2AKPA

Hsp90 delta24-n210 mutant
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
184
structure length
184
Chain Sequence
b'KEIFLRELISNASDALDKIRYKSLSDPKQLETEPDLFIRITPKPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGSFTVTLDEVNERIGRGTILRLFLKDDQLEYLEEKRIKEVIKRHSEFVAYPIQLVVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent molecular chaperone HSP82
publication title Intrinsic inhibition of the Hsp90 ATPase activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 56
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2akpA00
1YETA 1S14A 3HHUA 1TILA 2QG2A 4GEEA 2XCMA 2Q8FA 4URLA 4CWOA 2IOQA 3ZXQA 2BU2A 4ASFA 4WUCA 2XJGA 4XD8A 2BRCA 3GIFA 4CE2A 1I5CA 4MP2A 5BOCA 3G75A 3B28A 4HY6A 2YEGA 1THNA 2BT0A 3TZ5A 4ASBA 4XC0A 3T0ZA 2YEFA 4O0BA 3VHCA 2YE3A 5CTUA 2YKIA 4HXZA 1GJVA 4LWFA 3A0RA 1UYCA 4ASGA 5D7RA 1ZWHA 1AH6A 3OWDA 2PNRA 3GIGA 5CTWA 1TC0A 3U2DA 4JAUA 2YJWA 4LWHA 2Q8IA 3CGZA 1UYEA 4EGHA 2BREA 2BU8A 4L94A 4LWGA 4AS9A 4EFTA 3C0EA 3K99A 2WI3A 3FT5A 4MP7A 1I58A 3MNRP 3RLRA 4AWQA 3K60A 2QG0A 1BKNA 5F3KA 2XHXA 4MPCA 4R3MA 4KSHA 2GQPA 2XHTA 2YEAA 1B62A 1H7UA 4GQTA 3T2SA 4CWRA 4HY1A 2BSMA 4L91A 4XTJA 4E02A 1B3QA 3RLPA 1QY8A 4EGIA 3LPSA 4XIQA 1TC6A 4QPKA 5IDMA 2VCIA 4FPPA 2WI1A 4I5SA 4PRVA 1BGQA 4HZ5A 2YI0A 4JASA 4XITA 2EXLA 2FYPA 4L93A 1NHHA 4FCPA 3OPDA 4PRXA 2GFDA 3TUHA 4NH7A 1ZXMA 2IORA 3BM9A 5GGZA 5CTYA 1YT2A 4LP0A 4H7QA 3ZM7A 2O1UA 3B27A 2CG9A 2YKEA 2YEHA 2XDUA 3A0XA 2ZBKB 4KTNA 2YK9A 2H8MA 2BTZA 1Y8OA 4O07A 4ZKIA 2YI7A 3CWVA 4YKZA 4CWPA 4LWEA 1I5AA 2CCTA 4XCLA 4CWSA 4I3HA 2YE8A 4PL9A 3O0IA 2YKBA 3A0WA 1S16A 3FT8A 4XIRA 3FV5A 2CCUA 2IWUA 4L90A 2XD6A 5J6AA 3HZ1A 1YT1A 4O09A 1KZNA 3CGYA 4P8OA 1R62A 1Z5BA 2E0AA 2IWSA 4URMA 4PU9A 3R91A 3QDDA 5FNFA 3H80A 3INWA 3ZKDA 4XE2A 1U0ZA 4EM7A 1UYFA 4ASAA 1A4HA 4DZYA 2BZ5A 4V26A 2BU7A 4MB9A 2VW5A 1Z5AA 3LNUA 3EKRA 1YC3A 3GIEA 4BIZA 3TTZA 5IDJA 1UYLA 3B26A 5FNDA 2WEQA 2YE7A 5L3JA 4MBCA 3R4NA 4KFGA 2BU5A 1ID0A 2XX2A 4AWOA 3R4OA 3A0TA 5CPHA 3A0YA 2FWZA 4K4OA 3RLQA 1JM6A 4MPNA 2YE2A 3D2RA 3BMYA 1Y8PA 4YKTA 3WHAA 4CE3A 1UYMA 1OSFA 2ZKJA 1Y8NA 3ZKBA 3HZ5A 2WI7A 2IWXA 4U7NA 3EHGA 2YI6A 3R4PA 4HYPA 4AWPA 1TH8A 4EGKA 5CF0A 1I5DA 3K98A 3OWBA 3PEHA 1KIJA 2AKPA 2WI2A 2WEPA 5IN9A 3TZ4A 1I5BA 1Z59A 3G7BA 1TBWA 3OMUA 2O1VA 4GT8A 4XIPA 4CWFA 4EEHA 2FXSA 2XDKA 4BXIA 2UWDA 4XCJA 1GKXA 1AJ6A 1UY9A 2XX4A 1YSZA 4H85A 3HYZA 4FMTA 2XJJA 2Q8HA 4KP4A 1I59A 1UYIA 3O6OA 1EA6A 3D0BA 4BIUA 4KQVA 3R92A 4BAEA 4YKRA 4YKXA 2YGAA 2YE5A 3VHDA 2FWYA 5D7CA 4CWNA 3CRLA 4GGLA 2YEEA 4EMVA 4GFNA 4URNA 3O2FA 4W7TA 3TZ0A 3U67A 3B24A 1YC1A 4XKKA 4CWTA 2ZDXA 1UYGA 3QTFA 4FCRA 5BODA 4H81A 2YE4A 2YEBA 2CCSA 3Q5KA 5D6QA 2IOPA 1YC4A 4X9LA 2YE9A 2K5BA 4R3AA 1AM1A 1YT0A 4KSGA 2CGFA 2O1WA 2XABA 1NHIA 3GIGB 4QPJA 4YKQA 4E01A 1MU5A 4LPBA 3R4MA 2BU6A 3ZXOA 2H55A 4O05A 2HG1A 1UYHA 3A0ZA 1EI1A 4B7PA 5M4KA 3HYYA 1BXDA 2XK2A 3T10A 1UY6A 4JAVA 2XDSA 2YGEA 2YKJA 4YKUA 3EHFA 1Y4SA 1QZRA 2HKJA 3JZ3A 3PEJA 4O04A 1UY7A 3CRKA 2YECA 1Y4UA 2WI5A 4JQLA 4R1FA 3U2KA 4V25A 5CTXA 2JKIA 3OW6A 4ZVIA 4XDMA 3INXA 4E00A 1ZW9A 4YKWA 5F5RA 3EHHA 3IEDA 4U7OA 4FCQA 2JJCA 3KE6A 1B63A 5M4EA 4BQGA 2XHRA 1YSRA 2YGFA 4XKOA 1TIDA 1UYKA 5D7DA 5M4NA 3NMQA 5M4PA 1QYEA 3D36A 2WI4A 3WQ9A 4B6CA 2ESAA 2WERA 1AH8A 5C93A 1UY8A 2WI6A 4WUBA 1YESA 4MPEA 3VHAA 2QFOA 3TZ2A 1L0OA 4GCZA 1PVGA 4Q20A 4WUDA 2YI5A 4UROA 4HXWA 1YERA 4HZ0A 1AMWA 3B25A 3Q5LA 3T0HA 3Q5JA 3H4LA 4P7AA 3T1KA 3G7EA 4U93A 1GKZA 4XKAA 4MOTA 2XDLA 2BYHA 2YEJA 3HEKA 4CE1A 4CWQA 1U2OA 2XJXA 3C11A 4LWIA 1Z5CA 2BYIA 3SL2A 1H7SA 2VCJA 3EKOA 3K97A 1US7A 4NH8A 4YKYA 4DUHA 2XX5A 1YS3A 5D6PA 2YEIA 2Q8GA 5FWKA 4NH9A 1MX0A 2YE6A 3EHJA 2YKCA 1ZXNA 2VWCA 2YEDA 2CH4A 2HCHA 2QF6A 3DGEA 1UYDA 1NHJA 2C2AA 2XDXA 5J71A 5M4HA 1BYQA 5M4MA 2YJXA 4EFUA 4L8ZA 4BQJA 3VADA 3RKZA 4HYMA 2Q2EB 5FNCA 2ZDYA 2YK2A
chains in the Genus database with same CATH superfamily
1YETA 1S14A 3HHUA 1TILA 2QG2A 4GEEA 2XCMA 2Q8FA 4URLA 4CWOA 2IOQA 3ZXQA 2BU2A 4ASFA 4WUCA 2FTKA 2XJGA 4XD8A 2BRCA 3GIFA 4CE2A 1I5CA 4MP2A 5BOCA 3G75A 3B28A 4HY6A 2YEGA 1THNA 2BT0A 3TZ5A 4ASBA 4XC0A 3T0ZA 2YEFA 4O0BA 3VHCA 2YE3A 5CTUA 2YKIA 4HXZA 1GJVA 4LWFA 3A0RA 1UYCA 4ASGA 5D7RA 1ZWHA 1AH6A 3OWDA 2PNRA 3GIGA 5CTWA 1TC0A 3U2DA 4JAUA 2YJWA 4LWHA 2Q8IA 3CGZA 3LMMA 1UYEA 4EGHA 2BREA 2BU8A 4L94A 4LWGA 4AS9A 4EFTA 3C0EA 3K99A 2WI3A 3FT5A 4MP7A 1I58A 3MNRP 3RLRA 4AWQA 3K60A 2QG0A 1BKNA 5F3KA 2XHXA 4MPCA 4R3MA 4KSHA 2GQPA 2XHTA 2YEAA 1B62A 1H7UA 4GQTA 3T2SA 4CWRA 4HY1A 2BSMA 4L91A 4XTJA 4E02A 1B3QA 3RLPA 1QY8A 4EGIA 3LPSA 4XIQA 1TC6A 4QPKA 5IDMA 2VCIA 4FPPA 2WI1A 4I5SA 4PRVA 1BGQA 4HZ5A 2YI0A 4JASA 4XITA 2EXLA 2FYPA 4L93A 1NHHA 4FCPA 3OPDA 4PRXA 2GFDA 3TUHA 4NH7A 1ZXMA 2IORA 3BM9A 5GGZA 5CTYA 1YT2A 4LP0A 4H7QA 3ZM7A 2O1UA 3B27A 2CG9A 2YKEA 2YEHA 2XDUA 3A0XA 2ZBKB 4KTNA 2YK9A 2H8MA 2BTZA 1Y8OA 1IXMA 4O07A 4ZKIA 2YI7A 4E72A 3CWVA 4YKZA 4CWPA 4LWEA 1I5AA 2CCTA 4XCLA 4CWSA 4I3HA 2YE8A 4PL9A 3O0IA 2YKBA 3A0WA 1S16A 3FT8A 4XIRA 3FV5A 2CCUA 2IWUA 4L90A 2XD6A 5J6AA 3HZ1A 1YT1A 4O09A 1KZNA 3CGYA 4P8OA 1R62A 1Z5BA 2E0AA 2IWSA 4URMA 4PU9A 3R91A 3QDDA 5FNFA 3H80A 3INWA 3ZKDA 4XE2A 1U0ZA 4EM7A 1UYFA 4ASAA 1A4HA 4DZYA 2BZ5A 4V26A 2BU7A 4MB9A 2VW5A 1Z5AA 3LNUA 3EKRA 1YC3A 3GIEA 4BIZA 3TTZA 5IDJA 1UYLA 3B26A 5FNDA 2WEQA 2YE7A 5L3JA 3CYGA 4MBCA 3R4NA 4KFGA 2BU5A 1ID0A 2XX2A 4AWOA 3R4OA 3A0TA 5CPHA 3A0YA 2FWZA 4K4OA 3RLQA 1JM6A 4MPNA 2YE2A 3D2RA 3BMYA 1Y8PA 4YKTA 2HHIA 3WHAA 4CE3A 1UYMA 1OSFA 2ZKJA 1Y8NA 3ZKBA 3HZ5A 2WI7A 2IWXA 4U7NA 3EHGA 2YI6A 3R4PA 4HYPA 4AWPA 1TH8A 4EGKA 5CF0A 1I5DA 3K98A 3OWBA 3PEHA 1KIJA 2AKPA 2WI2A 2WEPA 5IN9A 3TZ4A 1I5BA 1Z59A 3G7BA 1TBWA 3OMUA 2O1VA 4GT8A 4XIPA 4CWFA 4EEHA 2FXSA 2XDKA 4BXIA 2UWDA 4XCJA 1GKXA 1AJ6A 1UY9A 2XX4A 5JENA 1YSZA 4H85A 3HYZA 4FMTA 2XJJA 2Q8HA 4KP4A 1I59A 1UYIA 3O6OA 3S5TA 1EA6A 3D0BA 4BIUA 4KQVA 3R92A 4BAEA 4YKRA 4YKXA 2YGAA 2YE5A 3VHDA 2FWYA 5D7CA 4CWNA 3CRLA 4GGLA 2YEEA 4EMVA 4GFNA 4URNA 3O2FA 4W7TA 3TZ0A 3U67A 3B24A 1YC1A 4XKKA 4CWTA 2ZDXA 1UYGA 3QTFA 4FCRA 5BODA 4H81A 2YE4A 2YEBA 2CCSA 3Q5KA 5D6QA 2IOPA 1YC4A 4X9LA 2YE9A 1F51A 2K5BA 4R3AA 1AM1A 1YT0A 4KSGA 2CGFA 2O1WA 2XABA 1NHIA 3GIGB 4QPJA 4YKQA 4E01A 1MU5A 4LPBA 3R4MA 2BU6A 3ZXOA 2H55A 4O05A 2HG1A 1UYHA 3A0ZA 1EI1A 4B7PA 5M4KA 3HYYA 1BXDA 2XK2A 3T10A 1UY6A 4JAVA 2XDSA 2YGEA 2YKJA 4YKUA 3EHFA 1Y4SA 1QZRA 2HKJA 3JZ3A 3PEJA 4O04A 1UY7A 3CRKA 2YECA 1Y4UA 2WI5A 4JQLA 4R1FA 3U2KA 4V25A 5CTXA 2JKIA 3OW6A 4ZVIA 4XDMA 3INXA 4E00A 1ZW9A 4YKWA 5F5RA 3EHHA 3IEDA 4U7OA 4FCQA 2JJCA 3KE6A 1B63A 5M4EA 4BQGA 2XHRA 1YSRA 2C1GA 2YGFA 4XKOA 1TIDA 1UYKA 5D7DA 5M4NA 3NMQA 5M4PA 1QYEA 3D36A 2WI4A 3WQ9A 4B6CA 2ESAA 2WERA 1AH8A 5C93A 1UY8A 2WI6A 4WUBA 1YESA 4MPEA 3VHAA 2QFOA 3TZ2A 1L0OA 4GCZA 1PVGA 4Q20A 2C1IA 4WUDA 2YI5A 4UROA 4HXWA 1YERA 4HZ0A 1AMWA 3B25A 3Q5LA 3T0HA 3Q5JA 3H4LA 4P7AA 3T1KA 3G7EA 4U93A 1GKZA 4XKAA 4MOTA 2XDLA 2BYHA 2YEJA 3HEKA 4CE1A 4CWQA 1U2OA 2XJXA 3C11A 4LWIA 1Z5CA 2BYIA 3SL2A 1H7SA 2VCJA 3EKOA 3K97A 1US7A 4NH8A 4YKYA 4DUHA 2XX5A 1YS3A 5D6PA 2YEIA 2Q8GA 5FWKA 4NH9A 1MX0A 2YE6A 3EHJA 2YKCA 1ZXNA 2VWCA 2YEDA 2CH4A 2HCHA 2QF6A 3DGEA 1UYDA 1NHJA 2C2AA 2XDXA 5J71A 5M4HA 1BYQA 5M4MA 2YJXA 4EFUA 4L8ZA 4BQJA 3VADA 3RKZA 4HYMA 2Q2EB 5FNCA 2ZDYA 2YK2A
chains in the Genus database with same CATH topology
1YETA 1S14A 3HHUA 1TILA 2QG2A 4GEEA 2XCMA 2Q8FA 4URLA 4CWOA 2IOQA 3ZXQA 2BU2A 4ASFA 4WUCA 2XJGA 4XD8A 2BRCA 3GIFA 4CE2A 1I5CA 4MP2A 5BOCA 3G75A 3B28A 4HY6A 2YEGA 1THNA 2BT0A 3TZ5A 4ASBA 4XC0A 3T0ZA 2YEFA 4O0BA 3VHCA 2YE3A 5CTUA 2YKIA 4HXZA 1GJVA 4LWFA 3A0RA 1UYCA 4ASGA 5D7RA 1ZWHA 1AH6A 3OWDA 2PNRA 3GIGA 5CTWA 1TC0A 3U2DA 4JAUA 2YJWA 4LWHA 2Q8IA 3CGZA 1UYEA 4EGHA 2BREA 2BU8A 4L94A 4LWGA 4AS9A 4EFTA 3C0EA 3K99A 2WI3A 3FT5A 4MP7A 1I58A 3MNRP 3RLRA 4AWQA 3K60A 2QG0A 1BKNA 5F3KA 2XHXA 4MPCA 4R3MA 4KSHA 2GQPA 2XHTA 2YEAA 1B62A 1H7UA 4GQTA 3T2SA 4CWRA 4HY1A 2BSMA 4L91A 4XTJA 4E02A 1B3QA 3RLPA 1QY8A 4EGIA 3LPSA 4XIQA 1TC6A 4QPKA 5IDMA 2VCIA 4FPPA 2WI1A 4I5SA 4PRVA 1BGQA 4HZ5A 2YI0A 4JASA 4XITA 2EXLA 2FYPA 4L93A 1NHHA 4FCPA 3OPDA 4PRXA 2GFDA 3TUHA 4NH7A 1ZXMA 2IORA 3BM9A 5GGZA 5CTYA 1YT2A 4LP0A 4H7QA 3ZM7A 2O1UA 3B27A 2CG9A 2YKEA 2YEHA 2XDUA 3A0XA 2ZBKB 4KTNA 2YK9A 2H8MA 2BTZA 1Y8OA 4O07A 4ZKIA 2YI7A 3CWVA 4YKZA 4CWPA 4LWEA 1I5AA 2CCTA 4XCLA 4CWSA 4I3HA 2YE8A 4PL9A 3O0IA 2YKBA 3A0WA 1S16A 3FT8A 4XIRA 3FV5A 2CCUA 2IWUA 4L90A 2XD6A 5J6AA 3HZ1A 1YT1A 4O09A 1KZNA 3CGYA 4P8OA 1R62A 1Z5BA 2E0AA 2IWSA 4URMA 4PU9A 3R91A 3QDDA 5FNFA 3H80A 3INWA 3ZKDA 4XE2A 1U0ZA 4EM7A 1UYFA 4ASAA 1A4HA 4DZYA 2BZ5A 4V26A 2BU7A 4MB9A 2VW5A 1Z5AA 3LNUA 3EKRA 1YC3A 3GIEA 4BIZA 3TTZA 5IDJA 1UYLA 3B26A 5FNDA 2WEQA 2YE7A 5L3JA 4MBCA 3R4NA 4KFGA 2BU5A 1ID0A 2XX2A 4AWOA 3R4OA 3A0TA 5CPHA 3A0YA 2FWZA 4K4OA 3RLQA 1JM6A 4MPNA 2YE2A 3D2RA 3BMYA 1Y8PA 4YKTA 3WHAA 4CE3A 1UYMA 1OSFA 2ZKJA 1Y8NA 3ZKBA 3HZ5A 2WI7A 2IWXA 4U7NA 3EHGA 2YI6A 3R4PA 4HYPA 4AWPA 1TH8A 4EGKA 5CF0A 1I5DA 3K98A 3OWBA 3PEHA 1KIJA 2AKPA 2WI2A 2WEPA 5IN9A 3TZ4A 1I5BA 1Z59A 3G7BA 1TBWA 3OMUA 2O1VA 4GT8A 4XIPA 4CWFA 4EEHA 2FXSA 2XDKA 4BXIA 2UWDA 4XCJA 1GKXA 1AJ6A 1UY9A 2XX4A 1YSZA 4H85A 3HYZA 4FMTA 2XJJA 2Q8HA 4KP4A 1I59A 1UYIA 3O6OA 1EA6A 3D0BA 4BIUA 4KQVA 3R92A 4BAEA 4YKRA 4YKXA 2YGAA 2YE5A 3VHDA 2FWYA 5D7CA 4CWNA 3CRLA 4GGLA 2YEEA 4EMVA 4GFNA 4URNA 3O2FA 4W7TA 3TZ0A 3U67A 3B24A 1YC1A 4XKKA 4CWTA 2ZDXA 1UYGA 3QTFA 4FCRA 5BODA 4H81A 2YE4A 2YEBA 2CCSA 3Q5KA 5D6QA 2IOPA 1YC4A 4X9LA 2YE9A 2K5BA 4R3AA 1AM1A 1YT0A 4KSGA 2CGFA 2O1WA 2XABA 1NHIA 3GIGB 4QPJA 4YKQA 4E01A 1MU5A 4LPBA 3R4MA 2BU6A 3ZXOA 2H55A 4O05A 2HG1A 1UYHA 3A0ZA 1EI1A 4B7PA 5M4KA 3HYYA 1BXDA 2XK2A 3T10A 1UY6A 4JAVA 2XDSA 2YGEA 2YKJA 4YKUA 3EHFA 1Y4SA 1QZRA 2HKJA 3JZ3A 3PEJA 4O04A 1UY7A 3CRKA 2YECA 1Y4UA 2WI5A 4JQLA 4R1FA 3U2KA 4V25A 5CTXA 2JKIA 3OW6A 4ZVIA 4XDMA 3INXA 4E00A 1ZW9A 4YKWA 5F5RA 3EHHA 3IEDA 4U7OA 4FCQA 2JJCA 3KE6A 1B63A 5M4EA 4BQGA 2XHRA 1YSRA 2YGFA 4XKOA 1TIDA 1UYKA 5D7DA 5M4NA 3NMQA 5M4PA 1QYEA 3D36A 2WI4A 3WQ9A 4B6CA 2ESAA 2WERA 1AH8A 5C93A 1UY8A 2WI6A 4WUBA 1YESA 4MPEA 3VHAA 2QFOA 3TZ2A 1L0OA 4GCZA 1PVGA 4Q20A 4WUDA 2YI5A 4UROA 4HXWA 1YERA 4HZ0A 1AMWA 3B25A 3Q5LA 3T0HA 3Q5JA 3H4LA 4P7AA 3T1KA 3G7EA 4U93A 1GKZA 4XKAA 4MOTA 2XDLA 2BYHA 2YEJA 3HEKA 4CE1A 4CWQA 1U2OA 2XJXA 3C11A 4LWIA 1Z5CA 2BYIA 3SL2A 1H7SA 2VCJA 3EKOA 3K97A 1US7A 4NH8A 4YKYA 4DUHA 2XX5A 1YS3A 5D6PA 2YEIA 2Q8GA 5FWKA 4NH9A 1MX0A 2YE6A 3EHJA 2YKCA 1ZXNA 2VWCA 2YEDA 2CH4A 2HCHA 2QF6A 3DGEA 1UYDA 1NHJA 2C2AA 2XDXA 5J71A 5M4HA 1BYQA 5M4MA 2YJXA 4EFUA 4L8ZA 4BQJA 3VADA 3RKZA 4HYMA 2Q2EB 5FNCA 2ZDYA 2YK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YET A;  1S14 A;  3HHU A;  1TIL A;  2QG2 A;  4GEE A;  2XCM A;  2Q8F A;  4URL A;  4CWO A;  2IOQ A;  3ZXQ A;  2BU2 A;  4ASF A;  4WUC A;  2XJG A;  4XD8 A;  2BRC A;  3GIF A;  4CE2 A;  1I5C A;  4MP2 A;  5BOC A;  3G75 A;  3B28 A;  4HY6 A;  2YEG A;  1THN A;  2BT0 A;  3TZ5 A;  4ASB A;  4XC0 A;  3T0Z A;  2YEF A;  4O0B A;  3VHC A;  2YE3 A;  5CTU A;  2YKI A;  4HXZ A;  1GJV A;  4LWF A;  3A0R A;  1UYC A;  4ASG A;  5D7R A;  1ZWH A;  1AH6 A;  3OWD A;  2PNR A;  3GIG A;  5CTW A;  1TC0 A;  3U2D A;  4JAU A;  2YJW A;  4LWH A;  2Q8I A;  3CGZ A;  1UYE A;  4EGH A;  2BRE A;  2BU8 A;  4L94 A;  4LWG A;  4AS9 A;  4EFT A;  3C0E A;  3K99 A;  2WI3 A;  3FT5 A;  4MP7 A;  1I58 A;  3MNR P;  3RLR A;  4AWQ A;  3K60 A;  2QG0 A;  1BKN A;  5F3K A;  2XHX A;  4MPC A;  4R3M A;  4KSH A;  2GQP A;  2XHT A;  2YEA A;  1B62 A;  1H7U A;  4GQT A;  3T2S A;  4CWR A;  4HY1 A;  2BSM A;  4L91 A;  4XTJ A;  4E02 A;  1B3Q A;  3RLP A;  1QY8 A;  4EGI A;  3LPS A;  4XIQ A;  1TC6 A;  4QPK A;  5IDM A;  2VCI A;  4FPP A;  2WI1 A;  4I5S A;  4PRV A;  1BGQ A;  4HZ5 A;  2YI0 A;  4JAS A;  4XIT A;  2EXL A;  2FYP A;  4L93 A;  1NHH A;  4FCP A;  3OPD A;  4PRX A;  2GFD A;  3TUH A;  4NH7 A;  1ZXM A;  2IOR A;  3BM9 A;  5GGZ A;  5CTY A;  1YT2 A;  4LP0 A;  4H7Q A;  3ZM7 A;  2O1U A;  3B27 A;  2CG9 A;  2YKE A;  2YEH A;  2XDU A;  3A0X A;  2ZBK B;  4KTN A;  2YK9 A;  2H8M A;  2BTZ A;  1Y8O A;  4O07 A;  4ZKI A;  2YI7 A;  3CWV A;  4YKZ A;  4CWP A;  4LWE A;  1I5A A;  2CCT A;  4XCL A;  4CWS A;  4I3H A;  2YE8 A;  4PL9 A;  3O0I A;  2YKB A;  3A0W A;  1S16 A;  3FT8 A;  4XIR A;  3FV5 A;  2CCU A;  2IWU A;  4L90 A;  2XD6 A;  5J6A A;  3HZ1 A;  1YT1 A;  4O09 A;  1KZN A;  3CGY A;  4P8O A;  1R62 A;  1Z5B A;  2E0A A;  2IWS A;  4URM A;  4PU9 A;  3R91 A;  3QDD A;  5FNF A;  3H80 A;  3INW A;  3ZKD A;  4XE2 A;  1U0Z A;  4EM7 A;  1UYF A;  4ASA A;  1A4H A;  4DZY A;  2BZ5 A;  4V26 A;  2BU7 A;  4MB9 A;  2VW5 A;  1Z5A A;  3LNU A;  3EKR A;  1YC3 A;  3GIE A;  4BIZ A;  3TTZ A;  5IDJ A;  1UYL A;  3B26 A;  5FND A;  2WEQ A;  2YE7 A;  5L3J A;  4MBC A;  3R4N A;  4KFG A;  2BU5 A;  1ID0 A;  2XX2 A;  4AWO A;  3R4O A;  3A0T A;  5CPH A;  3A0Y A;  2FWZ A;  4K4O A;  3RLQ A;  1JM6 A;  4MPN A;  2YE2 A;  3D2R A;  3BMY A;  1Y8P A;  4YKT A;  3WHA A;  4CE3 A;  1UYM A;  1OSF A;  2ZKJ A;  1Y8N A;  3ZKB A;  3HZ5 A;  2WI7 A;  2IWX A;  4U7N A;  3EHG A;  2YI6 A;  3R4P A;  4HYP A;  4AWP A;  1TH8 A;  4EGK A;  5CF0 A;  1I5D A;  3K98 A;  3OWB A;  3PEH A;  1KIJ A;  2AKP A;  2WI2 A;  2WEP A;  5IN9 A;  3TZ4 A;  1I5B A;  1Z59 A;  3G7B A;  1TBW A;  3OMU A;  2O1V A;  4GT8 A;  4XIP A;  4CWF A;  4EEH A;  2FXS A;  2XDK A;  4BXI A;  2UWD A;  4XCJ A;  1GKX A;  1AJ6 A;  1UY9 A;  2XX4 A;  1YSZ A;  4H85 A;  3HYZ A;  4FMT A;  2XJJ A;  2Q8H A;  4KP4 A;  1I59 A;  1UYI A;  3O6O A;  1EA6 A;  3D0B A;  4BIU A;  4KQV A;  3R92 A;  4BAE A;  4YKR A;  4YKX A;  2YGA A;  2YE5 A;  3VHD A;  2FWY A;  5D7C A;  4CWN A;  3CRL A;  4GGL A;  2YEE A;  4EMV A;  4GFN A;  4URN A;  3O2F A;  4W7T A;  3TZ0 A;  3U67 A;  3B24 A;  1YC1 A;  4XKK A;  4CWT A;  2ZDX A;  1UYG A;  3QTF A;  4FCR A;  5BOD A;  4H81 A;  2YE4 A;  2YEB A;  2CCS A;  3Q5K A;  5D6Q A;  2IOP A;  1YC4 A;  4X9L A;  2YE9 A;  2K5B A;  4R3A A;  1AM1 A;  1YT0 A;  4KSG A;  2CGF A;  2O1W A;  2XAB A;  1NHI A;  3GIG B;  4QPJ A;  4YKQ A;  4E01 A;  1MU5 A;  4LPB A;  3R4M A;  2BU6 A;  3ZXO A;  2H55 A;  4O05 A;  2HG1 A;  1UYH A;  3A0Z A;  1EI1 A;  4B7P A;  5M4K A;  3HYY A;  1BXD A;  2XK2 A;  3T10 A;  1UY6 A;  4JAV A;  2XDS A;  2YGE A;  2YKJ A;  4YKU A;  3EHF A;  1Y4S A;  1QZR A;  2HKJ A;  3JZ3 A;  3PEJ A;  4O04 A;  1UY7 A;  3CRK A;  2YEC A;  1Y4U A;  2WI5 A;  4JQL A;  4R1F A;  3U2K A;  4V25 A;  5CTX A;  2JKI A;  3OW6 A;  4ZVI A;  4XDM A;  3INX A;  4E00 A;  1ZW9 A;  4YKW A;  5F5R A;  3EHH A;  3IED A;  4U7O A;  4FCQ A;  2JJC A;  3KE6 A;  1B63 A;  5M4E A;  4BQG A;  2XHR A;  1YSR A;  2YGF A;  4XKO A;  1TID A;  1UYK A;  5D7D A;  5M4N A;  3NMQ A;  5M4P A;  1QYE A;  3D36 A;  2WI4 A;  3WQ9 A;  4B6C A;  2ESA A;  2WER A;  1AH8 A;  5C93 A;  1UY8 A;  2WI6 A;  4WUB A;  1YES A;  4MPE A;  3VHA A;  2QFO A;  3TZ2 A;  1L0O A;  4GCZ A;  1PVG A;  4Q20 A;  4WUD A;  2YI5 A;  4URO A;  4HXW A;  1YER A;  4HZ0 A;  1AMW A;  3B25 A;  3Q5L A;  3T0H A;  3Q5J A;  3H4L A;  4P7A A;  3T1K A;  3G7E A;  4U93 A;  1GKZ A;  4XKA A;  4MOT A;  2XDL A;  2BYH A;  2YEJ A;  3HEK A;  4CE1 A;  4CWQ A;  1U2O A;  2XJX A;  3C11 A;  4LWI A;  1Z5C A;  2BYI A;  3SL2 A;  1H7S A;  2VCJ A;  3EKO A;  3K97 A;  1US7 A;  4NH8 A;  4YKY A;  4DUH A;  2XX5 A;  1YS3 A;  5D6P A;  2YEI A;  2Q8G A;  5FWK A;  4NH9 A;  1MX0 A;  2YE6 A;  3EHJ A;  2YKC A;  1ZXN A;  2VWC A;  2YED A;  2CH4 A;  2HCH A;  2QF6 A;  3DGE A;  1UYD A;  1NHJ A;  2C2A A;  2XDX A;  5J71 A;  5M4H A;  1BYQ A;  5M4M A;  2YJX A;  4EFU A;  4L8Z A;  4BQJ A;  3VAD A;  3RKZ A;  4HYM A;  2Q2E B;  5FNC A;  2ZDY A;  2YK2 A; 
#chains in the Genus database with same CATH topology
 1YET A;  1S14 A;  3HHU A;  1TIL A;  2QG2 A;  4GEE A;  2XCM A;  2Q8F A;  4URL A;  4CWO A;  2IOQ A;  3ZXQ A;  2BU2 A;  4ASF A;  4WUC A;  2FTK A;  2XJG A;  4XD8 A;  2BRC A;  3GIF A;  4CE2 A;  1I5C A;  4MP2 A;  5BOC A;  3G75 A;  3B28 A;  4HY6 A;  2YEG A;  1THN A;  2BT0 A;  3TZ5 A;  4ASB A;  4XC0 A;  3T0Z A;  2YEF A;  4O0B A;  3VHC A;  2YE3 A;  5CTU A;  2YKI A;  4HXZ A;  1GJV A;  4LWF A;  3A0R A;  1UYC A;  4ASG A;  5D7R A;  1ZWH A;  1AH6 A;  3OWD A;  2PNR A;  3GIG A;  5CTW A;  1TC0 A;  3U2D A;  4JAU A;  2YJW A;  4LWH A;  2Q8I A;  3CGZ A;  3LMM A;  1UYE A;  4EGH A;  2BRE A;  2BU8 A;  4L94 A;  4LWG A;  4AS9 A;  4EFT A;  3C0E A;  3K99 A;  2WI3 A;  3FT5 A;  4MP7 A;  1I58 A;  3MNR P;  3RLR A;  4AWQ A;  3K60 A;  2QG0 A;  1BKN A;  5F3K A;  2XHX A;  4MPC A;  4R3M A;  4KSH A;  2GQP A;  2XHT A;  2YEA A;  1B62 A;  1H7U A;  4GQT A;  3T2S A;  4CWR A;  4HY1 A;  2BSM A;  4L91 A;  4XTJ A;  4E02 A;  1B3Q A;  3RLP A;  1QY8 A;  4EGI A;  3LPS A;  4XIQ A;  1TC6 A;  4QPK A;  5IDM A;  2VCI A;  4FPP A;  2WI1 A;  4I5S A;  4PRV A;  1BGQ A;  4HZ5 A;  2YI0 A;  4JAS A;  4XIT A;  2EXL A;  2FYP A;  4L93 A;  1NHH A;  4FCP A;  3OPD A;  4PRX A;  2GFD A;  3TUH A;  4NH7 A;  1ZXM A;  2IOR A;  3BM9 A;  5GGZ A;  5CTY A;  1YT2 A;  4LP0 A;  4H7Q A;  3ZM7 A;  2O1U A;  3B27 A;  2CG9 A;  2YKE A;  2YEH A;  2XDU A;  3A0X A;  2ZBK B;  4KTN A;  2YK9 A;  2H8M A;  2BTZ A;  1Y8O A;  1IXM A;  4O07 A;  4ZKI A;  2YI7 A;  4E72 A;  3CWV A;  4YKZ A;  4CWP A;  4LWE A;  1I5A A;  2CCT A;  4XCL A;  4CWS A;  4I3H A;  2YE8 A;  4PL9 A;  3O0I A;  2YKB A;  3A0W A;  1S16 A;  3FT8 A;  4XIR A;  3FV5 A;  2CCU A;  2IWU A;  4L90 A;  2XD6 A;  5J6A A;  3HZ1 A;  1YT1 A;  4O09 A;  1KZN A;  3CGY A;  4P8O A;  1R62 A;  1Z5B A;  2E0A A;  2IWS A;  4URM A;  4PU9 A;  3R91 A;  3QDD A;  5FNF A;  3H80 A;  3INW A;  3ZKD A;  4XE2 A;  1U0Z A;  4EM7 A;  1UYF A;  4ASA A;  1A4H A;  4DZY A;  2BZ5 A;  4V26 A;  2BU7 A;  4MB9 A;  2VW5 A;  1Z5A A;  3LNU A;  3EKR A;  1YC3 A;  3GIE A;  4BIZ A;  3TTZ A;  5IDJ A;  1UYL A;  3B26 A;  5FND A;  2WEQ A;  2YE7 A;  5L3J A;  3CYG A;  4MBC A;  3R4N A;  4KFG A;  2BU5 A;  1ID0 A;  2XX2 A;  4AWO A;  3R4O A;  3A0T A;  5CPH A;  3A0Y A;  2FWZ A;  4K4O A;  3RLQ A;  1JM6 A;  4MPN A;  2YE2 A;  3D2R A;  3BMY A;  1Y8P A;  4YKT A;  2HHI A;  3WHA A;  4CE3 A;  1UYM A;  1OSF A;  2ZKJ A;  1Y8N A;  3ZKB A;  3HZ5 A;  2WI7 A;  2IWX A;  4U7N A;  3EHG A;  2YI6 A;  3R4P A;  4HYP A;  4AWP A;  1TH8 A;  4EGK A;  5CF0 A;  1I5D A;  3K98 A;  3OWB A;  3PEH A;  1KIJ A;  2AKP A;  2WI2 A;  2WEP A;  5IN9 A;  3TZ4 A;  1I5B A;  1Z59 A;  3G7B A;  1TBW A;  3OMU A;  2O1V A;  4GT8 A;  4XIP A;  4CWF A;  4EEH A;  2FXS A;  2XDK A;  4BXI A;  2UWD A;  4XCJ A;  1GKX A;  1AJ6 A;  1UY9 A;  2XX4 A;  5JEN A;  1YSZ A;  4H85 A;  3HYZ A;  4FMT A;  2XJJ A;  2Q8H A;  4KP4 A;  1I59 A;  1UYI A;  3O6O A;  3S5T A;  1EA6 A;  3D0B A;  4BIU A;  4KQV A;  3R92 A;  4BAE A;  4YKR A;  4YKX A;  2YGA A;  2YE5 A;  3VHD A;  2FWY A;  5D7C A;  4CWN A;  3CRL A;  4GGL A;  2YEE A;  4EMV A;  4GFN A;  4URN A;  3O2F A;  4W7T A;  3TZ0 A;  3U67 A;  3B24 A;  1YC1 A;  4XKK A;  4CWT A;  2ZDX A;  1UYG A;  3QTF A;  4FCR A;  5BOD A;  4H81 A;  2YE4 A;  2YEB A;  2CCS A;  3Q5K A;  5D6Q A;  2IOP A;  1YC4 A;  4X9L A;  2YE9 A;  1F51 A;  2K5B A;  4R3A A;  1AM1 A;  1YT0 A;  4KSG A;  2CGF A;  2O1W A;  2XAB A;  1NHI A;  3GIG B;  4QPJ A;  4YKQ A;  4E01 A;  1MU5 A;  4LPB A;  3R4M A;  2BU6 A;  3ZXO A;  2H55 A;  4O05 A;  2HG1 A;  1UYH A;  3A0Z A;  1EI1 A;  4B7P A;  5M4K A;  3HYY A;  1BXD A;  2XK2 A;  3T10 A;  1UY6 A;  4JAV A;  2XDS A;  2YGE A;  2YKJ A;  4YKU A;  3EHF A;  1Y4S A;  1QZR A;  2HKJ A;  3JZ3 A;  3PEJ A;  4O04 A;  1UY7 A;  3CRK A;  2YEC A;  1Y4U A;  2WI5 A;  4JQL A;  4R1F A;  3U2K A;  4V25 A;  5CTX A;  2JKI A;  3OW6 A;  4ZVI A;  4XDM A;  3INX A;  4E00 A;  1ZW9 A;  4YKW A;  5F5R A;  3EHH A;  3IED A;  4U7O A;  4FCQ A;  2JJC A;  3KE6 A;  1B63 A;  5M4E A;  4BQG A;  2XHR A;  1YSR A;  2C1G A;  2YGF A;  4XKO A;  1TID A;  1UYK A;  5D7D A;  5M4N A;  3NMQ A;  5M4P A;  1QYE A;  3D36 A;  2WI4 A;  3WQ9 A;  4B6C A;  2ESA A;  2WER A;  1AH8 A;  5C93 A;  1UY8 A;  2WI6 A;  4WUB A;  1YES A;  4MPE A;  3VHA A;  2QFO A;  3TZ2 A;  1L0O A;  4GCZ A;  1PVG A;  4Q20 A;  2C1I A;  4WUD A;  2YI5 A;  4URO A;  4HXW A;  1YER A;  4HZ0 A;  1AMW A;  3B25 A;  3Q5L A;  3T0H A;  3Q5J A;  3H4L A;  4P7A A;  3T1K A;  3G7E A;  4U93 A;  1GKZ A;  4XKA A;  4MOT A;  2XDL A;  2BYH A;  2YEJ A;  3HEK A;  4CE1 A;  4CWQ A;  1U2O A;  2XJX A;  3C11 A;  4LWI A;  1Z5C A;  2BYI A;  3SL2 A;  1H7S A;  2VCJ A;  3EKO A;  3K97 A;  1US7 A;  4NH8 A;  4YKY A;  4DUH A;  2XX5 A;  1YS3 A;  5D6P A;  2YEI A;  2Q8G A;  5FWK A;  4NH9 A;  1MX0 A;  2YE6 A;  3EHJ A;  2YKC A;  1ZXN A;  2VWC A;  2YED A;  2CH4 A;  2HCH A;  2QF6 A;  3DGE A;  1UYD A;  1NHJ A;  2C2A A;  2XDX A;  5J71 A;  5M4H A;  1BYQ A;  5M4M A;  2YJX A;  4EFU A;  4L8Z A;  4BQJ A;  3VAD A;  3RKZ A;  4HYM A;  2Q2E B;  5FNC A;  2ZDY A;  2YK2 A; 
#chains in the Genus database with same CATH homology
 1YET A;  1S14 A;  3HHU A;  1TIL A;  2QG2 A;  4GEE A;  2XCM A;  2Q8F A;  4URL A;  4CWO A;  2IOQ A;  3ZXQ A;  2BU2 A;  4ASF A;  4WUC A;  2XJG A;  4XD8 A;  2BRC A;  3GIF A;  4CE2 A;  1I5C A;  4MP2 A;  5BOC A;  3G75 A;  3B28 A;  4HY6 A;  2YEG A;  1THN A;  2BT0 A;  3TZ5 A;  4ASB A;  4XC0 A;  3T0Z A;  2YEF A;  4O0B A;  3VHC A;  2YE3 A;  5CTU A;  2YKI A;  4HXZ A;  1GJV A;  4LWF A;  3A0R A;  1UYC A;  4ASG A;  5D7R A;  1ZWH A;  1AH6 A;  3OWD A;  2PNR A;  3GIG A;  5CTW A;  1TC0 A;  3U2D A;  4JAU A;  2YJW A;  4LWH A;  2Q8I A;  3CGZ A;  1UYE A;  4EGH A;  2BRE A;  2BU8 A;  4L94 A;  4LWG A;  4AS9 A;  4EFT A;  3C0E A;  3K99 A;  2WI3 A;  3FT5 A;  4MP7 A;  1I58 A;  3MNR P;  3RLR A;  4AWQ A;  3K60 A;  2QG0 A;  1BKN A;  5F3K A;  2XHX A;  4MPC A;  4R3M A;  4KSH A;  2GQP A;  2XHT A;  2YEA A;  1B62 A;  1H7U A;  4GQT A;  3T2S A;  4CWR A;  4HY1 A;  2BSM A;  4L91 A;  4XTJ A;  4E02 A;  1B3Q A;  3RLP A;  1QY8 A;  4EGI A;  3LPS A;  4XIQ A;  1TC6 A;  4QPK A;  5IDM A;  2VCI A;  4FPP A;  2WI1 A;  4I5S A;  4PRV A;  1BGQ A;  4HZ5 A;  2YI0 A;  4JAS A;  4XIT A;  2EXL A;  2FYP A;  4L93 A;  1NHH A;  4FCP A;  3OPD A;  4PRX A;  2GFD A;  3TUH A;  4NH7 A;  1ZXM A;  2IOR A;  3BM9 A;  5GGZ A;  5CTY A;  1YT2 A;  4LP0 A;  4H7Q A;  3ZM7 A;  2O1U A;  3B27 A;  2CG9 A;  2YKE A;  2YEH A;  2XDU A;  3A0X A;  2ZBK B;  4KTN A;  2YK9 A;  2H8M A;  2BTZ A;  1Y8O A;  4O07 A;  4ZKI A;  2YI7 A;  3CWV A;  4YKZ A;  4CWP A;  4LWE A;  1I5A A;  2CCT A;  4XCL A;  4CWS A;  4I3H A;  2YE8 A;  4PL9 A;  3O0I A;  2YKB A;  3A0W A;  1S16 A;  3FT8 A;  4XIR A;  3FV5 A;  2CCU A;  2IWU A;  4L90 A;  2XD6 A;  5J6A A;  3HZ1 A;  1YT1 A;  4O09 A;  1KZN A;  3CGY A;  4P8O A;  1R62 A;  1Z5B A;  2E0A A;  2IWS A;  4URM A;  4PU9 A;  3R91 A;  3QDD A;  5FNF A;  3H80 A;  3INW A;  3ZKD A;  4XE2 A;  1U0Z A;  4EM7 A;  1UYF A;  4ASA A;  1A4H A;  4DZY A;  2BZ5 A;  4V26 A;  2BU7 A;  4MB9 A;  2VW5 A;  1Z5A A;  3LNU A;  3EKR A;  1YC3 A;  3GIE A;  4BIZ A;  3TTZ A;  5IDJ A;  1UYL A;  3B26 A;  5FND A;  2WEQ A;  2YE7 A;  5L3J A;  4MBC A;  3R4N A;  4KFG A;  2BU5 A;  1ID0 A;  2XX2 A;  4AWO A;  3R4O A;  3A0T A;  5CPH A;  3A0Y A;  2FWZ A;  4K4O A;  3RLQ A;  1JM6 A;  4MPN A;  2YE2 A;  3D2R A;  3BMY A;  1Y8P A;  4YKT A;  3WHA A;  4CE3 A;  1UYM A;  1OSF A;  2ZKJ A;  1Y8N A;  3ZKB A;  3HZ5 A;  2WI7 A;  2IWX A;  4U7N A;  3EHG A;  2YI6 A;  3R4P A;  4HYP A;  4AWP A;  1TH8 A;  4EGK A;  5CF0 A;  1I5D A;  3K98 A;  3OWB A;  3PEH A;  1KIJ A;  2AKP A;  2WI2 A;  2WEP A;  5IN9 A;  3TZ4 A;  1I5B A;  1Z59 A;  3G7B A;  1TBW A;  3OMU A;  2O1V A;  4GT8 A;  4XIP A;  4CWF A;  4EEH A;  2FXS A;  2XDK A;  4BXI A;  2UWD A;  4XCJ A;  1GKX A;  1AJ6 A;  1UY9 A;  2XX4 A;  1YSZ A;  4H85 A;  3HYZ A;  4FMT A;  2XJJ A;  2Q8H A;  4KP4 A;  1I59 A;  1UYI A;  3O6O A;  1EA6 A;  3D0B A;  4BIU A;  4KQV A;  3R92 A;  4BAE A;  4YKR A;  4YKX A;  2YGA A;  2YE5 A;  3VHD A;  2FWY A;  5D7C A;  4CWN A;  3CRL A;  4GGL A;  2YEE A;  4EMV A;  4GFN A;  4URN A;  3O2F A;  4W7T A;  3TZ0 A;  3U67 A;  3B24 A;  1YC1 A;  4XKK A;  4CWT A;  2ZDX A;  1UYG A;  3QTF A;  4FCR A;  5BOD A;  4H81 A;  2YE4 A;  2YEB A;  2CCS A;  3Q5K A;  5D6Q A;  2IOP A;  1YC4 A;  4X9L A;  2YE9 A;  2K5B A;  4R3A A;  1AM1 A;  1YT0 A;  4KSG A;  2CGF A;  2O1W A;  2XAB A;  1NHI A;  3GIG B;  4QPJ A;  4YKQ A;  4E01 A;  1MU5 A;  4LPB A;  3R4M A;  2BU6 A;  3ZXO A;  2H55 A;  4O05 A;  2HG1 A;  1UYH A;  3A0Z A;  1EI1 A;  4B7P A;  5M4K A;  3HYY A;  1BXD A;  2XK2 A;  3T10 A;  1UY6 A;  4JAV A;  2XDS A;  2YGE A;  2YKJ A;  4YKU A;  3EHF A;  1Y4S A;  1QZR A;  2HKJ A;  3JZ3 A;  3PEJ A;  4O04 A;  1UY7 A;  3CRK A;  2YEC A;  1Y4U A;  2WI5 A;  4JQL A;  4R1F A;  3U2K A;  4V25 A;  5CTX A;  2JKI A;  3OW6 A;  4ZVI A;  4XDM A;  3INX A;  4E00 A;  1ZW9 A;  4YKW A;  5F5R A;  3EHH A;  3IED A;  4U7O A;  4FCQ A;  2JJC A;  3KE6 A;  1B63 A;  5M4E A;  4BQG A;  2XHR A;  1YSR A;  2YGF A;  4XKO A;  1TID A;  1UYK A;  5D7D A;  5M4N A;  3NMQ A;  5M4P A;  1QYE A;  3D36 A;  2WI4 A;  3WQ9 A;  4B6C A;  2ESA A;  2WER A;  1AH8 A;  5C93 A;  1UY8 A;  2WI6 A;  4WUB A;  1YES A;  4MPE A;  3VHA A;  2QFO A;  3TZ2 A;  1L0O A;  4GCZ A;  1PVG A;  4Q20 A;  4WUD A;  2YI5 A;  4URO A;  4HXW A;  1YER A;  4HZ0 A;  1AMW A;  3B25 A;  3Q5L A;  3T0H A;  3Q5J A;  3H4L A;  4P7A A;  3T1K A;  3G7E A;  4U93 A;  1GKZ A;  4XKA A;  4MOT A;  2XDL A;  2BYH A;  2YEJ A;  3HEK A;  4CE1 A;  4CWQ A;  1U2O A;  2XJX A;  3C11 A;  4LWI A;  1Z5C A;  2BYI A;  3SL2 A;  1H7S A;  2VCJ A;  3EKO A;  3K97 A;  1US7 A;  4NH8 A;  4YKY A;  4DUH A;  2XX5 A;  1YS3 A;  5D6P A;  2YEI A;  2Q8G A;  5FWK A;  4NH9 A;  1MX0 A;  2YE6 A;  3EHJ A;  2YKC A;  1ZXN A;  2VWC A;  2YED A;  2CH4 A;  2HCH A;  2QF6 A;  3DGE A;  1UYD A;  1NHJ A;  2C2A A;  2XDX A;  5J71 A;  5M4H A;  1BYQ A;  5M4M A;  2YJX A;  4EFU A;  4L8Z A;  4BQJ A;  3VAD A;  3RKZ A;  4HYM A;  2Q2E B;  5FNC A;  2ZDY A;  2YK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...