2AKPA

Hsp90 delta24-n210 mutant
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
184
structure length
184
Chain Sequence
KEIFLRELISNASDALDKIRYKSLSDPKQLETEPDLFIRITPKPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGSFTVTLDEVNERIGRGTILRLFLKDDQLEYLEEKRIKEVIKRHSEFVAYPIQLVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intrinsic inhibition of the Hsp90 ATPase activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords ATP-dependent molecular chaperone HSP82
total genus 56
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2akpA00
2O1VA 1UY9A 4XE2A 3K99A 2XJJA 1AJ6A 3NMQA 4UROA 4EFUA 3ZXOA 3G7BA 3A0YA 2YKIA 1TILA 2BU5A 5GGZA 1BXDA 1UYEA 4BXIA 2BYHA 2HG1A 5FNFA 1KIJA 1YT2A 3FV5A 1KZNA 1UY7A 2YE9A 3R91A 4KSHA 2WEPA 2IWXA 2VCJA 1UYDA 2XDKA 2YE3A 3HZ5A 1Y8PA 2ZBKB 3O6OA 4EMVA 4XD8A 3A0TA 4CWOA 2CH4A 2YI7A 2CCSA 2YE7A 3LPSA 4JQLA 3DGEA 3U2DA 4WUBA 2QF6A 4O07A 4CE3A 5M4MA 4YKQA 4B6CA 3VHCA 4R3AA 2Q8FA 5M4NA 2YEGA 4O0BA 4V26A 1AM1A 1TC0A 2BU6A 2YKEA 1Z5BA 4FCQA 1YERA 4XCLA 4CWTA 3ZKDA 4K4OA 2XK2A 2YKBA 5M4EA 2UWDA 4W7TA 2XABA 5CPHA 1EA6A 3R92A 2ZKJA 2YEAA 1QY8A 2YE6A 3CRKA 3RLPA 1EI1A 1UYMA 2YEIA 1I5CA 4PRVA 4L90A 2O1WA 4DUHA 4JASA 2BSMA 1I5BA 1BGQA 3TUHA 5M4HA 1BYQA 2ESAA 3T0ZA 3CWVA 4HY1A 1GJVA 4EGIA 2QFOA 2XX5A 2WI2A 4E02A 1MX0A 4AWOA 5J6AA 4KQVA 4HZ5A 2O1UA 4I3HA 1TH8A 4CWFA 3LNUA 3QTFA 2IWSA 2YKJA 3WQ9A 4KSGA 4HXZA 5IDJA 1AMWA 4MBCA 3PEHA 2VWCA 4MPCA 2IWUA 1R62A 4P8OA 3B27A 3HHUA 4CWNA 3K98A 4U7OA 1UYFA 4XC0A 4AWQA 3OPDA 1GKXA 3B25A 3TTZA 5CTWA 2XX2A 5D7RA 4HXWA 3VHAA 5BODA 3A0XA 1TBWA 5D7CA 5IN9A 2YJXA 3HYZA 2XHTA 1US7A 2YE5A 4MP7A 4YKTA 3FT5A 1B3QA 2H8MA 4U7NA 4BIUA 4LP0A 2FWYA 5D6PA 2WI1A 4PRXA 4GT8A 4LPBA 1I5AA 1YT1A 1UYIA 5L3JA 3OWBA 1Z59A 4NH8A 2WI5A 3A0WA 4XCJA 1AH6A 3B24A 4ASBA 4O04A 4XIQA 1L0OA 3Q5KA 4YKXA 1MU5A 3EKOA 4GFNA 5C93A 4L93A 3R4OA 2XDUA 3CGYA 4L94A 1QYEA 2WI4A 2ZDYA 4CE2A 1NHIA 3OWDA 4Q20A 3PEJA 4MPNA 3H4LA 1YC4A 3D0BA 5FWKA 1I5DA 5D6QA 3RLRA 4CWQA 1YSRA 1UYGA 4KFGA 3TZ2A 5M4KA 1UYLA 3K97A 1Y4SA 3INXA 4ASGA 4QPKA 2EXLA 2YEDA 2PNRA 2HKJA 3EHFA 2XD6A 2VW5A 1TIDA 1Z5CA 3HYYA 3ZM7A 3T0HA 1ZWHA 4GQTA 4URMA 1UY8A 1YC3A 1Z5AA 3GIGA 3BMYA 2CGFA 4BIZA 2YE8A 3EHGA 3A0RA 4XKKA 5CTUA 1Y8NA 4FCPA 3U67A 4CWSA 3U2KA 2BTZA 3R4MA 1A4HA 4H81A 3VHDA 4FMTA 2BT0A 2WI7A 5IDMA 4YKUA 3T1KA 1UYHA 2BZ5A 2YGEA 3HEKA 2Q8HA 1I58A 4NH7A 2FYPA 2CCTA 2WERA 2XDLA 4PU9A 3INWA 4BQGA 3H80A 1Y4UA 2CCUA 4GCZA 1PVGA 1YESA 4KP4A 4QPJA 4XIRA 1ID0A 3D36A 1YSZA 3T10A 4GEEA 3SL2A 4P7AA 1U0ZA 4YKZA 2IOQA 4CE1A 4YKWA 1QZRA 2Q2EB 3B26A 4XKOA 4ASAA 4L91A 3C0EA 2XHRA 3WHAA 2YI5A 1UY6A 4HY6A 2YEEA 3A0ZA 4HYPA 2BU2A 1YT0A 2E0AA 1GKZA 4XIPA 2XHXA 2ZDXA 1ZW9A 4XTJA 4YKRA 4URNA 2YE4A 1UYCA 3G75A 2YE2A 4FPPA 1ZXNA 5FNCA 4XITA 4U93A 3G7EA 1B63A 2WI6A 3GIGB 4B7PA 3Q5LA 1H7SA 4CWPA 4MP2A 1OSFA 3B28A 4O05A 4E00A 1I59A 3GIEA 3OMUA 2IORA 4JAUA 2BU7A 3GIFA 1Y8OA 4LWFA 5CTXA 5F5RA 2YKCA 1JM6A 4AWPA 4WUDA 4NH9A 3D2RA 2HCHA 1S14A 4JAVA 4PL9A 3T2SA 5CF0A 1H7UA 4I5SA 2XDXA 3ZXQA 4ZVIA 3TZ0A 2JKIA 4WUCA 1YC1A 4KTNA 4H7QA 3VADA 4BQJA 2YGAA 3KE6A 1U2OA 2BRCA 2Q8GA 5M4PA 1ZXMA 2CG9A 2JJCA 1THNA 3TZ5A 2IOPA 2QG0A 2YEBA 2XCMA 4XDMA 4MOTA 2XDSA 1AH8A 3BM9A 3O2FA 1NHJA 2YECA 4LWEA 3C11A 2FWZA 4EEHA 1YS3A 2YK2A 4LWHA 4AS9A 2GFDA 2YGFA 3IEDA 4L8ZA 4EGHA 2XJXA 1YETA 2FXSA 4HZ0A 3RLQA 5BOCA 2WI3A 2YI0A 4ASFA 4URLA 4R1FA 1NHHA 4GGLA 2YEFA 2BYIA 1BKNA 4LWIA 3ZKBA 2YJWA 3O0IA 4V25A 4DZYA 5F3KA 2YK9A 3TZ4A 5FNDA 3R4NA 3R4PA 1S16A 2K5BA 5CTYA 4CWRA 2VCIA 2YEJA 3OW6A 2AKPA 3Q5JA 3MNRP 2GQPA 5D7DA 2XJGA 1UYKA 4BAEA 4O09A 1B62A 2YI6A 5J71A 2BU8A 3FT8A 2WEQA 2BREA 2Q8IA 3K60A 3CGZA 3EHHA 3HZ1A 4MB9A 2H55A 3JZ3A 4EFTA 4YKYA 2C2AA 3RKZA 4MPEA 4ZKIA 4HYMA 2QG2A 2YEHA 4EGKA 3CRLA 4R3MA 4E01A 4FCRA 3EKRA 4H85A 1TC6A 4EM7A 3EHJA 4XKAA 3QDDA 2XX4A 4X9LA 4LWGA
chains in the Genus database with same CATH superfamily
2O1VA 1UY9A 4XE2A 3K99A 2XJJA 1AJ6A 3NMQA 4UROA 4EFUA 3ZXOA 3G7BA 3A0YA 2YKIA 1TILA 2BU5A 5GGZA 1BXDA 1UYEA 4BXIA 2BYHA 2HG1A 5FNFA 1KIJA 1YT2A 3FV5A 1KZNA 1UY7A 2YE9A 3R91A 4KSHA 2WEPA 2IWXA 2VCJA 1UYDA 2XDKA 2YE3A 3HZ5A 1IXMA 1Y8PA 2ZBKB 3O6OA 4EMVA 4XD8A 3A0TA 4CWOA 2CH4A 2YI7A 2CCSA 2YE7A 3LPSA 3S5TA 4JQLA 3DGEA 3U2DA 4WUBA 2QF6A 4O07A 4CE3A 5M4MA 5JENA 4YKQA 4B6CA 3VHCA 4R3AA 2Q8FA 5M4NA 2YEGA 4O0BA 4V26A 1AM1A 1TC0A 2BU6A 2YKEA 1Z5BA 4FCQA 1YERA 4XCLA 4CWTA 3ZKDA 4K4OA 2XK2A 2YKBA 5M4EA 2UWDA 4W7TA 2XABA 5CPHA 1EA6A 3R92A 2ZKJA 2YEAA 1QY8A 2YE6A 3CRKA 3RLPA 1EI1A 1UYMA 2YEIA 1I5CA 4PRVA 4L90A 2O1WA 4DUHA 4JASA 2BSMA 1I5BA 1BGQA 3TUHA 5M4HA 1BYQA 2ESAA 3T0ZA 3CWVA 4HY1A 1GJVA 4EGIA 2QFOA 2XX5A 2WI2A 4E02A 1MX0A 4AWOA 5J6AA 4KQVA 4HZ5A 2O1UA 4I3HA 1TH8A 4CWFA 3LNUA 3QTFA 2IWSA 2YKJA 3WQ9A 4KSGA 4HXZA 5IDJA 1AMWA 4MBCA 3PEHA 2VWCA 4MPCA 2IWUA 1R62A 4P8OA 3B27A 3HHUA 4CWNA 3K98A 4U7OA 1UYFA 4XC0A 4AWQA 3OPDA 1GKXA 3B25A 4LWGA 3TTZA 5CTWA 2XX2A 5D7RA 4HXWA 3VHAA 5BODA 3A0XA 1TBWA 5D7CA 5IN9A 2YJXA 3HYZA 2XHTA 3LMMA 1US7A 2YE5A 4MP7A 4YKTA 3FT5A 1B3QA 2H8MA 4U7NA 4BIUA 4LP0A 2FWYA 5D6PA 2WI1A 4PRXA 4GT8A 4LPBA 1YT1A 1UYIA 5L3JA 3OWBA 1Z59A 4NH8A 2WI5A 3A0WA 4XCJA 1AH6A 3B24A 4ASBA 4O04A 4XIQA 1L0OA 3Q5KA 4YKXA 1MU5A 3EKOA 4GFNA 5C93A 4L93A 3R4OA 2XDUA 3CGYA 4L94A 1QYEA 2WI4A 2ZDYA 4CE2A 1NHIA 3OWDA 4Q20A 3PEJA 4MPNA 3H4LA 1YC4A 3D0BA 5FWKA 1I5DA 5D6QA 3RLRA 2FTKA 4CWQA 1YSRA 1UYGA 4KFGA 3TZ2A 5M4KA 1UYLA 3K97A 1Y4SA 3INXA 4ASGA 4QPKA 2EXLA 2YEDA 2PNRA 2HKJA 3EHFA 2XD6A 2VW5A 1TIDA 1Z5CA 3HYYA 3ZM7A 3T0HA 1ZWHA 4GQTA 4URMA 1UY8A 1YC3A 1Z5AA 3GIGA 3BMYA 2CGFA 4BIZA 2YE8A 3EHGA 3A0RA 4XKKA 5CTUA 1Y8NA 4FCPA 3U67A 4CWSA 3U2KA 2BTZA 3R4MA 1A4HA 4H81A 3VHDA 4FMTA 1F51A 2BT0A 2WI7A 5IDMA 4YKUA 3T1KA 1UYHA 2BZ5A 2YGEA 3HEKA 2Q8HA 1I58A 4NH7A 2FYPA 2CCTA 2WERA 2XDLA 4PU9A 3INWA 4BQGA 3H80A 1Y4UA 2CCUA 4GCZA 1PVGA 1YESA 4KP4A 4QPJA 4XIRA 1ID0A 3D36A 1YSZA 3T10A 4GEEA 3SL2A 4P7AA 1U0ZA 4YKZA 2IOQA 4CE1A 4YKWA 1QZRA 2Q2EB 3B26A 4XKOA 4ASAA 4L91A 3C0EA 2XHRA 3WHAA 2C1IA 2YI5A 1UY6A 2HHIA 4HY6A 2YEEA 3A0ZA 4HYPA 2BU2A 4E72A 1YT0A 2E0AA 1GKZA 4XIPA 2XHXA 2ZDXA 1ZW9A 4XTJA 4YKRA 4URNA 2YE4A 1UYCA 3G75A 2YE2A 4FPPA 1ZXNA 5FNCA 4XITA 4U93A 3G7EA 1B63A 2WI6A 3GIGB 2C1GA 3Q5LA 4B7PA 1H7SA 4CWPA 4MP2A 1OSFA 3B28A 4O05A 4E00A 1I59A 3GIEA 3OMUA 3CYGA 2IORA 4JAUA 2BU7A 3GIFA 1Y8OA 4LWFA 5CTXA 5F5RA 2YKCA 1JM6A 4AWPA 4WUDA 4NH9A 3D2RA 2HCHA 1S14A 4JAVA 4PL9A 3T2SA 5CF0A 1H7UA 4I5SA 2XDXA 3ZXQA 4ZVIA 3TZ0A 2JKIA 4WUCA 1YC1A 4KTNA 4H7QA 3VADA 4BQJA 2YGAA 3KE6A 1U2OA 2BRCA 2Q8GA 5M4PA 1ZXMA 2CG9A 2JJCA 1THNA 3TZ5A 2IOPA 2QG0A 2YEBA 2XCMA 4XDMA 4MOTA 2XDSA 1AH8A 3BM9A 3O2FA 1NHJA 2YECA 4LWEA 3C11A 2FWZA 4EEHA 1YS3A 2YK2A 4LWHA 4AS9A 2GFDA 2YGFA 3IEDA 4L8ZA 4EGHA 2XJXA 1YETA 2FXSA 4HZ0A 3RLQA 5BOCA 2WI3A 2YI0A 4ASFA 4URLA 4R1FA 1NHHA 4GGLA 2YEFA 2BYIA 1BKNA 4LWIA 3ZKBA 2YJWA 3O0IA 4V25A 4DZYA 5F3KA 2YK9A 3TZ4A 5FNDA 3R4NA 3R4PA 1S16A 2K5BA 5CTYA 4CWRA 2VCIA 2YEJA 3OW6A 2AKPA 3Q5JA 3MNRP 2GQPA 5D7DA 2XJGA 1UYKA 4BAEA 4O09A 1B62A 2YI6A 5J71A 2BU8A 3FT8A 2WEQA 2BREA 2Q8IA 3K60A 3CGZA 3EHHA 3HZ1A 4MB9A 2H55A 3JZ3A 4EFTA 4YKYA 2C2AA 3RKZA 4MPEA 4ZKIA 4HYMA 2QG2A 2YEHA 4EGKA 3CRLA 4R3MA 4E01A 4FCRA 3EKRA 4H85A 1TC6A 4EM7A 3EHJA 4XKAA 3QDDA 2XX4A 4X9LA 1I5AA
chains in the Genus database with same CATH topology
2O1VA 1UY9A 4XE2A 3K99A 2XJJA 1AJ6A 3NMQA 4UROA 4EFUA 3ZXOA 3G7BA 3A0YA 2YKIA 1TILA 2BU5A 5GGZA 1BXDA 1UYEA 4BXIA 2BYHA 2HG1A 5FNFA 1KIJA 1YT2A 3FV5A 1KZNA 1UY7A 2YE9A 3R91A 4KSHA 2WEPA 2IWXA 2VCJA 1UYDA 2XDKA 2YE3A 3HZ5A 1Y8PA 2ZBKB 3O6OA 4EMVA 4XD8A 3A0TA 4CWOA 2CH4A 2YI7A 2CCSA 2YE7A 3LPSA 4JQLA 3DGEA 3U2DA 4WUBA 2QF6A 4O07A 4CE3A 5M4MA 4YKQA 4B6CA 3VHCA 4R3AA 2Q8FA 5M4NA 2YEGA 4O0BA 4V26A 1AM1A 1TC0A 2BU6A 2YKEA 1Z5BA 4FCQA 1YERA 4XCLA 4CWTA 3ZKDA 4K4OA 2XK2A 2YKBA 5M4EA 2UWDA 4W7TA 2XABA 5CPHA 1EA6A 3R92A 2ZKJA 2YEAA 1QY8A 2YE6A 3CRKA 3RLPA 1EI1A 1UYMA 2YEIA 1I5CA 4PRVA 4L90A 2O1WA 4DUHA 4JASA 2BSMA 1I5BA 1BGQA 3TUHA 5M4HA 1BYQA 2ESAA 3T0ZA 3CWVA 4HY1A 1GJVA 4EGIA 2QFOA 2XX5A 2WI2A 4E02A 1MX0A 4AWOA 5J6AA 4KQVA 4HZ5A 2O1UA 4I3HA 1TH8A 4CWFA 3LNUA 3QTFA 2IWSA 2YKJA 3WQ9A 4KSGA 4HXZA 5IDJA 1AMWA 4MBCA 3PEHA 2VWCA 4MPCA 2IWUA 1R62A 4P8OA 3B27A 3HHUA 4CWNA 3K98A 4U7OA 1UYFA 4XC0A 4AWQA 3OPDA 1GKXA 3B25A 3TTZA 5CTWA 2XX2A 5D7RA 4HXWA 3VHAA 5BODA 3A0XA 1TBWA 5D7CA 5IN9A 2YJXA 3HYZA 2XHTA 1US7A 2YE5A 4MP7A 4YKTA 3FT5A 1B3QA 2H8MA 4U7NA 4BIUA 4LP0A 2FWYA 5D6PA 2WI1A 4PRXA 4GT8A 4LPBA 1I5AA 1YT1A 1UYIA 5L3JA 3OWBA 1Z59A 4NH8A 2WI5A 3A0WA 4XCJA 1AH6A 3B24A 4ASBA 4O04A 4XIQA 1L0OA 3Q5KA 4YKXA 1MU5A 3EKOA 4GFNA 5C93A 4L93A 3R4OA 2XDUA 3CGYA 4L94A 1QYEA 2WI4A 2ZDYA 4CE2A 1NHIA 3OWDA 4Q20A 3PEJA 4MPNA 3H4LA 1YC4A 3D0BA 5FWKA 1I5DA 5D6QA 3RLRA 4CWQA 1YSRA 1UYGA 4KFGA 3TZ2A 5M4KA 1UYLA 3K97A 1Y4SA 3INXA 4ASGA 4QPKA 2EXLA 2YEDA 2PNRA 2HKJA 3EHFA 2XD6A 2VW5A 1TIDA 1Z5CA 3HYYA 3ZM7A 3T0HA 1ZWHA 4GQTA 4URMA 1UY8A 1YC3A 1Z5AA 3GIGA 3BMYA 2CGFA 4BIZA 2YE8A 3EHGA 3A0RA 4XKKA 5CTUA 1Y8NA 4FCPA 3U67A 4CWSA 3U2KA 2BTZA 3R4MA 1A4HA 4H81A 3VHDA 4FMTA 2BT0A 2WI7A 5IDMA 4YKUA 3T1KA 1UYHA 2BZ5A 2YGEA 3HEKA 2Q8HA 1I58A 4NH7A 2FYPA 2CCTA 2WERA 2XDLA 4PU9A 3INWA 4BQGA 3H80A 1Y4UA 2CCUA 4GCZA 1PVGA 1YESA 4KP4A 4QPJA 4XIRA 1ID0A 3D36A 1YSZA 3T10A 4GEEA 3SL2A 4P7AA 1U0ZA 4YKZA 2IOQA 4CE1A 4YKWA 1QZRA 2Q2EB 3B26A 4XKOA 4ASAA 4L91A 3C0EA 2XHRA 3WHAA 2YI5A 1UY6A 4HY6A 2YEEA 3A0ZA 4HYPA 2BU2A 1YT0A 2E0AA 1GKZA 4XIPA 2XHXA 2ZDXA 1ZW9A 4XTJA 4YKRA 4URNA 2YE4A 1UYCA 3G75A 2YE2A 4FPPA 1ZXNA 5FNCA 4XITA 4U93A 3G7EA 1B63A 2WI6A 3GIGB 4B7PA 3Q5LA 1H7SA 4CWPA 4MP2A 1OSFA 3B28A 4O05A 4E00A 1I59A 3GIEA 3OMUA 2IORA 4JAUA 2BU7A 3GIFA 1Y8OA 4LWFA 5CTXA 5F5RA 2YKCA 1JM6A 4AWPA 4WUDA 4NH9A 3D2RA 2HCHA 1S14A 4JAVA 4PL9A 3T2SA 5CF0A 1H7UA 4I5SA 2XDXA 3ZXQA 4ZVIA 3TZ0A 2JKIA 4WUCA 1YC1A 4KTNA 4H7QA 3VADA 4BQJA 2YGAA 3KE6A 1U2OA 2BRCA 2Q8GA 5M4PA 1ZXMA 2CG9A 2JJCA 1THNA 3TZ5A 2IOPA 2QG0A 2YEBA 2XCMA 4XDMA 4MOTA 2XDSA 1AH8A 3BM9A 3O2FA 1NHJA 2YECA 4LWEA 3C11A 2FWZA 4EEHA 1YS3A 2YK2A 4LWHA 4AS9A 2GFDA 2YGFA 3IEDA 4L8ZA 4EGHA 2XJXA 1YETA 2FXSA 4HZ0A 3RLQA 5BOCA 2WI3A 2YI0A 4ASFA 4URLA 4R1FA 1NHHA 4GGLA 2YEFA 2BYIA 1BKNA 4LWIA 3ZKBA 2YJWA 3O0IA 4V25A 4DZYA 5F3KA 2YK9A 3TZ4A 5FNDA 3R4NA 3R4PA 1S16A 2K5BA 5CTYA 4CWRA 2VCIA 2YEJA 3OW6A 2AKPA 3Q5JA 3MNRP 2GQPA 5D7DA 2XJGA 1UYKA 4BAEA 4O09A 1B62A 2YI6A 5J71A 2BU8A 3FT8A 2WEQA 2BREA 2Q8IA 3K60A 3CGZA 3EHHA 3HZ1A 4MB9A 2H55A 3JZ3A 4EFTA 4YKYA 2C2AA 3RKZA 4MPEA 4ZKIA 4HYMA 2QG2A 2YEHA 4EGKA 3CRLA 4R3MA 4E01A 4FCRA 3EKRA 4H85A 1TC6A 4EM7A 3EHJA 4XKAA 3QDDA 2XX4A 4X9LA 4LWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O1V A;  1UY9 A;  4XE2 A;  3K99 A;  2XJJ A;  1AJ6 A;  3NMQ A;  4URO A;  4EFU A;  3ZXO A;  3G7B A;  3A0Y A;  2YKI A;  1TIL A;  2BU5 A;  5GGZ A;  1BXD A;  1UYE A;  4BXI A;  2BYH A;  2HG1 A;  5FNF A;  1KIJ A;  1YT2 A;  3FV5 A;  1KZN A;  1UY7 A;  2YE9 A;  3R91 A;  4KSH A;  2WEP A;  2IWX A;  2VCJ A;  1UYD A;  2XDK A;  2YE3 A;  3HZ5 A;  1Y8P A;  2ZBK B;  3O6O A;  4EMV A;  4XD8 A;  3A0T A;  4CWO A;  2CH4 A;  2YI7 A;  2CCS A;  2YE7 A;  3LPS A;  4JQL A;  3DGE A;  3U2D A;  4WUB A;  2QF6 A;  4O07 A;  4CE3 A;  5M4M A;  4YKQ A;  4B6C A;  3VHC A;  4R3A A;  2Q8F A;  5M4N A;  2YEG A;  4O0B A;  4V26 A;  1AM1 A;  1TC0 A;  2BU6 A;  2YKE A;  1Z5B A;  4FCQ A;  1YER A;  4XCL A;  4CWT A;  3ZKD A;  4K4O A;  2XK2 A;  2YKB A;  5M4E A;  2UWD A;  4W7T A;  2XAB A;  5CPH A;  1EA6 A;  3R92 A;  2ZKJ A;  2YEA A;  1QY8 A;  2YE6 A;  3CRK A;  3RLP A;  1EI1 A;  1UYM A;  2YEI A;  1I5C A;  4PRV A;  4L90 A;  2O1W A;  4DUH A;  4JAS A;  2BSM A;  1I5B A;  1BGQ A;  3TUH A;  5M4H A;  1BYQ A;  2ESA A;  3T0Z A;  3CWV A;  4HY1 A;  1GJV A;  4EGI A;  2QFO A;  2XX5 A;  2WI2 A;  4E02 A;  1MX0 A;  4AWO A;  5J6A A;  4KQV A;  4HZ5 A;  2O1U A;  4I3H A;  1TH8 A;  4CWF A;  3LNU A;  3QTF A;  2IWS A;  2YKJ A;  3WQ9 A;  4KSG A;  4HXZ A;  5IDJ A;  1AMW A;  4MBC A;  3PEH A;  2VWC A;  4MPC A;  2IWU A;  1R62 A;  4P8O A;  3B27 A;  3HHU A;  4CWN A;  3K98 A;  4U7O A;  1UYF A;  4XC0 A;  4AWQ A;  3OPD A;  1GKX A;  3B25 A;  3TTZ A;  5CTW A;  2XX2 A;  5D7R A;  4HXW A;  3VHA A;  5BOD A;  3A0X A;  1TBW A;  5D7C A;  5IN9 A;  2YJX A;  3HYZ A;  2XHT A;  1US7 A;  2YE5 A;  4MP7 A;  4YKT A;  3FT5 A;  1B3Q A;  2H8M A;  4U7N A;  4BIU A;  4LP0 A;  2FWY A;  5D6P A;  2WI1 A;  4PRX A;  4GT8 A;  4LPB A;  1I5A A;  1YT1 A;  1UYI A;  5L3J A;  3OWB A;  1Z59 A;  4NH8 A;  2WI5 A;  3A0W A;  4XCJ A;  1AH6 A;  3B24 A;  4ASB A;  4O04 A;  4XIQ A;  1L0O A;  3Q5K A;  4YKX A;  1MU5 A;  3EKO A;  4GFN A;  5C93 A;  4L93 A;  3R4O A;  2XDU A;  3CGY A;  4L94 A;  1QYE A;  2WI4 A;  2ZDY A;  4CE2 A;  1NHI A;  3OWD A;  4Q20 A;  3PEJ A;  4MPN A;  3H4L A;  1YC4 A;  3D0B A;  5FWK A;  1I5D A;  5D6Q A;  3RLR A;  4CWQ A;  1YSR A;  1UYG A;  4KFG A;  3TZ2 A;  5M4K A;  1UYL A;  3K97 A;  1Y4S A;  3INX A;  4ASG A;  4QPK A;  2EXL A;  2YED A;  2PNR A;  2HKJ A;  3EHF A;  2XD6 A;  2VW5 A;  1TID A;  1Z5C A;  3HYY A;  3ZM7 A;  3T0H A;  1ZWH A;  4GQT A;  4URM A;  1UY8 A;  1YC3 A;  1Z5A A;  3GIG A;  3BMY A;  2CGF A;  4BIZ A;  2YE8 A;  3EHG A;  3A0R A;  4XKK A;  5CTU A;  1Y8N A;  4FCP A;  3U67 A;  4CWS A;  3U2K A;  2BTZ A;  3R4M A;  1A4H A;  4H81 A;  3VHD A;  4FMT A;  2BT0 A;  2WI7 A;  5IDM A;  4YKU A;  3T1K A;  1UYH A;  2BZ5 A;  2YGE A;  3HEK A;  2Q8H A;  1I58 A;  4NH7 A;  2FYP A;  2CCT A;  2WER A;  2XDL A;  4PU9 A;  3INW A;  4BQG A;  3H80 A;  1Y4U A;  2CCU A;  4GCZ A;  1PVG A;  1YES A;  4KP4 A;  4QPJ A;  4XIR A;  1ID0 A;  3D36 A;  1YSZ A;  3T10 A;  4GEE A;  3SL2 A;  4P7A A;  1U0Z A;  4YKZ A;  2IOQ A;  4CE1 A;  4YKW A;  1QZR A;  2Q2E B;  3B26 A;  4XKO A;  4ASA A;  4L91 A;  3C0E A;  2XHR A;  3WHA A;  2YI5 A;  1UY6 A;  4HY6 A;  2YEE A;  3A0Z A;  4HYP A;  2BU2 A;  1YT0 A;  2E0A A;  1GKZ A;  4XIP A;  2XHX A;  2ZDX A;  1ZW9 A;  4XTJ A;  4YKR A;  4URN A;  2YE4 A;  1UYC A;  3G75 A;  2YE2 A;  4FPP A;  1ZXN A;  5FNC A;  4XIT A;  4U93 A;  3G7E A;  1B63 A;  2WI6 A;  3GIG B;  4B7P A;  3Q5L A;  1H7S A;  4CWP A;  4MP2 A;  1OSF A;  3B28 A;  4O05 A;  4E00 A;  1I59 A;  3GIE A;  3OMU A;  2IOR A;  4JAU A;  2BU7 A;  3GIF A;  1Y8O A;  4LWF A;  5CTX A;  5F5R A;  2YKC A;  1JM6 A;  4AWP A;  4WUD A;  4NH9 A;  3D2R A;  2HCH A;  1S14 A;  4JAV A;  4PL9 A;  3T2S A;  5CF0 A;  1H7U A;  4I5S A;  2XDX A;  3ZXQ A;  4ZVI A;  3TZ0 A;  2JKI A;  4WUC A;  1YC1 A;  4KTN A;  4H7Q A;  3VAD A;  4BQJ A;  2YGA A;  3KE6 A;  1U2O A;  2BRC A;  2Q8G A;  5M4P A;  1ZXM A;  2CG9 A;  2JJC A;  1THN A;  3TZ5 A;  2IOP A;  2QG0 A;  2YEB A;  2XCM A;  4XDM A;  4MOT A;  2XDS A;  1AH8 A;  3BM9 A;  3O2F A;  1NHJ A;  2YEC A;  4LWE A;  3C11 A;  2FWZ A;  4EEH A;  1YS3 A;  2YK2 A;  4LWH A;  4AS9 A;  2GFD A;  2YGF A;  3IED A;  4L8Z A;  4EGH A;  2XJX A;  1YET A;  2FXS A;  4HZ0 A;  3RLQ A;  5BOC A;  2WI3 A;  2YI0 A;  4ASF A;  4URL A;  4R1F A;  1NHH A;  4GGL A;  2YEF A;  2BYI A;  1BKN A;  4LWI A;  3ZKB A;  2YJW A;  3O0I A;  4V25 A;  4DZY A;  5F3K A;  2YK9 A;  3TZ4 A;  5FND A;  3R4N A;  3R4P A;  1S16 A;  2K5B A;  5CTY A;  4CWR A;  2VCI A;  2YEJ A;  3OW6 A;  2AKP A;  3Q5J A;  3MNR P;  2GQP A;  5D7D A;  2XJG A;  1UYK A;  4BAE A;  4O09 A;  1B62 A;  2YI6 A;  5J71 A;  2BU8 A;  3FT8 A;  2WEQ A;  2BRE A;  2Q8I A;  3K60 A;  3CGZ A;  3EHH A;  3HZ1 A;  4MB9 A;  2H55 A;  3JZ3 A;  4EFT A;  4YKY A;  2C2A A;  3RKZ A;  4MPE A;  4ZKI A;  4HYM A;  2QG2 A;  2YEH A;  4EGK A;  3CRL A;  4R3M A;  4E01 A;  4FCR A;  3EKR A;  4H85 A;  1TC6 A;  4EM7 A;  3EHJ A;  4XKA A;  3QDD A;  2XX4 A;  4X9L A;  4LWG A; 
#chains in the Genus database with same CATH topology
 2O1V A;  1UY9 A;  4XE2 A;  3K99 A;  2XJJ A;  1AJ6 A;  3NMQ A;  4URO A;  4EFU A;  3ZXO A;  3G7B A;  3A0Y A;  2YKI A;  1TIL A;  2BU5 A;  5GGZ A;  1BXD A;  1UYE A;  4BXI A;  2BYH A;  2HG1 A;  5FNF A;  1KIJ A;  1YT2 A;  3FV5 A;  1KZN A;  1UY7 A;  2YE9 A;  3R91 A;  4KSH A;  2WEP A;  2IWX A;  2VCJ A;  1UYD A;  2XDK A;  2YE3 A;  3HZ5 A;  1IXM A;  1Y8P A;  2ZBK B;  3O6O A;  4EMV A;  4XD8 A;  3A0T A;  4CWO A;  2CH4 A;  2YI7 A;  2CCS A;  2YE7 A;  3LPS A;  3S5T A;  4JQL A;  3DGE A;  3U2D A;  4WUB A;  2QF6 A;  4O07 A;  4CE3 A;  5M4M A;  5JEN A;  4YKQ A;  4B6C A;  3VHC A;  4R3A A;  2Q8F A;  5M4N A;  2YEG A;  4O0B A;  4V26 A;  1AM1 A;  1TC0 A;  2BU6 A;  2YKE A;  1Z5B A;  4FCQ A;  1YER A;  4XCL A;  4CWT A;  3ZKD A;  4K4O A;  2XK2 A;  2YKB A;  5M4E A;  2UWD A;  4W7T A;  2XAB A;  5CPH A;  1EA6 A;  3R92 A;  2ZKJ A;  2YEA A;  1QY8 A;  2YE6 A;  3CRK A;  3RLP A;  1EI1 A;  1UYM A;  2YEI A;  1I5C A;  4PRV A;  4L90 A;  2O1W A;  4DUH A;  4JAS A;  2BSM A;  1I5B A;  1BGQ A;  3TUH A;  5M4H A;  1BYQ A;  2ESA A;  3T0Z A;  3CWV A;  4HY1 A;  1GJV A;  4EGI A;  2QFO A;  2XX5 A;  2WI2 A;  4E02 A;  1MX0 A;  4AWO A;  5J6A A;  4KQV A;  4HZ5 A;  2O1U A;  4I3H A;  1TH8 A;  4CWF A;  3LNU A;  3QTF A;  2IWS A;  2YKJ A;  3WQ9 A;  4KSG A;  4HXZ A;  5IDJ A;  1AMW A;  4MBC A;  3PEH A;  2VWC A;  4MPC A;  2IWU A;  1R62 A;  4P8O A;  3B27 A;  3HHU A;  4CWN A;  3K98 A;  4U7O A;  1UYF A;  4XC0 A;  4AWQ A;  3OPD A;  1GKX A;  3B25 A;  4LWG A;  3TTZ A;  5CTW A;  2XX2 A;  5D7R A;  4HXW A;  3VHA A;  5BOD A;  3A0X A;  1TBW A;  5D7C A;  5IN9 A;  2YJX A;  3HYZ A;  2XHT A;  3LMM A;  1US7 A;  2YE5 A;  4MP7 A;  4YKT A;  3FT5 A;  1B3Q A;  2H8M A;  4U7N A;  4BIU A;  4LP0 A;  2FWY A;  5D6P A;  2WI1 A;  4PRX A;  4GT8 A;  4LPB A;  1YT1 A;  1UYI A;  5L3J A;  3OWB A;  1Z59 A;  4NH8 A;  2WI5 A;  3A0W A;  4XCJ A;  1AH6 A;  3B24 A;  4ASB A;  4O04 A;  4XIQ A;  1L0O A;  3Q5K A;  4YKX A;  1MU5 A;  3EKO A;  4GFN A;  5C93 A;  4L93 A;  3R4O A;  2XDU A;  3CGY A;  4L94 A;  1QYE A;  2WI4 A;  2ZDY A;  4CE2 A;  1NHI A;  3OWD A;  4Q20 A;  3PEJ A;  4MPN A;  3H4L A;  1YC4 A;  3D0B A;  5FWK A;  1I5D A;  5D6Q A;  3RLR A;  2FTK A;  4CWQ A;  1YSR A;  1UYG A;  4KFG A;  3TZ2 A;  5M4K A;  1UYL A;  3K97 A;  1Y4S A;  3INX A;  4ASG A;  4QPK A;  2EXL A;  2YED A;  2PNR A;  2HKJ A;  3EHF A;  2XD6 A;  2VW5 A;  1TID A;  1Z5C A;  3HYY A;  3ZM7 A;  3T0H A;  1ZWH A;  4GQT A;  4URM A;  1UY8 A;  1YC3 A;  1Z5A A;  3GIG A;  3BMY A;  2CGF A;  4BIZ A;  2YE8 A;  3EHG A;  3A0R A;  4XKK A;  5CTU A;  1Y8N A;  4FCP A;  3U67 A;  4CWS A;  3U2K A;  2BTZ A;  3R4M A;  1A4H A;  4H81 A;  3VHD A;  4FMT A;  1F51 A;  2BT0 A;  2WI7 A;  5IDM A;  4YKU A;  3T1K A;  1UYH A;  2BZ5 A;  2YGE A;  3HEK A;  2Q8H A;  1I58 A;  4NH7 A;  2FYP A;  2CCT A;  2WER A;  2XDL A;  4PU9 A;  3INW A;  4BQG A;  3H80 A;  1Y4U A;  2CCU A;  4GCZ A;  1PVG A;  1YES A;  4KP4 A;  4QPJ A;  4XIR A;  1ID0 A;  3D36 A;  1YSZ A;  3T10 A;  4GEE A;  3SL2 A;  4P7A A;  1U0Z A;  4YKZ A;  2IOQ A;  4CE1 A;  4YKW A;  1QZR A;  2Q2E B;  3B26 A;  4XKO A;  4ASA A;  4L91 A;  3C0E A;  2XHR A;  3WHA A;  2C1I A;  2YI5 A;  1UY6 A;  2HHI A;  4HY6 A;  2YEE A;  3A0Z A;  4HYP A;  2BU2 A;  4E72 A;  1YT0 A;  2E0A A;  1GKZ A;  4XIP A;  2XHX A;  2ZDX A;  1ZW9 A;  4XTJ A;  4YKR A;  4URN A;  2YE4 A;  1UYC A;  3G75 A;  2YE2 A;  4FPP A;  1ZXN A;  5FNC A;  4XIT A;  4U93 A;  3G7E A;  1B63 A;  2WI6 A;  3GIG B;  2C1G A;  3Q5L A;  4B7P A;  1H7S A;  4CWP A;  4MP2 A;  1OSF A;  3B28 A;  4O05 A;  4E00 A;  1I59 A;  3GIE A;  3OMU A;  3CYG A;  2IOR A;  4JAU A;  2BU7 A;  3GIF A;  1Y8O A;  4LWF A;  5CTX A;  5F5R A;  2YKC A;  1JM6 A;  4AWP A;  4WUD A;  4NH9 A;  3D2R A;  2HCH A;  1S14 A;  4JAV A;  4PL9 A;  3T2S A;  5CF0 A;  1H7U A;  4I5S A;  2XDX A;  3ZXQ A;  4ZVI A;  3TZ0 A;  2JKI A;  4WUC A;  1YC1 A;  4KTN A;  4H7Q A;  3VAD A;  4BQJ A;  2YGA A;  3KE6 A;  1U2O A;  2BRC A;  2Q8G A;  5M4P A;  1ZXM A;  2CG9 A;  2JJC A;  1THN A;  3TZ5 A;  2IOP A;  2QG0 A;  2YEB A;  2XCM A;  4XDM A;  4MOT A;  2XDS A;  1AH8 A;  3BM9 A;  3O2F A;  1NHJ A;  2YEC A;  4LWE A;  3C11 A;  2FWZ A;  4EEH A;  1YS3 A;  2YK2 A;  4LWH A;  4AS9 A;  2GFD A;  2YGF A;  3IED A;  4L8Z A;  4EGH A;  2XJX A;  1YET A;  2FXS A;  4HZ0 A;  3RLQ A;  5BOC A;  2WI3 A;  2YI0 A;  4ASF A;  4URL A;  4R1F A;  1NHH A;  4GGL A;  2YEF A;  2BYI A;  1BKN A;  4LWI A;  3ZKB A;  2YJW A;  3O0I A;  4V25 A;  4DZY A;  5F3K A;  2YK9 A;  3TZ4 A;  5FND A;  3R4N A;  3R4P A;  1S16 A;  2K5B A;  5CTY A;  4CWR A;  2VCI A;  2YEJ A;  3OW6 A;  2AKP A;  3Q5J A;  3MNR P;  2GQP A;  5D7D A;  2XJG A;  1UYK A;  4BAE A;  4O09 A;  1B62 A;  2YI6 A;  5J71 A;  2BU8 A;  3FT8 A;  2WEQ A;  2BRE A;  2Q8I A;  3K60 A;  3CGZ A;  3EHH A;  3HZ1 A;  4MB9 A;  2H55 A;  3JZ3 A;  4EFT A;  4YKY A;  2C2A A;  3RKZ A;  4MPE A;  4ZKI A;  4HYM A;  2QG2 A;  2YEH A;  4EGK A;  3CRL A;  4R3M A;  4E01 A;  4FCR A;  3EKR A;  4H85 A;  1TC6 A;  4EM7 A;  3EHJ A;  4XKA A;  3QDD A;  2XX4 A;  4X9L A;  1I5A A; 
#chains in the Genus database with same CATH homology
 2O1V A;  1UY9 A;  4XE2 A;  3K99 A;  2XJJ A;  1AJ6 A;  3NMQ A;  4URO A;  4EFU A;  3ZXO A;  3G7B A;  3A0Y A;  2YKI A;  1TIL A;  2BU5 A;  5GGZ A;  1BXD A;  1UYE A;  4BXI A;  2BYH A;  2HG1 A;  5FNF A;  1KIJ A;  1YT2 A;  3FV5 A;  1KZN A;  1UY7 A;  2YE9 A;  3R91 A;  4KSH A;  2WEP A;  2IWX A;  2VCJ A;  1UYD A;  2XDK A;  2YE3 A;  3HZ5 A;  1Y8P A;  2ZBK B;  3O6O A;  4EMV A;  4XD8 A;  3A0T A;  4CWO A;  2CH4 A;  2YI7 A;  2CCS A;  2YE7 A;  3LPS A;  4JQL A;  3DGE A;  3U2D A;  4WUB A;  2QF6 A;  4O07 A;  4CE3 A;  5M4M A;  4YKQ A;  4B6C A;  3VHC A;  4R3A A;  2Q8F A;  5M4N A;  2YEG A;  4O0B A;  4V26 A;  1AM1 A;  1TC0 A;  2BU6 A;  2YKE A;  1Z5B A;  4FCQ A;  1YER A;  4XCL A;  4CWT A;  3ZKD A;  4K4O A;  2XK2 A;  2YKB A;  5M4E A;  2UWD A;  4W7T A;  2XAB A;  5CPH A;  1EA6 A;  3R92 A;  2ZKJ A;  2YEA A;  1QY8 A;  2YE6 A;  3CRK A;  3RLP A;  1EI1 A;  1UYM A;  2YEI A;  1I5C A;  4PRV A;  4L90 A;  2O1W A;  4DUH A;  4JAS A;  2BSM A;  1I5B A;  1BGQ A;  3TUH A;  5M4H A;  1BYQ A;  2ESA A;  3T0Z A;  3CWV A;  4HY1 A;  1GJV A;  4EGI A;  2QFO A;  2XX5 A;  2WI2 A;  4E02 A;  1MX0 A;  4AWO A;  5J6A A;  4KQV A;  4HZ5 A;  2O1U A;  4I3H A;  1TH8 A;  4CWF A;  3LNU A;  3QTF A;  2IWS A;  2YKJ A;  3WQ9 A;  4KSG A;  4HXZ A;  5IDJ A;  1AMW A;  4MBC A;  3PEH A;  2VWC A;  4MPC A;  2IWU A;  1R62 A;  4P8O A;  3B27 A;  3HHU A;  4CWN A;  3K98 A;  4U7O A;  1UYF A;  4XC0 A;  4AWQ A;  3OPD A;  1GKX A;  3B25 A;  3TTZ A;  5CTW A;  2XX2 A;  5D7R A;  4HXW A;  3VHA A;  5BOD A;  3A0X A;  1TBW A;  5D7C A;  5IN9 A;  2YJX A;  3HYZ A;  2XHT A;  1US7 A;  2YE5 A;  4MP7 A;  4YKT A;  3FT5 A;  1B3Q A;  2H8M A;  4U7N A;  4BIU A;  4LP0 A;  2FWY A;  5D6P A;  2WI1 A;  4PRX A;  4GT8 A;  4LPB A;  1I5A A;  1YT1 A;  1UYI A;  5L3J A;  3OWB A;  1Z59 A;  4NH8 A;  2WI5 A;  3A0W A;  4XCJ A;  1AH6 A;  3B24 A;  4ASB A;  4O04 A;  4XIQ A;  1L0O A;  3Q5K A;  4YKX A;  1MU5 A;  3EKO A;  4GFN A;  5C93 A;  4L93 A;  3R4O A;  2XDU A;  3CGY A;  4L94 A;  1QYE A;  2WI4 A;  2ZDY A;  4CE2 A;  1NHI A;  3OWD A;  4Q20 A;  3PEJ A;  4MPN A;  3H4L A;  1YC4 A;  3D0B A;  5FWK A;  1I5D A;  5D6Q A;  3RLR A;  4CWQ A;  1YSR A;  1UYG A;  4KFG A;  3TZ2 A;  5M4K A;  1UYL A;  3K97 A;  1Y4S A;  3INX A;  4ASG A;  4QPK A;  2EXL A;  2YED A;  2PNR A;  2HKJ A;  3EHF A;  2XD6 A;  2VW5 A;  1TID A;  1Z5C A;  3HYY A;  3ZM7 A;  3T0H A;  1ZWH A;  4GQT A;  4URM A;  1UY8 A;  1YC3 A;  1Z5A A;  3GIG A;  3BMY A;  2CGF A;  4BIZ A;  2YE8 A;  3EHG A;  3A0R A;  4XKK A;  5CTU A;  1Y8N A;  4FCP A;  3U67 A;  4CWS A;  3U2K A;  2BTZ A;  3R4M A;  1A4H A;  4H81 A;  3VHD A;  4FMT A;  2BT0 A;  2WI7 A;  5IDM A;  4YKU A;  3T1K A;  1UYH A;  2BZ5 A;  2YGE A;  3HEK A;  2Q8H A;  1I58 A;  4NH7 A;  2FYP A;  2CCT A;  2WER A;  2XDL A;  4PU9 A;  3INW A;  4BQG A;  3H80 A;  1Y4U A;  2CCU A;  4GCZ A;  1PVG A;  1YES A;  4KP4 A;  4QPJ A;  4XIR A;  1ID0 A;  3D36 A;  1YSZ A;  3T10 A;  4GEE A;  3SL2 A;  4P7A A;  1U0Z A;  4YKZ A;  2IOQ A;  4CE1 A;  4YKW A;  1QZR A;  2Q2E B;  3B26 A;  4XKO A;  4ASA A;  4L91 A;  3C0E A;  2XHR A;  3WHA A;  2YI5 A;  1UY6 A;  4HY6 A;  2YEE A;  3A0Z A;  4HYP A;  2BU2 A;  1YT0 A;  2E0A A;  1GKZ A;  4XIP A;  2XHX A;  2ZDX A;  1ZW9 A;  4XTJ A;  4YKR A;  4URN A;  2YE4 A;  1UYC A;  3G75 A;  2YE2 A;  4FPP A;  1ZXN A;  5FNC A;  4XIT A;  4U93 A;  3G7E A;  1B63 A;  2WI6 A;  3GIG B;  4B7P A;  3Q5L A;  1H7S A;  4CWP A;  4MP2 A;  1OSF A;  3B28 A;  4O05 A;  4E00 A;  1I59 A;  3GIE A;  3OMU A;  2IOR A;  4JAU A;  2BU7 A;  3GIF A;  1Y8O A;  4LWF A;  5CTX A;  5F5R A;  2YKC A;  1JM6 A;  4AWP A;  4WUD A;  4NH9 A;  3D2R A;  2HCH A;  1S14 A;  4JAV A;  4PL9 A;  3T2S A;  5CF0 A;  1H7U A;  4I5S A;  2XDX A;  3ZXQ A;  4ZVI A;  3TZ0 A;  2JKI A;  4WUC A;  1YC1 A;  4KTN A;  4H7Q A;  3VAD A;  4BQJ A;  2YGA A;  3KE6 A;  1U2O A;  2BRC A;  2Q8G A;  5M4P A;  1ZXM A;  2CG9 A;  2JJC A;  1THN A;  3TZ5 A;  2IOP A;  2QG0 A;  2YEB A;  2XCM A;  4XDM A;  4MOT A;  2XDS A;  1AH8 A;  3BM9 A;  3O2F A;  1NHJ A;  2YEC A;  4LWE A;  3C11 A;  2FWZ A;  4EEH A;  1YS3 A;  2YK2 A;  4LWH A;  4AS9 A;  2GFD A;  2YGF A;  3IED A;  4L8Z A;  4EGH A;  2XJX A;  1YET A;  2FXS A;  4HZ0 A;  3RLQ A;  5BOC A;  2WI3 A;  2YI0 A;  4ASF A;  4URL A;  4R1F A;  1NHH A;  4GGL A;  2YEF A;  2BYI A;  1BKN A;  4LWI A;  3ZKB A;  2YJW A;  3O0I A;  4V25 A;  4DZY A;  5F3K A;  2YK9 A;  3TZ4 A;  5FND A;  3R4N A;  3R4P A;  1S16 A;  2K5B A;  5CTY A;  4CWR A;  2VCI A;  2YEJ A;  3OW6 A;  2AKP A;  3Q5J A;  3MNR P;  2GQP A;  5D7D A;  2XJG A;  1UYK A;  4BAE A;  4O09 A;  1B62 A;  2YI6 A;  5J71 A;  2BU8 A;  3FT8 A;  2WEQ A;  2BRE A;  2Q8I A;  3K60 A;  3CGZ A;  3EHH A;  3HZ1 A;  4MB9 A;  2H55 A;  3JZ3 A;  4EFT A;  4YKY A;  2C2A A;  3RKZ A;  4MPE A;  4ZKI A;  4HYM A;  2QG2 A;  2YEH A;  4EGK A;  3CRL A;  4R3M A;  4E01 A;  4FCR A;  3EKR A;  4H85 A;  1TC6 A;  4EM7 A;  3EHJ A;  4XKA A;  3QDD A;  2XX4 A;  4X9L A;  4LWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...