIBC 3QQ3B 4LVEA 2Y4SA 5IJKA 4JKKA 5A40E 4HBCL 3TBTA 3UTOA 4YGVB 1KIQA 3SCMA 1MCKA 1IGTA 5SWZB 4X6FA 1KCRL 1CDUA 6CGTA 2CH8A 2XXCB 3BGAA 5D7SL 1RVFL 1VGKA 2NY1B 2WM0A 1HKLL 2GSIA 1QLEH 5BJTA 4AH2A 1LO4L 5DK2A 1I1FA 3WYRA 3HE6C 1SBSH 2WBKA 4LLMA 4FP8H 5HPOA 1K4CB 3FO9A 4D0DB 3OAZK 1H3VA 2MPAL 2DQIH 2ICES 4MHHI 3DXAB 1N4XL 3VW3L 4W68A 4MA8L 4NM8H 2R0ZL 4UTBL 5EOCL 1HCFX 2FO4A 3P9MA 3FB5B 1KYOJ 2VDKL 2Y36H 5C08D 2HKFL 4YHNA 43CAB 2HT3D 5CBEB 3H7BB 3PL6B 5F96H 4PJIE 1S7XB 1JZ7A 4ODXB 1MVUA 3GKZA 4Q9BA 1HIML 3FOMA 4Y16D 4JZJA 5FO7A 2DTSA 1SQ2N 3L7FB 1FYTB 2XN9B 1DL7L 3MRQA 4Y89A 5EU4B 2FGWH 3HMWL 3KPNB 1P7KB 4OZIB 4IRZL 2Y1VA 4HK3J 4FHBD 4GOSA 3WEXB 2CKBH 4OB5H 1JHTB 3WD5L 3IU3B 3EFDL 2FYYA 5A2LH 3W5NA 3G6JA 3DIFA 1BBDH 5C0GA 5I8EA 3D25A 1HE7A 1LK3L 5LCVH 1MFBL 1VSCA 3ES6B 3NFPA 1I7RA 4Y19B 3QG7L 5I1AB 2YN5A 4NZJA 3D69B 4CN1A 4XMKL 4JFQA 1CQYA 5EUOF 2EDKA 4F2MA 1B0GA 2EKJA 3FRPG 2IG2H 1RZJC 3MRFB 4PR5A 2MMXA 3NPZB 2N4IA 4RGND 3EJYC 1A7OL 4ORGA 3ULSA 5E08H 1U91B 2HVJB 3BP5A 4F3FA 4HWUA 3HA0A 1XGYL 2V7NA 1JVKA 3TN0D 4EXKA 5TQ0L 3FFDA 3MV9A 1RZKH 4WTWA 4M7JL 2XN9E 2VUOA 3EZJB 2ZOLA 4NYLB 3GSNA 1S7TA 8FABA 4XPGL 4PJHE 4PJ8B 3L1OL 3MFGB 4KHXL 2FSEA 43CAA 1XGRA 4HIHA 4MLIA 4JO1L 2I60H 3QI9B 2H1PL 4HS8L 4LKXB 4OF5A 3IFLH 1XR9B 1OF2A 4R4FL 5C0JB 3UAJD 1JGLH 3VI3F 4ALAH 3QUML 4HG4K 2DBLL 1DZBA 4QY8B 4YHPA 4G8IA 4JLRB 2NY2B 3JTSB 4LAQH 4RAUA 5HHOE 2GJ6B 1AO7D 4MQ7A 4Q2ZA 4Y4HC 4G9DA 4XBGB 1I8KB 4F57L 3X11A 4FQPA 2R69H 1NBQA 1YMHB 3CFKB 4CAGA 1L0YA 2VLLA 2XKUA 4PJEF 3FFCD 2DM4A 4GRMA 4ZAKD 2NY2C 1NDMB 4QRUB 3QRGH 3BIKB 4CVWA 4U4BA 1YY8A 1EJ6A 1NUDA 3EZ8A 5SV4A 5L9DL 4Y4KB 1RZ8B 4OF6A 4FG6C 1D9KD 3IU4L 1P1ZA 1EFXB 4Y5YC 2IF7A 1OTTC 2P5WA 3HE7A 4HPOH 1OCWH 4MZ2A 3W5MA 1U93B 3MOQA 1EAJA 2RFXA 4OCWL 2DQFA 3U7WL 5EA0L 5IVNA 1D5BA 2OYPA 4GAGH 4NGHH 2X10A 3UEZA 5J12B 2EIEA 2J5LB 1ZKAA 1T0NA 5ADPL 1IEHA 2AXFB 3HAEB 4PG2A 4P9HL 2CIIB 1CR9H 2ADFH 4U6VL 1IM9B 4K9EH 4XNXL 4I5BA 1NEZG 1G9NH 5C0ND 1MRDL 4NSKB 3HRZA 2E9JA 2NY6C 4YBHA 1F6AA 1UJ3A 4LLDA 1KGCE 4UBDD 1TFHA 2Y6SD 1X5HA 4QOKB 5DQJB 1TZGL 4X99A 1LE5A 4MCZB 5JNYA 4IEFB 3EOBA 4GXUM 3VFTA 1S7SA 2W0LA 1FO0L 1NDGB 4HXAL 4WU5A 2VAJA 2XICA 3HE7D 5BW7A 2AXJA 2QQKH 3VA2C 1QFWH 2AK4A 2IWGA 5I6XB 3D85B 3V6OA 4UMGA 4M4RA 1SM3H 2HKHH 2IALA 1MIML 1MJUH 1M71B 1IGYB 4U6VH 2UUDK 1T3FB 4L3EA 3HG1A 1I75A 5J1SC 4QRSB 1WCBA 4M62L 3VFRA 4BSVB 3EOTH 2Z31A 5BO1H 2R4RL 5I0DA 2V7HB 3SPVA 3DX6A 2X1OA 1GRWA 1ZT7B 1FV1B 5I8CB 2DD8H 3BPCB 3IDUA 1VGKB 1F3DJ 3EYFB 2X4NA 2R2BB 2ITDB 4QOKE 4X6DB 3DJ9A 1V5JA 5FHBH 4GG6A 5I1JL 4KJYB 4OLWH 1UEMA 1IAIL 1G6RA 5FDWA 1M05A 3BWUC 3G08A 4O5LL 4DAGH 5EWIH 1JNHB 4E42A 5I1IH 5C0CB 2VDPH 4G8EA 1OB1A 1UEYA 4O2EB 4NQDE 3RBSA 5JORB 1OARH 3GBML 5E2JA 5BOPA 5I73B 4FQHB 1YEEH 2LFGA 1MREL 3EOYG 3WJJA 4N0UA 1HWHB 1SYVB 2HFTA 3MRJB 1U8PA 4Z0BH 3KHQA 4JRYA 4XPHH 4YDLC 5BVPH 2WP3T 4TTDC 5F9OL 3CNKA 4D0CA 4XP6H 3MACH 4Q9CA 1N6QL 1GGCH 4QTIH 4WY7L 3NIDF 3DVIA 3PNWB 2KQNA 1JWMB 1HHHB 1FP5A 2AXGB 1ZHLB 1P7QD 3FTGB 4CRPA 3GIZL 2VXVH 2DLFH 2A9MH 3LQAC 3IFLL 3NOIA 4XPAH 3TGXA 4N0UB 4WFEE 2DYPD 3KR3L 4DQOL 3VXRA 3JWDC 1JGUL 5HYQB 2FHFA 1B4JL 2PW2A 3VH8B 1MI5A 4ZD3H 5JHDE 1U58B 4NRYB 3EYSL 2DQGL 3QXVA 1DLFH 4OJFH 4GG6B 2A0LD 4RBPK 5H35A 4L1HA 3QCUH 1Y18B 4K3EL 4PRPB 3ARGD 4BH8B 4GRLA 3T08A 1O0VA 5IBLC 4YFLI 2WWMC 3TWCL 3MCKB 1W0WB 2BY2A 4U6TA 3O4LD 4JFFB 3BQUC 1RUPH 2P47B 3G5ZA 3DX6B 5DD6B 5T5NF 1EO7A 1PKOA 3QCTH 3BW9B 5EUKA 4JM2D 5TH2B 4Z7QE 1LGVA 3QI9D 1V8HA 4BZ1H 2AJVH 3I2CH 1QNZH 1T22A 3QDHA 2FZ3A 2W91A 3QG7H 3N0PB 3WHXA 3NPSC 5C0BE 5ID1B 1ODAA 4RFEB 3FRPA 1MHEA 3QNZA 4X8JB 2A6IB 5DEFB 5EFIB 1BBDL 3BW9A 4PJDE 4OFIA 3QDMD 3T0WA 1S5HA 3SDDD 4HJJH 5ANMA 3F7PC 3LSOB 2Y5EA 4JFFA 4NKDA 2R29L 4C55A 5F1NB 5GZOC 3UJJH 1URLA 2X42A 3UAJC 1Y18A 2FEDD 4KRLB 4G8GB 4PRPA 4S0TD 4ZTPL 4NRXA 4XT1C 4DVRL 3WDIA 3NFSL 5JIKA 4I3RL 5T1LD 5DMKB 5IFJB 3BEVA 1RU9H 4HGMA 3B2UD 1JYWA 4JZNB 1JRHL 4XNMA 3B8YA 3FRUA 3V4UH 2YPKA 1UM4L 2XFXA 5IEKA 3KYMA 3T0XA 4L8DB 4Z7WF 2EDJA 3MRLB 3JV4B 5ICXB 3VFSB 3RL1A 3QDJD 2H3NA 2ORBL 3IXAB 3DGGB 3D2UB 1T66D 3FB8A 5KVDL 3AM8A 1LDSA 1I1RA 1EMTL 3MACL 1J0IA 5FA3B 2VDPL 5SX5K 1IKFH 2ZCKL 4NNXA 4FRWA 1INDL 1KBGH 2SEBB 2KPNA 4G8GE 1YEJH 1G1CA 4CADB 4L8CA 1NEZB 1N2RB 1OAKH 1OLLA 3MYJB 2P24B 4H1LH 2BNRE 2BZDA 4KJYA 4OZGA 3U79A 4S1DC 1X9QA 3ZE1F 3DYMA 4LMQE 4OT1H 5IKCA 2EE9A 3QUXB 3QPQD 1T1YA 2NLJB 3DMMD 1T03L 3REWB 3CMGA 1EH9A 3LQZA 4FZ8L 5DJAB 2J8UF 5HYJD 2A73A 2X5PA 2VQ1B 2Z31B 4LASL 5D7JB 4K2UL 2E7LC 4K7FA 3N9GH 3CXDL 3OXSB 1RQ5A 4Z7OE 4RFOL 1T0PB 3TNNB 3PWPA 3C9NB 5CSZB 2DKSA 1I85A 1H5BB 2AK4D 3I6GB 4QHLA 4HKXB 4MXWL 3FO0H 4ZPVB 5GIRB 3ZKMC 3LN5A 3CZFA 1YQVH 5DA0B 2F54D 5IK3B 5ESAA 4NWUH 2DDQL 5FA3A 2B4CL 4LP5A 1CK0L 2VQTA 4XVTL 1YEHL 3DSFL 5GQBA 1KT2B 1IEAA 2H26B 2ED8A 3GUTA 4AL8H 3MROA 5MP6H 2BNRD 5C08E 3S98A 1MRDH 4JEGB 2ICWB 5EBLB 4LSRH 2FL5A 1A6TB 3O6FA 3MYZA 5HHXH 1FZJB 1RMFH 3VI4F 5IGXL 1Q0XL 3WSQH 3K46A 3PQYA 3I6KA 4EBQH 4JR9L 4KROD 3IVKB 1Z0MA 3NCYS 3AMLA 3WUZA 5ALCH 1OAYL 3BGFB 2X05A 1CTOA 3TLRA 3EFFA 5CMAB 5JOEA 2OZ4L 3IAPA 4WHDA 5L2JB 4FQIL 4GAJH 1A7RH 4HC1A 2XXMB 4YIQA 5FHAH 1AR1D 3ARUA 4QRRD 1BF8A 1T1WA 1KC5L 2ICWA 5IMLA 3LN9A 4FXGA 2P5EB 4XNQB 1JYNA 3MRQB 4KK8D 3VFWA 4DCQB 4OCNC 2VDOL 3F12B 4QHNB 3ROOA 3ZKXC 1YN6A 3TO4C 2GJZA 1S7XA 3QR2A 4AMKL 5L8JB 4U1SB 3CZFB 2AJXL 5ESVA 1UB5B 4KKBC 4PJ9C 5EFIA 4M48L 4C4KT 4LLYA 3TO4B 1F6LL 1JZ2A 2NXZB 2ATPB 3SJVD 5L2KD 2NPLX 4Y5YB 3FB5A 4F7CB 1X5IA 3KJ4C 4YO0B 1QVOB 4DN4H 3CFCH 4CJ1A 3DXAA 4HSQA 4PJIB 3QRGL 1FE8L 4OCMC 1U8OB 3K8KA 3KPOB 1ZVSA 4F7PB 1KN4H 5DS8A 1IVLA 1FYTE 5C0AA 2MNUA 5ALBH 5DJAA 1CVRA 3QPQC 2WK2A 1KNOB 4HFUL 1EIBA 4PJ8D 3RDTB 4AEIH 1V7NH 1GC1H 1FSKC 1MAKA 1B6DA 3IRZA 3L1OH 4KHXH 5SWZA 5ADOL 5F9OH 1CICC 4ZFZB 3WN5C 4LDOB 4LSSL 1SY6H 4UNTA 4NQED 1MCFA 2BRRH 3X13A 2FEEI 2P8PA 4QTHA 4KJPC 3U1SL 4QLRA 4DZ8B 4TNVF 4JN1H 1R5WB 4HQQH 2FWOB 4YXKL 1ZLUK 3NGBC 3W2DL 3L5XL 3QFJD 4K3JL 4RDQG 3AY4A 5GGVL 2NY0B 1A4KB 4U1NB 3CX5K 5D7IE 5IFAH 4D9RE 3F6LA 1ES0B 2OSLB 3OG6B 3NCBB 5I1JH 3CSGA 1S7QB 1BM3L 2NY7H 2GK2A 4P23D 3BIBX 3BISA 1GCFA 5JA9A 1XGYH 3W11C 4ORGB 2R1YA 3LH2L 5D1XB 4IJ3B 1LP9B 3EOTL 1FNGA 4PJXF 3RWFB 3JV4A 5ICXA 3VFSA 4QOKD 3HG1E 4Z95H 1F90H 5B3JF 1U8PB 1WGOA 3MV8D 1DEDA 1NAKH 3NFPB 4JZOB 1MFEL 5EU6A 3FT3B 3RHWK 4Y5XA 3MXVH 4I4WA 3D0VA 3QWOB 4R9HA 5FGBC 5BW7C 3RDTC 5C0GB 1AD0B 5D4QA 2A1WL 1BWMA 5AD0B 2EIBA 1FIGH 4KKLC 1JHTA 1H3GA 1BAFL 1A47A 5JUEH 2K9UA 3UYRL 4MNHA 4PJFF 5ID0B 1S9KC 4GRLD 5JW5A 4BK4A 4HXAH 4V1DD 4LLUB 4Z7UF 1IZJA 2R56H 2C3XA 3TT1L 2AV7B 1AGCB 4U6XA 4XVJL 5K59F 1NGWB 3TNMA 3CAFA 5D7IB 3KJ6L 1MAML 2XQYG 4YDIL 1NBVH 3GFUA 2WQ8A 4KI5F 2MCPH 2VAAA 5FYLH 5IB2B 5FIEA 4M7LH 1XGQA 2DL9A 1QTYT 1KJMA 3T0EE 3HPJB 3MGAA 5GGTA 1NKOA 2CO7B 5H8DA 1JGVH 1SYSA 1UH3A 2OLDA 5JW4N 4XRCA 2ZSVA 1D5MA 4P9HH 3HG1B 1RULH 2BSRB 2V9QA 1GPOH 3G6DL 3ZTNH 2VZTA 1XGUB 5GRUH 3QNXA 5FUZL 3TPUB 4P3CL 1G7IB 4D0DA 2X1XR 2XY2A 3EAKA 4IMLA 4NQUA 1EFQA 3T1FB 3WL9B 2LU4A 3FT4B 1IAKB 2H32B 5IROA 3ARWA 4UDUB 4NGHL 4ZO8A 3ARDA 1F4XH 5J6GA 2V2WA 4PJBF 3GSQB 4ISVB 5CD5D 1LNUB 3CU7A 2ENYA 2Q8AH 1KTLB 1OL0A 5HVHB 3SCMB 4YR6B 3X17A 3PJSA 2X89D 4Q9RL 4GKOA 4KDTA 4F37F 5TE7H 4R0LC 3GBLA 4HWEL 5DJDA 1HNGA 1HXYB 2DL2A 2FO1A 2NX5A 2Z0BA 3LN4B 1NGYA 4LCWA 5K93A 2NZ9C 1FVCB 2LVCA 4R90H 3T0EB 3IJYA 3TCLB 3C8KA 3V79C 5I9QC 4HIIA 3FT3A 1AXSB 5JOPE 1TXKA 2HFEB 1UADC 3NPSB 4M5ZL 4UV4H 4YHKH 2EXYC 5D7LB 3FAWA 3GKWH 2Z8VC 3T65B 1PZ5A 4TSCL 3HKFA 5CJQL 4YQXL 1N8ZA 2JJVA 4HGWA 4LLQB 4G8FB 2X4PA 5KVGH 1CE1H 1FDLL 3KYKL 1JF1B 3GK8H 4QNPF 3NH7L 4GMSL 5IMOA 5JHDD 2B1AH 5JR1H 5EO0A 2HAZA 5D7LA 5AYUH 1H3PL 3O0RH 2HFEA 3GRWL 4HKZB 5IVZB 1MFCL 4YPGB 3BH9B 5EU3A 3ZYOA 4R4FH 3QXTA 1Q72L 3C2AL 1WT5A 3P9LA 3S96B 4IOFD 4BA8A 4LIQH 3SE3A 2C3HA 5JHDA 5C0FA 5FFLA 5I66A 4HUWB 1CDCA 5I2IB 5F88B 1FCCA 3MA7A 4PJCF 5ACMA 5A2JH 3NMEA 3MXWL 3D48R 2XPGA 1MIEL 3GJFA 1U8JB 3L7EA 3RUGE 3PGDA 2DQTL 2YC1B 2ZCKH 4XH2A 3W82A 1DQML 3V4PH 3AAZB 1U92A 2OR9L 3H3BC 2WNGA 1ZVHA 3MNWA 4WUUD 4R4BA 3T1FA 4TNVK 1YNTB 2KH2B 1EJOL 4WO4C 2XY1A 3MBEB 5IG7A 3HUJA 5D8JH 4M5YH 3EO0A 5FKAA 2AXHA 5HD8D 4K94H 5IB3A 7CGTA 4DN3H 1YEFH 3QIUC 1RZ7L 1OPGH 5JLZB 1F2QA 4LLWB 3KLAB 4XGZA 3VWKB 4KHTH 3MCLH 4U33A 3C5SB 3O6KH 2YD3A 3VWKD 1OGAA 4U1LA 5AZ2H 3UPRA 2Z92A 3VFUA 8FABB 3PHQA 4F8TA 3GBNH 3MQIA 4Z5RA 2CPCA 4ZFFB 4G42B 4FQ2L 4RSVA 1NGZA 5GS0C 4M6OH 3PGFH 1C16A 2B4CH 2V7NB 3OKYA 3P77A 3VXOB 1MLBA 1ZA3A 3B5GA 4P2RA 4PUBH 1JNLH 5IBLD 4WHYG 1KB9J 2XRAH 5D7KD 1DN0B 2XKSA 2EH8L 5E1AA 4OFVA 3U1SH 3MBXL 4JFQB 2F74A 4YK4B 2PTVA 3TV3H 4WUUE 5EOCH 4NQVB 3HMXH 4H88L 1IGIH 2J5LC 3HI1A 4Z18A 4PY8J 2VDKH 3SDDA 4L4VE 3SJVB 5L2KB 2VNCA 3GSXA 5T1DH 4AQ1B 1M6OA 2Y06H 3HCVB 5LG1A 1J12A 2UZIH 5E4EB 4ZUSB 2BHZA 1L0QA 1OAZH 3D87B 3ZSTA 3U2SB 4MXVE 4PRPE 5IBTH 5C0RL 2MOVA 1AQKL 5CILH 3TO2A 2IBZX 5EBLA 3WFCL 2VABB 4L9LB 2EXWC 4F9PA 1JV5A 2IPTL 4E5XB 4L3ED 2JIXA 1I4FB 3E3QC 4Y4KC 1IGCH 4FQXA 1X5LA 4MNGA 4FS0A 3T2NL 1FNEB 3PWVB 5ENWA 4L5FL 4UOW0 2YPVL 4WHTA 4W6XB 4G6AD 1WQVT 4S2SA 4R90L 3L3HB 4IS6A 4PGZA 1MHPL 2AK1H 1H5BA 3WKMH 4OTXL 1IM3B 4PGDB 4XAKD 5JDSA 1HHKB 3MRHA 5CHNA 1H15A 1ZT4B 3NIDE 4AQOA 4PJDB 5LAXB 3LKSA 1I7ZB 3R8BB 3O2VL 4Y4HB 2VSCA 3T77A 3F7QA 2GY7B 4NQCA 1INEL 4UT7H 5F93C 1KCLA 2YD2A 2BVPA 2B1AL 5JR1L 1FGVH 2EEDA 4XP5H 4D9QE 3MA9L 2NY5H 2NLJA 3ME0A 5HHME 5K9JH 2YZ1A 5DRNB 2PUQT 1P69B 1CGWA 2NX5E 1XR9A 5C0JA 5AWNH 3ALWA 2XA3A 1OD9A 1TIUA 4PJ8C 4Y5YA 3RKDD 2VLKD 1DBMH 2JB5L 1MJ8H 1AXTH 1KLGA 1HSAB 2OJEB 3L5WA 4JPKL 1PLGH 1U6AL 4HIEA 1P53A 4EDWH 3CDYA 3BH9A 2ZUQB 3LEVH 5EU3B 5IVOA 4K3DH 4KVNL 4LGPB 4P57A 3VCLB 1YPZE 1FNHA 1BOGB 2DJUA 4G9FB 1FL5B 1A3LL 3ULSB 1UACL 1UKQA 1FSKB 1U8HB 3TA3B 2B1HL 5TPWL 4ELKB 1ZANL 5DO2C 1F3DH 2VLRA 4K9EL 2QLVB 5JZ7D 2HRPL 4G7VL 4Y4HD 2OR7A 3MC0A 4PJAF 1EEUA 1DDHA 2PO6A 4MD0B 4P23C 3VD5A 3ULVD 1QPXA 1N5AB 5DK0A 3LQAL 1HINL 3BT2L 1F90L 4QHUB 1R0AL 2NY6D 5E5RB 3IVKA 4YH6A 5DFTA 3EW3B 1T21B 4HF5H 2OR8A 2NX5B 4WENB 1FC2D 4WFHD 1EBPA 2ED7A 5F71A 3GMLA 1BP3B 3BEVB 3Q5OA 2ZP0T 1WC7A 3EJJX 3FQXA 3EO9H 4N90E 2OXGA 3AB0B 1E4WH 1W72H 1JUFA 4JY5H 2IBBA 3P77B 3IDGB 3MRPB 3MUGA 5EA0H 4XPBH 3OKKA 3UYOD 4GT7A 3MV9E 5F1NA 2Q76B 3CDFA 5I74C 3D39A 4UDUA 3WFDH 2JKXA 5ESAB 5E94B 4YHIB 4ZUUA 1J7VR 4CDGC 1BEYL 3A6BL 3S37X 2HMIC 4I13B 1CD0A 1RURL 3Q5TA 5J57B 5DD3H 4UUJB 4XZUA 2ERJB 3CD4A 4KKAD 3VGGA 3PWPD 3QQ9D 4LIQE 1VFBA 1ZE3C 3WE6B 1YEJL 1MHEB 4M00A 1BFVH 4JQXA 3MOBL 1MOEA 5IVXF 5CSZA 1V7NL 1I1YA 1RZFL 1C08B 2F5BL 1NCWH 3I75B 3BKYH 2UY6A 3STZB 1AKJA 4GSDL 4LLAA 3JVGC 4O58H 5E8EA 5IBTL 1WBXB 1IC1A 3ARFC 3WFCH 4N0YL 4HC1H 4ZAKC 1YNTA 3KYAA 3OJDA 1MCOH 2NY6B 4BM7A 5DK2B 1U8KA 2LE9A 4JZJC 1GGBL 2XWJA 1NANI 2BX5A 1AO7B 1KIUA 3O41B 2I27N 1TDQA 3DO7B 4J12A 5C7XL 2OMNA 1RURH 1NC4A 1OOAA 4DN4L 4XHJC 4HUWA 5KZCD 3RGVD 3I50L 1K5NB 2A9NH 4WWKB 1MF2L 5FGCB 4XHQA 5D1XC 2WW8A 3K4AA 1J87A 2C1OA 3AXLB 1PY9A 1DFBH 5J56B 3FN0H 3RWDB 4ZMAT 5L0QC 4RCAA 4Y5XB 3ILPA 2A9NL 3B5HA 1SMOA 1HKFA 2CGRL 2XKNA 2X2YA 1SEBA 1NSNL 2NXYD 2I9LB 4FZEL 4OF7A 4PY7B 3ZE2E 5DEZA 4TQEH 3KPMA 5DWUH 3ESVF 4MGXA 4P0DA 4DKDC 4PG9A 5BV7B 3U0WH 5HDQH 5GGSA 1WV7T 5MERB 5TQ2L 1YEFL 3RVWC 2GAZB 4NRZB 4NC0B 1Q0XH 4KK6C 2PTTB 5E56A 1UFUA 2D7TH 5TE6L 3S3PA 1AO7E 3G6AA 1I8LC 4U1HB 3KXFD 3SGJC 1EJOH 1FVCA 3VXTB 4BFEA 3GJFH 2G2RB 4O2EA 4YX2H 1KLUB 4M5YL 4PRHB 4Z78A 1GYAA 1N0XH 4I0KA 1K5NA 4ZQKB 3ECBA 1ULVA 4LPWA 3VE0B 5F8RC 1ROWA 1P9MA 5JQ6L 4IOIB 2VB5A 4LQ1A 2FGWL 4JM4H 5IQ7L 3C5JA 1INQA 4MB3A 3VXQB 1TQCB 1JFQL 2FR4B 4HUXB 1DE4A 2GK0A 3OJDB 3BJ91 5FM5M 2E8YA 4MJIA 2AJ3A 4YHOL 4PJ9A 4MXWH 1J18A 3B6SA 1UQSB 3LKPB 1FGNH 3HRPA 4P46B 1P7QB 3QNYA 2ZSWB 4Q6IA 2AJZB 3WE6A 4JFHE 3IKCA 3NZHH 4JY4B 1YECH 2VAAB 5IB2A 3CH1A 4RMQA 2NY4C 4XP5L 5E6IA 5HYFA 4XI5D 1VDGA 1CGUA 5C70A 3L3GB 5DI8B 4P5TD 3HE6B 3PP3H 4IOIA 3VWJA 2XACC 2DMCA 1BMGA 3O3BB 4M61B 3D6GA 4M7ZB 3L3IA 1HYRC 1Q1JH 4Z76A 1IGCL 4CW1B 3QJHA 3B9KA 3LCYA 5ITFA 3HZYB 4MYWB 5E8OB 4Z77B 3N50A 1RZGB 5SWSE 4PJ7B 3RL2B 2IQAA 3RA7H 3CC5B 4PTUA 5HHOA 4U7SA 1CLYL 4ZS6C 3FZUD 2P44B 3KYNA 4J3UA 1K8IA 1P2CA 3OB0H 4AENA 4OM0L 1RUQL 1A9EB 2DQIL 3A6CH 1PBYA 4ODSH 4FQCH 4X6CF 3SDCA 5FO8B 3U9UB 1KJ3H 1KXVC 3CDGB 1J0JA 4KWUA 1TPXB 1TVHA 2H26A 2AEPH 3OAUL 4Y19D 2GY5A 1WIPA 2DIBA 3VI3E 2QADB 3RNKB 1MEXL 4WEBL 3IRPX 5IHBA 1BQUA 5GISH 3I3BA 3DURA 4PJBA 4M3KB 5FGBA 4GW1A 1Y0LA 3RZCD 3O3UN 3QISA 4WW1B 3X13B 5T1KB 3H0TA 3MBXH 3U0PB 3LD8B 2Z8WC 2ZPKH 3NFSH 3ARSA 4GLRH 1BBJB 1XH3A 1ZGLM 3DROA 4P5TC 3HZMA 4K7FB 1VADA 2VLJD 3CJJA 4PJ7E 3KWWA 4L4JA 4DK3A 2B2XH 3O6KL 4RAUB 4GH7B 3WXVL 4W6YB 1R24B 3JV6A 4M1GL 4YHYC 4OD2B 4G8IB 4R3SB 3U4EB 4XNYH 2AQ2A 2QSQA 3CU1A 1AQKH 4NPYA 1UKTA 5DJCB 3WIIH 2R8SH 3MLYH 4MA3B 4PYHA 3V5DA 2GHWB 2QQNL 1TVBB 1R3KB 2CLVB 5HGAA 2VN4A 2EIZA 3QEUB 1TTUA 2BC4B 4JPIB 1QD0A 1HH9A 3QUZD 1OY3B 3VFGL 4TOYL 1N64L 2IADB 4MZ3A 3GMPA 4JM4L 1WWAX 3FFCB 2XWTA 5J1AA 2J8UA 4Y0GA 3DOSA 4F9LC 2HJKA 1JPTL 1U91A 5D2NA 4ZUVA 4YXKH 3HNTH 1YNKL 1HH6B 4P2OA 4KJWC 1TVDA 3IFNH 3HB3D 5EC1A 4PR5B 2DMBA 4P5TB 1A22B 2R23A 3THML 1T7WA 5D2NC 5B38A 5TE6H 5DJ0B 5AEAA 3GBNL 1FFNA 5DGQA 5B39G 3RGHA 4BSWA 3DMMB 4OCYH 4WV1C 3GMOB 3BIAX 5CCKH 5DJ0A 1BFTA 5T3ZL 3ZO0A 4QHMB 2DWDB 4NOFA 4MJ2A 3KPRB 5DF0A 3P11L 2VH5H 1VEPA 4KI1A 1FORH 1KTRL 2Z31D 1R5VB 4QXGL 2OTWA 1CG9A 1A21A 3KPNA 3T3MF 5KVGL 1UYWL 3UPAA 1JWUB 2DQFB 4QRRE 5TF0A 3ESUF 4GLRI 1RJYA 2K7PA 1UB6A 5C0DB 4PJEE 3C60C 5EWIL 2X41A 5KSUB 4FFWD 2BVOA 3MRMB 4D3CH 1BEYH 5GIRA 5KVEL 3QDGE 3PWNB 5I1DB 4KTYA 5EBWB 3HR5B 1TJHH 5DD3L 2NYYC 5CUSL 5T5FH 3BE1L 3BKML 4TNWK 2AKRB 4NO3B 1KB5A 4MJ5A 5C09D 4JY5L 1GGIH 4JRWA 3T0DA 5HXMA 4X6EB 4RMRA 3SCMC 4OCSH 5E8NA 3QHZL 2DM3A 3ZT7A 5EN2B 3CFEB 4POZC 1EHXA 1MCWM 3FN9A 5TDPA 3QIBA 1AQDB 3LIZH 4MD4B 2HTKC 1A2YA 3SOBL 5GS2D 4NQDD 2O5ZL 3OG4B 4LEOB 8CGTA 1GPOL 3G6DH 3V8OA 1FYTD 5FK9B 1TQBB 1XGTB 1FDLH 4HUMB 3S37L 1CGXA 1U8JA 2W07A 1KJ2A 1H15B 2RBLA 4Y7MA 2DWEA 1U58A 3DETC 3ELAT 1QEWB 5TE4L 2P24A 2YA0A 2Z35A 3R8QA 1U3JA 5DUPH 4XWOC 2P8LA 3RJDA 3RVUD 1PG7W 4PJEB 5KSAA 5FUOL 1JPGB 3G5XA 2NR6D 2EYTB 3QAZB 3MLUL 4ONGH 2ESVD 2OP4H 5HHMD 4WWKC 5CEYA 2D31B 3UYRH 4JQXC 1AR2A 5F9JB 3FO0L 5IW1A 3EJZD 3W9DA 3O4LA 5FO9B 3IXAA 4HGWB 4LLQA 4NT6A 3MXVL 4I1NB 5DC0A 3L5JA 5AG9A 1JNJA 4U6HB 1MJ8L 4WW2A 5E2TL 1HQRB 1MCNA 4LFHD 1D9KB 5K9JL 5DMIH 5HYJE 3BAEH 3T2PA 3QA3B 1W8NA 1S7UA 5H2BA 3B9KB