2AKRA

Structural basis of sulfatide presentation by mouse cd1d
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
273
structure length
269
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for CD1d presentation of a sulfatide derived from myelin and its implications for autoimmunity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords T-cell surface glycoprotein CD1d1
total genus 80
structure length 269
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2akrA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2akrA01
1D5ZA 3WL9B 1AGEB 4PJDF 5T3ZH 3BD3A 1QLEH 2YPVH 3S96A 1HIMH 2ARJA 3QDGA 2WM0A 3FB6B 3FO1A 4NNYB 1CI5A 4PJHB 4U1IB 5CBEA 2AXGB 1BPVA 3AVEA 1YEHL 3P40A 2D0FA 1QBBA 2FLBT 3DVIA 2X44D 3UO1L 1IARB 2HKFH 5L2KE 4JG1L 5HHOE 4ODSH 1X7QB 1KIQA 1OAYL 4N0CA 5FYLH 1HK6A 3A6BH 5JA8B 1KB5L 3T04D 5CBEB 4HUWB 3L7FA 4KTYA 3QDGB 3NFPA 5EN2B 1A21A 4PJEF 4AT6B 2FX7H 4IDJH 4J4PD 4HBQA 4Z7WA 3HFML 4QXGH 1ITBB 1SMOA 1UCBL 4X99B 4AK1A 4HCRL 5AG9A 1F2XK 3CFDB 5MERA 2YPKA 5JIKA 4K3EL 4DOHE 3ARYA 4YK4B 2NY5C 2HVJA 4M7JL 4XMKL 5F6HJ 1G9NL 4DTGL 2VLJA 4P2OA 3W0WE 4GAYA 4F37F 3I2CL 3C5ZA 3HZVA 4JVUA 2I27N 5EIQA 5AYUH 1JPSH 1TETH 3TV3H 4LARL 1ETZB 1LQSR 2YK1H 3B9EA 1AP2A 1MWAB 4K8RL 3C87A 1A7OH 1LO3H 1RUML 2BJML 5DC0A 4BSVB 2PW1B 4NQXA 3QHTC 3MRNA 1QRKA 1ORSB 1U92A 3O6KH 3S37X 4X99A 5DLMH 4YHYC 3EAKA 4QT5A 4UILH 2G9HB 2WANA 1AKJB 4TRPL 2VE6A 4LEXL 3CD4A 4XBGB 5CSBA 4M4RA 2C1OA 3RX5A 3EO1B 4LLMB 1NGWB 4PV8B 1CFSA 1MCWW 3B5TA 3QNZA 4X5XB 5EBGA 1JGDA 3UTSE 3MRFA 3LPGA 4RAUB 5EOTB 1H8NA 4OCXH 4GG6F 2V9RA 4YHIB 2FR4A 1DQJB 2VLLB 3GMQA 3IXTA 4TNVK 5IHZA 5M7QA 3MV8B 1AXTH 1A6UH 1IL1B 1FP5A 5DEZA 4H20L 4IBLT 1F4YH 4LSQH 4U1IA 2ZCKL 2VRAA 3DRTA 3O3BB 5AZ2H 3KPRB 4MAUH 1MHCB 2H41A 2J8OA 3FQXB 1V3JA 4L4TA 2DM2A 5FF6A 3Q1SL 3MACL 4IM8A 3O6LL 3N9GH 4YZFE 1T7YA 5GRJH 1ND0A 2NNAB 5F7NC 3M8OH 1BFSA 4JRYA 3KS0J 3MMEA 1QR1B 3C8KA 4JFDA 3DV4B 2R0ZH 2R4SL 4AEIH 1PEZA 4MXWL 3H9SB 2JJTA 4IRJA 4M7KH 4XMPH 5D2LF 5E08L 1MPAH 3D0VB 1CD0A 4I9WE 1ZA3B 1Q9LB 3STBA 5IWLA 3MCKA 4ETQB 1RZIB 1NGPH 2NY2D 1CS6A 1E4WL 1EEQA 3MLTB 1XF4A 2XA8L 3V5HA 2GFBB 4BZ1L 5C2BH 4GRWH 4JFXB 1OARH 1MCNA 3QO0A 3IF1A 2P8MA 4LSRL 1AXIB 4QCIB 4KJYB 4UQ3A 3UAJD 2ZZUT 3FT3B 1ROWA 2K7QA 2IBGA 4KDTA 4P4KD 2JK5B 2YBRA 4WWKA 1U91A 1TJGH 2VZOA 1QPPA 5L0QB 4F9LC 3NFSL 4LSUH 1GL4B 5EOCH 2AQ3A 4FABH 3S5LA 1NCBL 1ZSDB 2WP3O 1HSBB 4XCYB 5T1MB 4JFEB 3QJFB 3O8XB 3O3DA 4R7DA 4Y5XA 1U36A 3FCTA 5BQ7A 1R3HB 4MD5B 4ZPVB 3EIFA 3B3IA 3DRQA 4ZQKA 4MVBC 4NOFA 1CG9B 4BFBD 4F33A 3JV6A 4ETQA 5CMAB 1DFBH 2R2EB 1I1YA 5J12C 5SWQA 1U8KA 1XFPA 1KXTB 1J1OH 4M8QA 1C16A 1HCVA 1TVHB 2ADGB 3OHXA 4ODVH 1MY7A 2ZOLA 3E2HC 1TMCA 3LV3A 3ARPA 1J0JA 1ED3B 2EE6A 5E2TL 4DEPC 5E95B 3VJ6A 4Z77A 2Z8VC 3PV6B 3MLUL 4GKOA 5D7IF 3QFDA 4RGNC 2KL6A 5ISZB 4XMLL 3S88L 1R3JA 1B0WA 4K3GA 3O3BA 3T2NL 3UPRA 8FABA 4ZO6A 4K07A 3BFOA 4E0RA 3IJSB 4FG6C 4PG2A 1PQZA 2R9HC 3BP7B 3TCLA 4Z9KB 3O2WH 1AXSA 4ODUA 3HR5B 3L3GB 4P46D 2MQ3A 4NN6C 1K8IA 4PDCE 2Y6SC 2ZCLL 2IPUG 2SEBA 1QTYT 2VOTA 4IOFD 4HULB 2HFEA 4GW5B 4UT9H 2OL3B 2Z91A 5IQ9B 4NN5B 4OCYH 3OSKA 3NFNA 1T1YA 4HXAL 1UXWA 5IW1B 3VGEA 5DF0A 1RFDL 5SWSB 3AY4C 2P8PA 3NACH 2NX5D 2F8XC 3IDGA 1H15B 3FO0H 4WI9A 5E99H 1E4XI 4FABL 4FQIL 4HS8L 3LN5B 3NA9L 2IAMA 2ZUVA 4F15C 1TJGL 1KV3A 5JOPE 3DTXB 4XX1E 5IMMA 2BSED 1JIBA 4LLWA 5GHWH 1DEDA 3RZCC 1TJHH 4OKDA 4WY7L 4NN5C 5KOVC 1I85C 1NGQH 3B9KB 3FMGH 3MRKA 5CEZD 3TF7C 1JJUA 1S9VA 4Q0XH 1LP9B 2F15A 2NY0C 3GGWA 1U8OB 5BOPA 1MLCA 4YWGL 3UYOD 3DUHA 2VAJA 2ED8A 2DKUA 4JY6B 1JYVA 3U1SL 5D1XA 1G0YR 1FGNL 2XWBB 4LCWE 5CJXC 1GOHA 3LQAH 2VXSL 1BQLH 4NQCB 2HFGL 1D9KA 1INQA 2YD1A 4DVRL 4JZJA 3TBVA 3KPRE 1D5MA 1DBBH 1I3GH 2VXUH 2A1WH 1C16B 3S35L 1FYTB 4NQSB 5K93A 2XPGB 4Z7UE 4MXWH 4OGZA 2MQCA 4V1DD 5FYJE 4RAVA 4AEIL 1SYVB 4U1NB 3BZEB 3RDTC 1WBZA 3WIFA 1AC0A 5T5FH 4UOW1 3GMPA 3C9NB 4JO1H 3DO7A 4XVUD 3MACH 3SJVA 3BQUC 3WXWH 3T4YA 2VSCA 3V7AE 4OKVB 4U1SA 5KG9B 1OTTC 4HSQA 4X4ME 2NR6C 5IEHB 1OAKL 2XIDA 1UYWL 1ZT7B 1Y6MR 4Y2OA 1KJ2L 4WWID 1LD9A 2HFFB 1OVZA 3SDCD 4KJYA 1JHKH 1FAIL 5DVNA 1AHWC 3OPZH 3TPKA 1J11A 1G7LA 5DJAA 2OCFD 2APXA 4UIKH 1A47A 2JIXA 2R1XA 3ABZA 4MQXD 3U4AA 1RUPL 1IKFL 1HSBA 4R7NB 4XCYA 1ZGLP 2IH1A 5L2KA 1VFAB 4ZS7L 4HUVB 5LBSL 3MV7B 4F7PB 4WUUD 3Q6FB 3VMNA 5IEKA 5F3HA 3VWKA 4J3TA 4YAQB 1KB5A 5GGSA 3FB7A 5IMLB 4I8DA 3CSBA 4OCNC 1FVCB 1NBYB 2VABB 4RFNB 1MCWM 1YEKH 5HYJA 1T83A 4FZEH 4WFFE 1TETL 3TV3L 3EJZD 4X4MA 1W0YT 5FYKE 4MNQE 3B9KD 3QIBA 5KAQF 1FCGA 1JHLL 3I2CH 4HK3J 5F7FA 5AYQA 3T77A 3K3QA 1J1PH 3MROA 4UDTB 1QPXA 3RUGF 4K3EH 4GRLB 5JUEL 5IEKB 1WUNT 2WZPD 1K5NA 4NQCD 1FHGA 1XF3B 4KQ4H 3SEPA 2YZ1A 4QXGL 1U8QB 4V2BA 4S1QH 4PJ7B 3T1WA 1MJ8L 3C8KB 4IDJL 4JFDB 3OXRA 3F65A 3VRJB 4TYUA 4CMHC 4KHXH 1RURL 2GW5A 5A2LH 1WBZB 3GHBL 3KPLA 2LABA 1FNAA 5HHOB 1W72H 2WK2A 4KK5C 3RAJH 2DBLL 1U8LB 4NHUE 4KI5D 2VIRA 1NBYA 2VABA 3T77B 2FWOB 1AD0B 1V7NL 3NCBB 4ODSL 5BV7C 4JFDE 4ZMAT 3QIBB 1BFVH 5A16A 5DJDA 3G5ZA 1GHFH 3QWQB 3TZVD 3DPBA 3ZDZF 4NO0A 4M6ML 1YY9D 2X4TA 2LE9A 3ME0A 1I8IA 3H3PH 4UDTA 1IM9B 2IH3A 1MLBB 4E42A 1GPOL 3DXAA 4MNQB 5CGTA 3QBTB 2ITCA 5E9DB 1SHMA 3IU3A 5L2KB 1RZKC 5EBMA 1RUAH 3HRZA 5JO5B 4LRIC 4Z76B 1ORQA 2R1XB 3U4BL 4XTRD 5IMLA 3PABB 1KFAL 1QSFA 1MI5D 4PJXB 1JUFA 1G7HA 2FJHB 3FJTA 3MA7B 2EDQA 1RUKH 3HC4H 2CK0L 5C07B 5CZXD 1J8KA 3Q2CA 1MJ7L 1NEUA 2OMBA 3BSZH 2Y5TA 2G5BA 1IMHC 1FC1A 2NYYD 4ZOCA 1HXMB 2AJSL 4DCQB 2E7HA 1F5WA 4XP9H 1RULH 2HH0L 1NMAL 4KKCC 3FN0H 4J6RL 1FSKC 4OZGE 3HE6B 5F6IB 1ONQA 3QWOB 4RQQA 5IMOA 4PJ5B 3CFBB 1ZT7A 5AWNH 5CSZA 5LAXA 3RA7L 1I3VA 4U6YB 1KSRA 3RTQD 5GS0H 2RIKA 3E1F1 3TF7A 2JCCE 3LD8C 1JGUH 2P5EA 4OZHB 5C0AD 2ADIB 3QAZC 4FQXD 5KSAD 3V8CA 4KMTH 1CGXA 4H25A 1KELL 2UWEE 2JE8A 1FSKB 1T22B 3CFEA 4YEEA 1BFOA 5T3XL 3KPQB 1G7PB 3TIEB 5SWQB 3FHQA 3VXSD 3JV4B 4NDMA 1PYWA 1JZ6A 4FQPA 3WIHL 1PKQB 1LO4L 4ODWA 1SY6H 3TYFB 5DQDL 4H0IA 4B5EA 4FFWD 5FAAA 4AIZB 4LLWB 1A1NB 2FJFA 5KSBF 2BVOB 3QQ3A 5IB1A 3T09A 3CSGA 3PV6A 1H5BB 5I74C 3DV6A 1MHEA 5E2UH 4FQCL 1DANT 1JE6A 4JO4H 5DEGB 3GBNL 3HUJF 1AY1L 4TULH 5HDQH 1U3HC 3MRIA 4X4XB 2E7LE 1ZVSA 1MFEL 1KENH 4B50A 1IEBA 1AFVH 5D72L 4M93B 3BP5B 5KZCB 1X5HA 4FQ1L 3WLWC 1A2YB 3IU4H 3JZ7A 4IIQB 4AEEA 4TVSa 4MD0B 2CKBH 5ICYB 4UB0L 4Q6IA 1HHKB 1P84J 2ERJC 3B9AA 5I0ZA 2CLZB 1P4BL 2OJEA 5L6YH 2VZ1A 3L3GA 5I74B 3V5HB 3VFVA 2YWYA 2DWDA 5F1NB 5LG1A 2VR9A 3T0VA 1JRHL 3DX6B 3B4NA 4JN1L 1KCLA 1QSFE 4LEOB 1WSST 4XPBL 1FNSL 3VXRD 3ZT5A 4NQCE 3RWIB 2WUCH 3CDCA 4LCWB 5I1AB 2Y7QA 2MKLC 2CIIA 2FRGP 4PJCA 3VXTB 2A6IB 5DZLA 4ELKA 3WYRA 4LLVB 3OKDB 4KUZH 3O81A 4XVTH 1XGUB 3QWRA 4NP4H 5CJXA 2D7OA 1QR1A 3J8F7 4LSVL 2GJ6A 3MOAL 1NPUA 3T65A 3T3PF 1ZE3C 1KLUA 1CG9A 4HLJA 3ZHKA 1BEYL 2YD2A 1R3HA 4PV9A 2Y7QB 1XH3A 3HZMB 3WHXA 5C0IA 4QEGA 4LEOA 4JPKL 4DGVH 1I1YB 2WWKO 3FQUB 3T0WA 1QFWH 5AZEH 4CN6A 3K8MA 3I50L 4KI1A 3U2SB 3VE0B 3H9SA 1T5XA 2J8UE 3S36H 3ZHDA 2P4AB 3HZKB 5EU7C 3FTGA 2R1WB 2YUZA 4I2XE 4JFOB 5TE7L 1UJTA 1F58H 5I9QC 1N5YH 5KVEH 1HH6A 2PO6B 5J1AA 4I48A 2VAAB 2O26U 3IF1B 5H94A 4GRWE 1SBBA 4HAFA 5KVMC 4K7PY 1CGVA 3HC3H 5FYLD 5FYKL 1CLCA 4D8PA 3SKNB 4PGCB 3O8XA 4ZDHA 5ANMA 1ZSDA 2GY5A 4HC1H 5I9QB 3V0WH 1UXSA 1RVFL 3WHXB 1NAKH 5ALCH 4HMDA 3GIVA 5D93C 4G9FB 3SDDA 3BIKA 3LS5H 3U4EB 5C0CD 5CKGA 5H94B 2VLRE 1YA5A 2OI9B 4YGAB 1GJIA 1SJHA 1KJMB 2HT2D 4EQ2A 1NLBL 1ES0A 4X6CE 4NN7C 1QBMH 4L9LA 4M9OA 1Z5LA 5DHYA 4N0UE 1T1XB 4WFHE 5I1KH 4C58B 2NMSA 2IBBA 3BRGC 4G5ZH 5DWUH 1PSKH 3HS0A 4P2RB 4YGVA 3P0GB 3NH7H 5GS0D 3HMWL 4YNYB 1MI5A 3BISA 5HY9A 1OGAD 2IJ0C 32C2A 2B1AH 4ZO8A 1XGQA 5F7KC 1ZLVH 4M1CD 3ULVF 1DBKH 4MQ7A 4R26H 1JPTH 3BQUB 1INEH 2FB4L 1CDIA 3VG0H 4X6DF 3K2UL 3FZUC 1CU4L 1T2QH 5IR1B 5C08B 1DQTA 2C1OB 3RKPA 5HHQA 1SJXA 3GJFA 4FQHB 5ID0B 4UOJA 5EC2B 3C08L 4Y5YC 1NFDF 5BRZA 5HHNB 5I8OH 3MRFB 3IDMB 2XXMB 1C1EL 5MENE 4YPJA 4C56A 2V5SA 6FABH 2CJUL 5D7JC 4JZNB 3TO2A 2IQ9L 3QUXD 2NY6D 5D96C 1IGMH 1MFNA 3CX5K 2C4XA 2EE9A 3PWUA 4N8CL 3H3BC 4MQSB 1BHGA 4WI8A 4NRXA 4MHHG 5F7UA 1ORQB 2NZ9C 5GGQL 3EYVA 4K94H 3HG1E 2PO6D 2VDRH 1S7XB 3Q6GL 1CICD 4UU9B 3BYYA 2FJHA 1NCWH 3F7QA 3H0TA 1GOGA 2VKWA 2W91A 1NC2D 3DMMC 3NABH 5C0RL 5JNYB 3VW3H 5TH2A 1A3LL 3FQRB 5D4QA 1FDLL 2EIZB 3UJJL 1T20B 4WHYG 1OQXA 1CVSC 5AG8A 5TDPA 3QSKB 3HB3D 5ITFA 5ENWB 2J6EL 3PHOA 4HQQH 3QEGH 4YXKL 1AGCB 5BVPH 4JRYE 3RWCA 1CZ8H 1U3HA 4H1LA 4OD3H 2DDQH 2X4RB 3EYOB 1MCOH 3MGOA 5DDHA 1U3ZA 1VSCA 1EFXD 4OZGF 4Q58C 4B7IA 5BXFA 2N1KA 3TBYA 2Y4SA 2QSCH 3RGVA 5A1AA 5T5NF 2WBWB 2DKMA 1MH5B 2LU4A 5IFJB 2DTSA 2EDXA 5KW9L 4RFOL 1KEGH 5AUMA 5C0BD 4G9DB 2PYFA 3VFNB 5I6XB 1I9IH 1MFBH 4NO2A 3LEYL 2P5ED 3PDOB 4X6CA 4MAYD 3MV8D 4R4BA 2X4NA 4WW2A 5B3JE 4X4ZA 5CWSB 1M05A 1ZHBA 4QKXB 3WFZA 4XCNB 5CBAB 2IFFH 3OGOE 5E5MB 4HFWB 1BQUA 2Q8AH 4HUWA 2FH6A 2F54E 4Z7NF 1AGFB 2J12B 4U0RB 1F3DJ 1MVFA 4E5XB 3KPLB 3MUY1 3GMMA 5IHLB 2MSPA 4KWUA 4OJFL 3RBSA 2OSLA 5BOZG 1JPGB 1MRFL 4OIIH 4Y19B 3OGCA 4OCRH 2YD6A 5IF0B 5HHPB 4BELD 3VRIA 5BVPL 1DN2A 3TT3L 3FAXA 1YEDB 3VDCA 4HPYH 1E28A 2GHWB 5JIHA 5A16B 4XNUL 2EKJA 3SBWC 3IGAB 5B3JF 1NCWL 4OLUH 3D25B 4PYGA 1RHHB 3BXNB 3UAJC 2VDRL 2Q7YB 1YMMD 1FZOB 1A8JH 5BMFH 1DN0A 3L5JA 5GGQH 2XTJD 3LOWA 3VXOA 5BZDB 5HYJB 3U7YH 5HYEA 4LFHG 2YD9A 3DXAB 2FHBA 2LU7A 3TO4B 4GMTH 3HAEB 3UBXB 5DMYA 4IHOB 5I2IB 2JF1A 5A3IC 3N85L 2WP3T 3MRLA 1MWAL 2DI8A 1A1MA 3UZVB 4PJBF 4G6ML 2Y06H 1F3DH 4M7LH 1KIPB 4UOW0 4YR6B 5IJKC 3NPSB 5DQJA 3CX5J 1KOAA 1NFDE 3IFNH 3UTTE 3AAZA 4QGYA 5D8JH 1U8LA 3U30B 5CUSH 4UTAL 4XHJC 4S1DD 4U2YA 4HFUL 5IW6A 4HWEL 1NGYA 3M17B 4XZUB 3HKFA 3D39A 4JGUA 4PREA 4WI3A 3ELAT 2IF7A 3B6SB 3AM8A 4OUOA 2X4NB 4WW2B 2B1AL 4PJGF 1KUMA 1CGUA 5KVFH 4U7KA 1T0PB 1XIWD 2IADB 3C6LA 3U46B 5DWUL 5FV1L 1FL5A 4F7PA 1LEGB 1MFDL 3KNBA 4XP1H 4APQA 4HDIB 4Y4KB 2F19L 3TNMA 3DX7B 1XF5A 3BUYB 3KDMB 3WIFB 4WRLA 5GGRB 5IM7A 2OL3H 1Z3GL 4RWYH 3EYUL 4Z7VA 3IDYB 3WUWG 3I6GB 4Y5XC 5GS1A 4XAWL 2BHUA 2V2TB 3MTRA 2O61B 3NCJL 2UUDH 1AGCA 2XQBL 3QDJA 4P5KB 3L3DA 4PJEA 5FDYA 1MCCA 1KN2H 5TDPB 1IILE 3ILPB 5DHVA 3ZT7A 3ILQD 4TNWF 4QXTB 4OAWA 4HC1L 3H3KA 4L4TD 4U0QB 3CH1A 2AV1A 4AIXA 1CFTA 1HDMB 1KCSH 4JQVA 4ZSOB 1M6OB 4JRYD 1I9RH 5IB1B 1IVLA 3RY4A 1FG9C 2FJFB 5E2VH 1I3RB 5HDBE 3T0ED 3R0MA 3BWAB 1UJ3A 3DGCR 2X41A 1TQCB 1YMMB 2A9MH 2WAHA 1T89A 4YHPA 1UWXK 1J12A 1WGOA 4JDZB 1JRHI 4PRPB 4OZIF 4ZS6C 5TPWH 3TH3T 5FUCE 2OL3A 1ZLSL 5D1ZA 3BP5A 3DBXB 2V2XB 3O41B 2AV1B 4Y19E 3CCHA 2CRZA 5DYOA 3P9WB 1WFNA 1U8MB 5FKAB 1MCKA 3GJFB 4H26B 1GAFL 4HF5H 3SJVD 1MCRA 2BVYA 1FYTD 1BEYH 2HVKA 3O11A 4PUBL 2DTMH 3W11C 1YMME 3MJ6A 5CEXA 1A6AA 4K7PL 4P4KA 5DR5L 3MNWA 2YC1A 4LKXA 1QLFA 1UJ3B 3ULSB 4XVTL 5J3HC 3L3KA 1B3JA 3QULB 2ZJSH 4CUCA 5A43C 1ZT4A 3MRCB 5IB2A 2LTQC 1G9ML 8FABB 4H26A 5BVJA 4RFNC 1QBLL 1CDBA 1J05A 1EH9A 2FIKB 1Z5LB 4F9PC 1XZ0B 2X4SB 3MLXL 1FFOA 2DIAA 4OSUH 3G5XB 5D1ZB 3U36B 3S5LB 5BZWA 2CPCA 1TJIL 1NQBA 2OXGA 1WBXB 1AJ7L 3X3GL 2V2TA 1FORL 1U8MA 4WWKB 1SM3H 3DI2B 2XICA 2SEBB 3QUXC 5DHXB 1SBSL 3CH8A 4ZPVA 3IU4L 4JM4L 1JNNL 1AFVL 1UWEL 5L9DL 2EYRB 4TVPE 1U8KB 3SQOL 2WINB 4U1KA 4JO4L 4N90D 4G3YL 3B3IB 5TDNA 2C3WA 3UTPE 3MCG1 4ZYKB 1RMFH 3WFDH 3IT8D 3MV7D 1I8KB 2WMPA 1P4LA 1I3RA 2OR9H 2EKSA 1JPFB 1T2JA 2J2ZA 4UINL 2E3VA 4X98A 3D2UB 2FX8H 2EDRA 4YIQA 2XOTA 4TUKH 1LO4H 3P2TA 2EXWC 2EH8L 4U05A 4JM2F 1RZKL 4P4RA 4JREB 3G9VA 2I5YH 3F12B 3ULUL 4OTXL 1V05A 3D85B 3RP1A 2DQIL 3MLTA 2AQ1A 1NCAH 4HIIA 1J8HA 4Z76A 1QQDA 1HSAA 4NQDE 5DK2A 3DSFL 3RVTC 2AJYL 1XH3B 5C3LD 3QIUB 1P1ZB 4LGRB 5TQ2H 1VENA 2GFBA 5L8KB 1L8JA 3QXWA 1DBAL 3CC5B 4BUGA 1SVCP 1G7IB 3KPSE 3WKNA 4YHIA 5M95B 3BPOB 2VLKE 2P5WD 3MLRL 4IEFB 4PJDB 2GSIB 1CE1L 1ZOXA 2X2YA 4UV7L 2QEJA 1HHJB 2NY5L 2FBJH 2VDOH 5ERWA 1K8DA 3NIGF 4XWOD 3CDFA 1A6PA 4YDJB 3ARZA 2X4PA 1A4KB 3CVIH 5D96B 5TE6H 5F7MC 4CU6A 5JOEA 3VFVB 1CR9L 2OTUB 2RFXA 4LGSB 1RUKL 2ITDA 4XGZA 1ZHLA 4G8FA 1JPST 4F7TA 4HKZB 3ARBB 4PRIE 2CLRB 2X4QA 4X7SL 4U0RC 5E03A 1CE6B 4XVJL 2IANA 2EH7L 1XIWA 4FMKA 3U4BH 4U7SA 4IRJB 4QOKA 1BWMA 3T4AB 2MFNA 1C5CL 1WAAA 2NXYC 4MNQD 1MCIA 3AS2A 1MCDA 3VGGA 3TNNB 4OF5A 1SMAA 5GGTL 4OQTH 5D2NB 1LVEA 3QAZB 3V5DA 4QRRB 2AGJL 1NBZA 4FA8A 2VL5B 1KYOJ 3MODL 4U1GB 1YNLL 3MRPB 3TZVA 1AO7A 5MERB 2ILLA 1L9MA 5C07D 1F45A 3FQRA 4LSPL 4HKJA 1P6FA 4NQDA 3AS3A 1XR9A 4XPAL 5A40E 4X6FB 3P4NA 2XN9E 4KVCH 3HE7D 1IC1A 3ARGD 1W0VA 3NAAL 4CJ0A 1JWMB 3GB7B 1MEXL 4GS7B 4R2GB 1AC6A 5D1QD 3ARED 4OQTA 3RHWF 5FFLA 3BHBA 5E8NA 5LCVL 2DQCL 2Y36L 5IVXB 2OZ4L 5EO0A 5JUEH 3QPXH 5LGHH 4LDOB 3DLQR 1U3HD 2NCMA 2RBLA 1FVDA 3KPOA 4QRPD 2MCPH 4XCNA 5J3HD 2VTFA 5KSAB 4P2RE 5MEQA 1JHLH 4WHYH 3D3VB 1OCWL 4DVBA 3HI5H 1YEFL 4K3DL 5FUZH 4X6CB 3TBSA 4MVBD 1NAML 2WBJC 1V3MA 2DYPA 5F89A 1L4IA 3SGKC 4UUJB 2WUBL 1KLFA 1SEBB 1NGZA 2IC2A 2YWZA 4LF3A 3BZEA 3H7BB 1UM5L 4KJWD 3BO8A 3PHOB 1AR1C 4XB7A 1UZ8A 4CVZA 5B8CB 5GJSH 1C7TA 5D71L 2IALB 3V6OE 3R8QA 4M93C 5DD5H 4ZS7H 1RZJH 1T1XA 5TH2B 4X7SH 3QUXA 5JDSA 4GLRH 4ODHH 3L6FA 3GFUA 4FQHA 3GJEA 3WIIL 3O45A 3QJHB 5D9SB 3W2DL 3P11H 5KZCD 2EYTA 2HFTA 4CKVX 3EBAA 5FOBA 5I19L 3CVIL 1LP9A 4L4JA 1DQLH 5TE6L 1FAIH 3ZE2E 5L88L 4LRIA 1IE5A 4NZTH 1NFIA 4FQ2L 1HZHH 1INDH 2C5DC 4UV7H 1UYWH 3WNLA 2BVEA 4XWGL 1L0YA 5C09D 2IAMC 4P2YA 3MBED 3IDMA 4OFPA 4LCWD 4KAQL 2XKSA 4AL8L 3ES6B 2PXYA 3L5HA 3GK8L 2OI9A 4N0CD 5DA4A 2AJYH 4EN3A 3EFDL 1XR9B 3TH4T 1T04B 3CPLB 4CN4A 3DSFH 2YEZB 5H2BB 1YPZB 4L9LB 1EIBA 4P2QA 4LLYA 5ESAB 2NY7H 4ODXB 4RMUA 4Z8FH 2A1WL 1ADQL 1A14H 3OKEA 4N0YL 4XP4H 1L7IH 3WFHB 2R56H 1PX4A 2CLRA 1U41A 2YRZA 5FOJA 1RV6X 4HS3A 5CP7B 3OJDA 3S34H 3HTLX 2F9BT 2DL9A 4MD5A 3BKCH 1UENA 3RIFK 4FFYH 3KPPA 2ZUTA 3PV7A 1UJ3C 1FE8L 4R7DB 1T83C 1KEML 4Y5XB 5ETUA 4PGJA 3FFCE 3EOTL 3VXUE 3KYMA 5FB8B 1RMFL 1OTUC 3FMGL 3HE7C 3SO3C 3ZL4H 3E3QA 3WUWA 3T08A 3ALWA 1D6EA 1U58A 3V4VL 1IGTB 2Z9TA 3SQOH 5D6CB 2VZUA 5E9DE 5IK3A 1UWEH 2GT9B 3CDGA 5DI8B 4YIQB 1FNGB 2OLDA 5E99L 4RA0C 1E4JA 1SBSH 1G6RH 3K1DA 5CINL 4Y2DD 2E7LC 5CJ8A 1AJ7H 3D69B 4PJBE 4OCYL 1G9MC 1MCQA 4PRAB 2CDFB 5DT1L 3T1FA 1XCQB 1PVHA 3AU1B 3KYNB 3B8SA 4UI2A 5E4EC 1VGKA 1DUZB 2H32A 2X10A 4K9EL 4AG4H 1H9VA 5ICYA 4NN7B 4OGAC 4Z7QE 1FO0A 3G6JB 3QQ9C 2GAZB 1QBLH 4GKZA 2E9IA 5I8CA 2D9QB 5KBNC 1S3KH 3EO9L 1KCUL 1D6EB 1U58B 1PG7W 3QXAA 2YSSB 4XNQB 4QF1B 1S7TA 2PN5A 5H8DA 1HHIB 3EHBC 1XGTA 1LDPL 1AQKL 2AJXH 1FZJA 3UTSA 4PTUB 3LQMA 4TOYL 3D18A 1TCRA 43CAB 1CIUA 2A6KB 4ELKB 1OWRM 3RZWA 4XX1G 2CDFA 2VUOA 3TYFA 4ZYKA 4XVUC 1G6RA 1CDGA 3O6FD 2CIKB 4W6YB 3WLBB 2J3SA 3JV4A 4NDMB 1R0AL 4P3WA 4P2QE 4HJ0C 5FGBA 2DQJH 4Z78A 4XHQA 4O2FA 1J1OL 1JTPA 3IDUA 3RIFF 4GRLD 3T0BA 4JZOA 5C8JA 1RZ7L 1DQDL 3CZFA 4NM8H 1A6AB 4Y4FA 2P44B 3MFFA 5KVDL 1RSFA 4DOHB 2EICA 1ZANH 2MMXA 3LS4L 2J6EA 3QEHB 4HUUB 1YNKH 3WSQL 4I4WA 1XZ0A 1ZVSB 1JL8A 3MLZL 3QUXB 5JDSB 4LVOC 5HHVL 2EIDA 1CICA 4M6NL 3IDNB 3IJYA 4K71C 5T3XE 2P48B 1HHKA 2JCCF 3AREC 2HJFA 4NQXB 4CJ1A 3SO5A 1NFIB 2CMRL 1SJEA 4I1NB 4YHPB 4I5BA 4HK0B 5F96H 5CD5D 3L7EB 4OI9A 4WI5A 4OIAA 5IB3B 4HKBA 5MHSD 4KK9C 3CSYB 1EHAA 3NCJH 5E5RB 3BH8A 2Q76A 5DFTA 4LIQL 3EYUH 2X05A 3I6KB 5I1GH 1F6AB 5FDWB 5E8DL 4QTHA 5HGDB 4L3CB 3VD9A 4WEMB 1EGJA 4DZ8B 5B38G 4H25B 4NQTA 3B2VL 3CCHB 4XP1L 1T21A 3DUSB 3PABA 4XP4L 3ZTNH 3H9HB 1YC7A 4ODWB 2PTTB 4RZCA 4N1CA 1NDMA 3VD7A 4PRNA 2DQFA 1P2CB 3BHBB 4NO0D 2ENYA 5IT2L 3FFCB 3EO0A 3AREA 4AT6A 1S7VA 2BERA 4I3SH 4X83A 1HXMA 3MNWB 4IMKA 4N9GA 1BD2D 5FA3A 3LZFL 4HV8A 4AL8H 4JE4B 1LO2H 5DJYA 1M6OA 5AZ2L 5IBTH 3ALXA 5T5NG 4JQXA 1A64A 5E6IA 5JPNA 3IKCB 2ORBH 1HOCB 2VLJB 1INDL 1QLRA 5IJKA 1EV2E 3KLAA 4FQ2H 4MS8C 3QEQB 5JLZB 4PJCF 1S9YA 4PJ9B 4NKIH 1DQLL 4LPYA 4ZAKA 1I1AC 1TPXB 2XWTA 2ARJB 4Q6YA 2PW2B 4YXLH 1BOGB 1HKLL 4OLWH 3H7BA 1UM4H 3BPNB 4D9QE 4M43L 1CD1A 2MWCA 3W2DH 3HPLA 3AROA 3L3OB 3Q5OA 5DS8B 1LNUA 4TRPH 4Z95L 5C0AB 4HWZA 4JFFB 1YJDL 1I7UA 2YMXL 1HILB 2YPLE 2CKNA 5D1XC 5T3XD 5GJSL 4OCLC 2CRYA 1I1AB 1P7KA 1TPXC 4XNUH 3FT3A 1UM5H 1UM6L 3TBWA 2HKHL 4PY7B 3R06A 3OAZK 3OKOA 4F7TB 2VC2H 3E3QC 4UIMB 3TT3H 2WUBH 1WJ3A 5C0FA 5CIPH 5I15L 5BRZE 4GMSL 2W65A 5E00B 1WAAE 5GSRB 4OCRL 3M1BA 5DJ8A 5AYUL 3QZWA 2YR3A 3EDJA 4G7YL 1K4CB 1OAXH 2GK0B 4C83B 3P4MB 5GGUB 4DZBB 2BNQE 4Y4HB 2APWA 1XR8A 2IG2H 3MUGB 3NPSC 5EZJA 2W59A 5JHDD 4P46A 4JCMA 1UCBH 5EBWA 2R69H 2ADFH 5IJVA 3DV4A 4OD2B 1IM9A 4CVXB 1E6JH 4QXUH 1BVZA 4KJQD 4LHUG 2ZG1A 3A6OA 2NY1B 2D7QA 3WNPA 1CDHA 3QXUA 1PG7H 5I1DB 3MRPA 4F80A 5IIEA 4QRRE 2BDNH 1HINL 4HXBH 5C0BE 2X4PB 3FFDB 4CDGC 1NMCC 3EJJX 2NZIA 1ITCA 5ID1A 2YA1A 3C5SB 2VDMH 1IEHA 4WTWA 2DM4A 1HHJA 1EHLH 5F3HB 1TQCC 3ILQC 2MQ0A 4YHOH 5EOTA 4OLEA 3TA3B 1MJJA 2MOVA 4KDWA 4ZUUB 1HIML 5BW7C 2FGZA 4OD3L 3TVMA 2NY0D 5T3ZL 3CVHL 4M1DL 3RVWD 3IDYC 1CBVL 1M7IB 5DMIH 2BCKA 4AJ0A 1I8KA 4X9IA 5I18L 3OZ9L 1NGXA 5EORH 3GSOA 4KROB 1JZ8A 1FDLH 1Z0NA 5CD3A 4BKLB 2ATPA 1LP9E 5ID1B 5I71B 1QQDB 4BFEA 3T3MF 4MA3B 4JPVL 3SGEH 1Q0YH 1S7QB 1XIWC 1RHFA 1LQVA 1OTUD 3TBWB 4OLVL 5IIEB 4K94L 2BSTA 5IGXH 1MCLA 3L5IA 3QQ4B 3X14A 4P9MH 3SDXF 4F9LA 1AR2A 1FFQA 3LMJL 4U3HA 1G7QB 1DDHB 4UIMA 3SO3B 5E8EB 3FO2A 4M62L 2HTLD 3A6CL 4POZC 5SWSE 5CHNB 2B2XL 2DJSA 2Q1EA 1QHPA 1BWWA 1PJ9A 4QWWD 5KN5A 1IKNC 4EUPH 1U6AH 2BZDA 1ZWIA 1UZ6E 1B9ZA 4MD4B 4WO4D 4EXKA 4X7CC 1ZVYA 1YDPB 2HN7A 3H42H 3MLRH 2NY2B 1FYTA 2QQNH 5DMJB 3TPUB 2R8SH 1I7TA 3N06B 5T1KA 4KHTL 1R5IB 5E4EB 1NCCL 4YE4H 1PGRB 4NQCA 1YYMH 4MAYA 3GO1L 4RAVB 4B7LA 1H3GA 4MJ5B 2VMFA 2Z91B 5IHBA 1BECA 2PCPA 2X9WA 4KKBD 3SJVB 2ZUXA 5C0ND 5JNYA 1FVEA 3BJLA 4GXVH 4PJ8B 4DGYL 1KB9K 4GXUM 2FHFA 2BXYA 3C2SA 3KXFB 1J87A 4G5ZL 2W07A 4X0KB 5LQBH 4OKVA 1UQSA 1OSZA 5FO9A 1IGCH 2CR6A 3DTXA 4NGHL 5BW7A 5CZVH 4LCCB 2Q3ZA 1KBGL 3E3QE 2XWJA 2FX8L 3UJIL 3L9RB 4UINH 3ARGA 4YPGB 5GGVH 1RZJC 3LS5L 1W0WA 4CADA 3OG4B 3WKML 4L3EE 3QWRD 4YHMH 2J8UA 5C08D 4C55A 3PGDA 2LVEA 3C5JB 4RGMB 3BH8B 4F57H 1RVFH 3GGWB 4C56E 5EPMB 1AO7E 3HG1D 3LKPA 5AD0A 4QRTB 5J1TC 1JNNH 3OAYH 2XWBA 4XPGH 5FDWA 43C9B 1JF1A 1F4AA 2UZIH 1R5VB 2BNRB 1ZT4B 1SM3L 1L6ZA 3MRCA 3LN4A 3HC3L 3X3GH 1N6UA 2KPNA 4NRXB 1I9EA 3ULVE 4BZYA 1JNJA 2EE3A 1NC4B 3KS0H 4HKXB 1X6NA 3IDJB 2BNQD 5B4MC 3ZSSA 5LGJA 5EZOL 2AK4A 1OP5H 2NY4D 3UROR 3I50H 5HYQB 1ZLUH 3GMOA 4N9OB 3U9PH 2IPKB 4AIOA 3W9EB 4BH8A 5EH1A 4CW1B 2VXVH 4YHNB 2EYSA 3QG7L 2JB5L 2IFGA 1F4WH 4W81A 2I9TB 2A77L 3O2VL 3VWJB 5HPOA 3VA6A 5IQ9A 4N5UA 1HHGA 3BOVA 1JWUB 5DJCA 4O51A 2F8VA 3KYNA 1MCHA 4LVHB 5SWSD 3QRGH 3L7EA 1TVHA 2ADGA 4Z0BH 1F4WL 4U49A 2GAZA 3QG7H 4KVNL 4LCIL 3KPNB 4PTUA 3I84A 1I7RB 2HWZH 4W70A 1LEGA 1E27B 4QF1A 3RUGE 1NC2A 3DHMA 2P45B 3JTTA 3MXWH 1WZ1L 1Q1JL 4OF6A 5J89A 1Y0LA 4ZFFB 2HLFD 3QO1A 4M02A 4NT6A 1U93A 4P5KA 1R5WB 4NJAH 5ECJE 1S9WA 2WIIB 5IBLD 4XPGL 1NJ9B 1EBAA 3K46A 1A6TA 1HCFX 4X9HA 5I66A 2QJDA 5ELIA 4YFEA 3IAGC 3MA9H 3LQZB 3BZDA 3U30C 3HUJE 2BVQB 5E8PB 1AY1H 3LHPL 3GBNH 4TULL 1FNGA 4F57L 1MQKH 1Q38A 3PP3K 3AFLA 4L1HA 1ULVA 2AJVL 4PJ7F 2IADA 1H3PH 5I1IL 1YPZA 2B39A 4NFCA 3VFWA 4XAWH 5IF0A 4LLMA 4CVWA 2ICCA 1FNEA 1Y0LB 1AI1H 1DLHB 1KBGH 4OIBA 2VSDA 5CZVL 9CGTA 4P2QB 1BIIB 4Y4KC 4ODBD 5LQBL 3LAFA 1LO0H 1RHHA 5T3XH 1Q72H 4NC1E 4JVWA 3ZKXC 1FN4A 4HGWB 4E41E 3ARUA 4PG9A 3RVUC 1CGTA 1UVQA 3PWJB 3H6JA 2CD0A 4PRHE 5I1DA 4FFVC 5DJ0A 4EI5A 3DO3A 5D5MA 4IRZH 3HE7A 3SGDH 3OJDB 4KJPD 4JQIH 2LU3A 4YE4L 3QRFM 4N0FB 1UWGH 1W72A 1HHGB 3R4DA 4O5LL 2VR4A 4K7FA 4IIQA 3LKRA 4Y4HC 4DN3H 1HHHB 2APFA 4L8SA 3IS0X 3SDCC 1T6WA 3WJJC 3C5ZD 2E7MA 3H42L 3FN0L 3OKKB 3P73B 1FJ1A 3U6RA 1NMAH 4R2GD 1RULL 5HGAA 3MJ8A 2EZ0D 2GK0A 5GRUH 2Z35A 1EUUA 3FO9A 3JV5A 5T1KD 2BSSA 1U3HB 4HG4K 3A6CH 3VXUA 5D7JD 1OGTB 1MREL 4L3ED 4QT5B 2M2DA 5KS9B 3DX8A 2NTFB 1PYWB 1R5VA 2BNRA 3PJSB 5FO7B 3UTTD 1MFCH 3PXJA 3TH2T 3JWDC 5KJRL 2RCSL 2RGSA 4G8GD 4HS6A 2V7HA 5AUMB 3CLFH 5ESAA 5C92A 4K3JL 4QRQB 2WWMD 5KTEH 5F9OH 1MCFA 1MH5A 2YEZA 1RUAL 5IFJA 2R29L 4I0PC 3BW9A 4R96B 4UT6L 4X7TA 1F8TL 4HPYL 2V2WB 4PS4H 1YNTB 5DJXA 3BMVA 1KPVA 5HGHA 1A6WL 4AY0A 1QYGH 1WF5A 4MNGB 5JZ7D 4XAKE 1Q94B 2YUWA 2G5RA 4LHUB 5GZNC 3P77A 3H3PL 4J1UA 4NRYB 3SE8L 3RIAK 4Z7OF 4OQ1A 3V52L 3K4ZA 3A67L 4JHBA 2XN9D 3QCUL 1KPRB 4NHCH 3VD3A 4ELME 5HHNA 5EA0L 3QQ9D 4Z7VE 1MRCH 2JJUA 2BDNL 4HXBL 3PXHA 4NQEA 2DBLH 4MNHB 3VCLA 1BMGA 5FA3B 2LAAA 1KIUA 3RWGB 5EDXA 3FB8B 1X7QA 4PB0L 3IDXH 2GSGA 4ACPA 4BQ9A 4WVRA 3VDBA 3QEUB 4OV5A 5IESH 1JVKA 1PAMA 2R69L 4ZXBB 5FO8A 2ENSA 2ZWLT 4Y0GA 3CFJB 5EU6D 4RFOH 1KEGL 1BP3B 3MRDB 4XVSH 4J1UB 3SCMC 1PD6A 1TVBA 1XT5A 3THMH 1ZHKB 4WO4C 2ZPKL 4HGMA 4DCQA 1BJ8A 3PGFL 4R97C 3RU8L 5F7EL 5B4MD 3ZMRA 4MHHI 1CZ8L 5JQ6L 4W68A 4P5TB 1R3IH 3PWVA 1YEKL 4XGZB 5JHDA 1CLYH 5MEQB 2VC2L 5GQBA 1JWSA 4HBCL 2HKHH 2QADB 1BF2A 2IANB 3MQIA 2OS7A 2VL5A 3TT1L 5C0RH 3C5SA 2EEAA 1K3ZA 4MSWB 2I9LA 4GG8B 3VFPA 1MELA 3D39D 4Z7NE 5F88A 4GBXB 4GO6B 2GUOB 3R1GL 4R96A 4TQEL 3TZVB 2W0FA 1QKZL 4M5YL 3K4AA 4JJ5A 3TGXA 1YY8B 3ZE1F 3GNMH 2ITCB 4POYA 4K2UL 1S7RA 4I18C 3S98A 3MUZ1 4M43H 4V3DB 1UM4L 3KG5A 1HKLH 4YXLL 1DBJH 4Y4FB 4LPVA 5D2NE 5FV2A 1GZPB 4Y2DB 1DANU 4JB9H 2PR4L 1Z9LA 1HXYA 4PTTB 4NKDB 4K23L 5DURB 5F21B 1KJ2H 3LKRB 1VFAA 4UT7L 5CFHA 1TQBB 5F7WC 4XCCH 1XGRB 4IOIA 4HKZA 5B39B 1CTOA 4CNIB 4OFVA 1EFXA 1JGVL 1S9XB 3HZMA 1UADC 4W6WB 2RFXB 2YUVA 3D85A 1WV7T 2K7PA 1NCNA 3P73A 1LE9B 4NQDD 4HEME 2CO6B 4NM4L 1G7JA 5CKAA 1HSAB 3HN3A 5E2WL 5DQ9A 2IMNA 2FATH 4LDEB 4LFHD 3HMXA 5ISZE 3FT4B 2R1WA 4JFOA 4K7PX 4YLQT 2E6QA 4LK4A 1A02N 3HZKA 2BRRH 3VXME 1T0NA 1KTKE 1LO5B 3DWTA 3NH7L 3KGRA 2CXGA 2GEEA 4TVPD 3F58H 3GHEH 4C57C 4GAJH 4KK6D 1I3GL 2D4DA 2VXUL 4H0GA 4ODTL 4RMVA 5C08E 3P3YA 2F5BH 3QDHA 3SCMA 1YEIH 4RMSA 1FPTL 4ZUWB 3IDJA 4OM0H 5EU6B 2VXSH 4LVHC 3ZHLA 1KJ2A 1FGNH 2FJGB 1T7WA 5CZXC 3WE6A 3U1SH 4KFZC 2OJEB 1BFTA 5I1GL 2GIYA 2R2BA 4XCEB 2VLRD 5E00A 4OCWL 3DROB 4QY8A 4ORGA 4Q0XL 2XQYG 5C0FB 1IAII 4LVOB 3LB6C 3WXVL 3VXRB 2BY0A 4ENEC 4X7FC 2WY3A 1NAKL 4WFHD 1D5MB 1KC5L 4P48A 5JOFB 3MV11 3G6DL 4FQJH 2XKNB 3VXTA 3U7AA 4QLRA 1CT8B 5EUKB 5EWIL 2H6PB 3EOYG 4FQLH 5TDNB 1OAQL 4LAQH 2WQ8A 4M6NH 4FQIH 4XAKD 4IRSB 4EDXA 4D0CB 3QG6A 4WW2F 2W9DL 3HNVH 2EKSB 3QQ3B 1MNUH 4S1DC 4G8EA 3U0TA 2QLVB 3WSQH 4QYOB 4AIZA 4JRXA 3I3EA 1FL3B 3OKLA 4UT9L 3BD5A 5L7XL 1VACB 1U42A 3U79A 3QUML 4PJIB 4NM8L 2A83B 3ZKQD 1DQDH 3ARBD 4KKLD 3HPJB 4WV1A 1PW3A 5ITBL 1RIVH 2YPLA 5DJZA 4L4VE 1H15A 4UQ2A 4TSCL 2P8PB 1ODAA 3BPNC 2XXCB 5DEFB 4OM1L 5LJYH 3WEXB 3UEZA 4BQ6A 4XMLH 3OQ3B 4KV5E 3QUZB 5F1NA 2P7TA 2C26A 1AQKH 5GISL 4M3KB 5F1IB 2YPLB 3GDBA 5CJBA 4NP4L 4MAYC 3ZTJH 2A6DA 2DRUA 2AEPH 4L8BA 5E2TH 3EO9H 1S3KL 4GG6A 1Y6KR 2PYEB 3VG9C 2V17H 2DQGL 4ODVL 5A2JH 4U31A 5D7JA 3CH1B 1NUGA 1CGSH 4JZJB 1WIPA 4RWHA 1FZKA 3VFRB 1JRHH 3C6LD 5K9JL 1D9KB 2VLJD 3LQAC 4G9FE 4LHQB 1EZVX 4TPRL 4JPWL 1BD2E 1V3KA 2C9AA 1P4BH 4WUUA 2NW3A 3ARGB 3K2MC 3CZFB 4OZGA 2BVUA 1YPZF 1HYSD 5IFHL 4P2RD 1MFEH 3CMOL 3MXVH 2PYEA 1IEAA 4POUB 3V95A 3HAEH 1LMKA 3V4VH 5K59F 3KNBB 1O0VA 1YEJH 4ALAL 4MD4A 1C5DB 3KPRD 3LN5A 4RISL 1NGZB 5C7XH 2B5IB 2HYMA 3KPMB 3RWEA 4BFIB 4D9RD 1F4XL 4G8EB 1UXWB 3U0TB 5IW1A 4HLZH 1FE8H 2Y5TB 4Q6IC 3TVMB 3P0YL 1XGTB 5GGRY 1MJJB 2GJJA 1N64L 5FHAH 5EBLB 3VFRA 4MJID 2VQ1B 2R56L 4YDLC 3IVKB 2VYRE 5GGRA 4N0YH 1ADQH 2XWJB 1GRWA 3DECA 4IMLB 5GJTL 2NY7L 1WCBA 3GKWL 3RJDA 4K94C 1PZ5A 2N4IA 2CDGA 1UQSB 4LRNL 3H7LA 5HHOA 5T1DH 4Y4HD 3N1PC 3LKQA 3JWDL 3G5YA 3MJ9H 4PJDE 1Q9WA 1V7MH 2Z4QA 2PTUA 3O6LH 4QXWA 3HAEA 4WHDA 5EU6A 4MWFA 5C0CB 1C08A 3BEVA 3JTSB 4URTB 4CU8A 3VXNA 5GXBB 4MAUL 3QDGE 4LSQL 3D1MC 4XWGH 1F4YL 5DRZB 3BGMA 1J0KA 3JWOL 3QUZD 1AXTL 3TIDA 3IFPB 2X7LB 3K0WA 4NZTL 3RL2B 1K2DA 3JV0A 3B6SA 3PNWA 3HRZB 1F13A 2R2EA 5DD0L 2E7LA 4OGYH 1T2XA 2YD4A 1U95B 3RPIB 3WFCL 1IGYB 4H5SA 2VDKL 4APQB 4ZNCD 4UILL 1RJLB 2OJZL 4ISVB 3CFCH 5DLML 4ODXA 5I71C 3WLWD 4XT1C 2UWEF 3UTOA 1T0MA 1GZPA 3NCFB 3TJEL 5DJDB 5HSFA 3QXTA 1FGVH 2ED9A 1KIRB 3S3SA 3ARVA 2R1YA 1TNMA 4EUPB 4TTDC 4I3GA 3TJHC 2QQQA 4Q97A 4AH2A 1EO8H 3WFEH 2FX9H 1QHOA 1JPSL 5CBAA 5F7HA 4LMQE 4RMTA 3AAZB 5DRWA 3VMPA 1EMTL 3RHWK 1VPOL 3PQYE 4GBXC 4OLYL 1UEYA 4LQFL 1KB5B 2BOCA 2HRLA 1ZMYA 5IROC 3RWDA 2ICWJ 2OR7A 4IJ3C 1ZV5A 2Q3AA 3QCTH 1XR8B 1YQVH 5M94B 3U0PB 4Y19D 3RAJL 1MSPA 3T4YB 2FX7L 3GHBH 4Z7VF 3AB0C 5BXFB 5DDHB 2AS5M 3BP4A 1D5IH 2Z4QB 4BZ2L 1JP5A 1RURH 3QZWG 3HLAA 5DUBB 1IC7L 2PXYB 3KJ6L 3VXPA 3KPSD 4X6EA 2A2QT 4KQ4L 3QCTL 5GSVB 3BXNA 1CL7H 5DK0A 4FXGA 2HFFA 1NAMA 4JG1H 3VCLB 1X5FA 4D2NA 1IL1A 4LSPH 5INCA 4LQFH 4OV5B 5D7IE 1VGEH 1J1PL 5I76A 2EE2A 4HWBL 4Y8DC 4YC2B 1ZHBB 3LB6D 1JGEB 4HWBA 4YXHH 1TFHA 4R4NC 4Y2DA 1JNHA 2ZUUA 1NFKA 1KT2A 1QLEL 2YPVL 1DE4A 1YNLH 4JGMA 4KXZH 4WENB 1IC5H 4PJ7E 1N59A 4KI5F 4OQTL 2ZUYA 4Y16A 3FRUB 2Z31C 4OZIB 4I2XA 4Z7UA 1BOYA 3PJSA 3TJEH 1P2CA 2DICA 4HJJH 4RMRA 4XPFL 3TCXA 2NY3B 4GQPH 1C5CH 3FRPG 4X5WB 4UTBH 5DJXB 3TYGH 5I1LB 1J8HD 2WIMA 1ORSA 1U92B 2MCG1 3WJLA 3CFCL 3V6ZB 1IKFH 1N26A 2J8UF 4I77H 1CF8H 1KPVB 3P4NB 2B4CH 2DM7A 3QEQA 4JY6A 3C6LC 4CGTA 4MJIE 4G80B 4WTZA 1P7QA 4WFGD 3E8UH 1KLGA 2BNRD 2NTSP 2O5XH 4CDHA 3T0XA 1JGEA 2C3HA 1XMWA 3W39A 3GSQA 1TTFA 5CLWA 3NTCH 4PJ9C 4L8SB 4I5BB 4JM2B 3WD5L 3OR6A 4HT1H 1DUYB 2NY5H 3DXAE 4O02H 3MOBH 1GGTA 1OAKH 4QNPF 2A6DB 4PJXE 5HGAB 4WW1A 3HCVB 3MR9B 4WUKH 2Y07H 4KI5C 5SWSA 4YBLC 3T3PE 1TCRB 4RFEB 5HYJD 1JGLH 5CEXB 3BZ4B 5DMGD 2XNAB 4ZNEA 3INUH 1A7PH 4DK6A 5IR1A 1UCTA 1JTOA 3I6KA 1MVUB 4LRNH 3I02B 1Y18B 3EYFA 1UFUA 4M4PA 1J7VR 1S7VB 3BIAX 5MHSE 2J4WL 3S35H 2O5YH 3VFSB 4D0BA 2E6PA 4LVNC 3MZTA 5FO7A 3ULUH 4EJ1C 4F9PA 1DBBL 1FN4B 1CDYA 5I17B 4PRNB 5FHAL 3WCYA 1GZQA 4YX2H 3CU1A 1RJYB 2DAVA 4LNRB 4TUJA 4JKPL 1ACYH 1Q94A 1BD2B 4WFED 3QEHA 5HGHB 1GC1H 4L3EA 2ZKHL 5EUOF 4WY7H 1VEOA 2XYCA 2Z8SA 1JYXA 1A6TB 4HGKC 5DC9B 1FFPA 5D7KE 5D6DC 4PRDB 3KLHD 3QHZL 3CMOH 1UKTA 4A2LA 1D9KC 3MFGB 4HK0A 3VE0A 4YHYB 1WIUA 1XGPA 2R0LH 1IFHL 5HHMA 1I7ZA 3FO0L 4R6UA 1S7SB 3LY6A 1I8MB 3QDJB 1T7VA 4G6KH 4E0RB 1FORH 4P49A 2BXZA 4WEBH 3DRQB 2GJZA 5DD6B 4U1LB 5HPMA 3O3DB 3ZKMC 4WFGE 5DUPL 3GI8L 2ZCLH 1CGSL 4QHKJ 4D0CA 4I48B 3QIBD 4JFFD 2QKIA 5A3ID 2G75B 5CS7A 4DK3A 3QUYB 5EUKA 4TNWK 2VH5L 3SKNA 5INDB 3VFGH 3BH9A 2EDFA 1W2KT 3DMMD 3OHXB 4H8WH 4J8RB 5EZIL 2X89A 2I24N 1ZGLB 4CVUA 1RIUH 1A4JB 1BX2B 4L8CA 1DSFH 1DVFD 3AXLA 3NGBB 4HF5L 1F11A 4X5LA 2E9BA 4LCWA 5CILL 2A74A 4ZUWA 5D7LE 2FEEI 1CDCA 3U0WH 3SDCA 3LPFA 1A7RH 2BC4A 3PL6B 1KGCD 4U1LA 3AGVA 3WIHA 5FECA 4M3JA 2JK5A 2YBRB 3DYPA 3MNZA 3WS6C 1EJ6A 3D0LB 2C3VB 1MAMH 1JZ2A 43C9A 2RHEA 3BN3B 2PO6A 2UUDK 4JRWA 4UAOC 4YQXL 5IVXE 1S7RB 5GZND 2W9DH 1IQDB 3AU1A 1FC2D 5ADPL 1HH9A 3RY6C 1J8HE 3C5JA 4L4VB 3DRTB 3D3VE 5EWIH 2AXFB 4L3EB 3ZKND 4MD0A 5DFVD 3VH8A 3W5NA 3OR6B 3MLVL 2DWDB 4DAGH 1NJ9A 1AP2B 3KJ4C 5T1LA 1DLFL 4OI8A 5K59E 1K3IA 4OFIA 4EKXA 2R23A 3ULVH 3L5WA 3RJQB 1OARL 1WBXA 1NUNB 5DUML 4JFEE 4GW1B 4NCC2 4ZFGL 5FIEA 5HHMB 1T4KB 4KUCF 2H45A 4HUKB 4XBGA 4CW1A 2F19H 4TSBH 2I07A 4ONHB 4KROD 3X3FH 4GAJL 1MFDH 1U2CA 4ZTOL 1VFOA 3HC0B 5GZOD 4N1HB 4LCCA 5EULV 2R0ZL 2R4SH 3MV9E 3KYKL 3SDAA 4YPGA 2Y23A 4XPTH 3O3EA 3PWPE 2W0LA 4PJ5A 1W0VB 4QHLA 3QUYD 1IBGL 2VDQH 4YFLF 3PG2A 2P7TB 3N9GL 2P49B 1EJOL 4O51B 2CQVA 2VZSA 4NCC1 2FZ3B 3LH2H 3TN0C 4PJFA 4HFUH 5C6TH 2P43B 5CUSL 1CLOL 1IAIL 1JNHB 3L5XH 3BMWA 2ZCKH 1JGVH 3OV6A 4QRTA 1H3UA 3GSRA 4GKSB 4BK4A 1DVFB 4NO3A 2YD5A 4MQTB 1F90H 1I7TB 1A6UL 1QSFB 5DO2C 4KZEH 2DWEA 4UT7H 4K23H 3O41A 1WIOA 3DBXA 2Z92A 3GSWA 3BESR 1DBMH 3AB0B 4MJ5A 5B8CA 4ZXBD 4YDKL 2AEQH 4JKKA 2MHAA 1ZHNB 2R9HD 2PXYC 1R5IA 1REIA 1G6VK 2CK2A 4PJCE 3WJJA 3D9AH 2XG4A 5FCSH 4LF3B 3P9LA 4QRSA 3EDEA 1VB9A 3GNML 3BDXA 4IOFC 4AEHH 1YN7A 4APQC 4MA7H 2ATPB 4LMQI 3STZA 3KXFA 2P5WB 3GJEB 1OB1B 3CK0L 3IRPX 4NSKB 4UU9A 4HKJB 2V7NA 4JGJA 1A9BA 4R3SA 1T5WB 2L7JA 4NCDA 5IP4A 1EEYA 1HEZA 2MJWA 1OM3L 4JO3H 4PJAE 3OJMB 4G80A 2IAND 1A7OL 1LO3L 2P42B 4OBSA 1ZHLB 4OBRA 3RKDD 3EOBA 1IGFH 4XCEA 3G5ZB 1JWMA 1MRFH 3RRQA 5JMRA 3O6ML 2FBOJ 5DFWH 5ACZB 3THML 2C7UB 4NUGL 1YDPA 1QFUL 1RQ5A 1KTDA 4ZFOA 5TGBB 4OZFA 4YO0A 4GRLA 2IPTL 3D3VD 1BIHA 1ZLWH 1EHNA 4M7ZB 3CDYA 4MLIA 5E8OB 3X12B 4KDTC 3F7RA 3V7MA 2YXFA 4PJ7A 2I25N 2P46B 4JN2B 4XNYL 1U0QA 4HIHA 3MA7A 1VA9A 5EOCJ 1K5NB 5JW4N 5A2IH 5BZDA 4Q2ZA 4O00A 1RZ8B 3A6BL 1T1ZB 3OX8A 1BBDH 5MEOA 2BOCB 3NCMA 1IAOB 2JB6B 1FZOA 3CUPA 3QEQE 1V8HA 3BP4B 1S5HA 1LHZA 3VRJA 5DRWB 3DGGA 1QFUH 1YECH 2FD6L 4KRLB 3F8UB 1F3JA 4JANA 4PRBB 4NUGH 2I26N 1YEHH 3QCUH 3BX7C 4OF8A 3VI3F 4XC3H 4ELMB 1MCOL 1DLHA 1JMXA 1RJLA 4DGIL 4HIXH 2IH3B 3E6HB 3BT2L 2A0LC 2AJZB 4JDTL 4OF3A 3TBTA 4ZOEA 1D3CA 3PDGA 5TJWK 2V5TA 3REWB 4S0SD 5KSUA 4EI6B 1G7QA 3W11D 1QYGL 4HQQL 2GJ6E 4N8VB 1UB6B 2OSLB 1U95A 5C0EB 3QB7C 5D2NC 4PS4L 3SKMA 5HI4C 5GSRA 3QFJB 4JO3L 2R29H 2RJMA 1JBJA 1JNLH 5ANMB 5J8OA 1QFWI 1FVCA 3DGGB 1WK0A 3PIQB 1FIEA 1K4CA 2AERT 3MLPA 2IBZY 4LU5L 1KB9J 2QHLA 4MA7L 1IGIL 1CFVL 4JDVB 4ZAKB 3KR3L 4P3DB 3AMLA 1A4KA 1J1XL 1QRND 2W92A 3QO1B 4ZFFA 3JVGC 1MREH 4DQOL 5KSUB 1LD9B 3VXNB 1NH6A 3X13A 3IFPA 2H32H 4OD2A 3ARBA 1C08B 3NZHL 4Z7WE 5C0CA 1IGML 4OZIE 4NWUH 4NO2B 4MA8L 2ITDB 2JJVA 1EERB 2IBZX 1FO0H 3FN3A 4YDVB 4YDKH 4LCUA 6FABL 3L3JA 1DBML 4KK8C 1HILA 3EOAA 1PKQE 4NBXB 1WWCA 4CBPA 5DK2B 4GS7C 3IS1X 2C7UA 3LQZA 3QULA 3GEWB 1OSPL 4YK4C 4OT1H 1IAIH 4KRMB 3TIDB 4EVNA 2F53B 3QEUA 4AENA 2R0KL 5J6HB 4PJGE 1TENA 2EDDA 1EHXA 2J8HA 3QH3B 5D2LA 3S9DB 4P99A 5LWYL 2G60L 4HIHB 1JFMA 1BBJB 5C0JA 1G7IA 2DQHL 1E4XL 5TQ0L 4CMMA 4NC1C 3G5XA 4M6OL 1E4KC 3FB7B 1S7UB 3C6SB 4R0LA 4EIZC 4PB9H 5J4MA 2A0LD 1ZT1A 4JPIA 5FCUL 2CIIB 3ROOA 3VI4E 1NC2B 1Q9OA 5J0BA 3STZB 4MXVF 4TVPH 2B1HL 4U1KB 1JFQH 3MV01 2X9YA 4TSBL 1RIHL 1KYOK 3T0DA 4PP2B 4NC2B 2CDEB 5KSVA 3N0PB 3MBEB 4ZFGH 4PLNC 3MSPA 3SPVB 2HT4C 3AMKA 5DUMH 2VDNL 2HTLC 2NW3B 2YD8A 4WGVB 5F9WC 1II4E 3VI4F 1QACA 1KTLB 4LCYB 1D9KD 4DAGL 5K9OB 5F97E 3WEXA 1K6QL 3D2UA 3IDNA 3JWOC 1MQKL 1JPFA 2XFXA 1NBVH 3RUGA 4KV5F 1IAKA 1EBPA 3W9EA 4WCYL 1IT9L 1DJSA 3MCLL 1X3DA 3MA9L 4NZRH 4L3CA 4XNZB 1H5BA 1X5GA 3BKYH 5BV7B 4HWZB 3L3DB 4UAOB 3I6LD 4NJAL 1M71B 2Q6WB 5CIPA 2OR8A 4JFZL 4GQ9L 3SPVA 4YQXH 1CXEA 5D7JB 3VXUB 4R90L 4QYOA 3O3EB 4XBPA 4ZSOE 4E9LA 1EFQA 3ARDC 1TTUA 1QRNB 3HE6D 1MJUH 4YDLB 5BZWB 4I13B 1YY9C 1HDMA 4PJ5D 2PTTA 1QEWA 2AV7B 3T3ME 1TTGA 25C8L 1OP5K 3E2HB 1ED3A 1BGXH 1HOCA 3QUMB 4LCIH 3RUGB 5F7DB 5CILH 2BK8A 4MX7A 4WV1B 1CK0H 2CUMA 5FGCB 5JHDE 5K9KA 1DR9A 3OF6A 5DEFA 4N0FA 5D2LB 4PRPA 4N9GB 4AENB 4DKFH 1RIUL 2LQRA 1CK0L 2PETA 3LD8B 5I8CB 1CWVA 1C5BH 5EZIH 3QUZA 3VXSB 3TNMB 4KJWC 3RY6A 1PBYA 2UVFA 2IQAB 2Q8BL 2OBGA 2XN9B 3U9PL 1WITA 3KHOA 2BY2A 2WW8A 1S7TB 4JQXC 4YUEH 4Y1AB 2FEDC 5EZOH 4ELMF 2ZSWA 3ROOB 1T66C 4XPBH 3GI8H 4R2GC 1FIGL 3UBXA 5HXMA 2A6KA 4PJBB 3AXLB 5DRXA 3EJZC 4WU7B 5DZNA 1FZJB 3DXAD 1OP3K 2KDGA 4R90H 4L8DA 4O9HH 2W60B 4LPUA 4GAGL 5L6YL 4P3DA 3DROA 3RL1A 3JV6B 1B6UA 4G6KL 2CKBL 4JZOB 2ZOLB 2P5WE 3OKLB 1OT1A 5C8JB 5E0QA 1IFHH 3LKSA 1SEQL 1UA6H 4FTVD 4M8QB 5D72H 5C86A 5JO5A 1IT9H 5HDQL 2BMKB 2JJWA 4AQ1B 3G5VA 1NBVL 3KYOA 1WTLA 4APQD 5EU5A 5E2UL 1OAZL 4AEFA 4Z5RB 3B9KC 1GC1L 2BY1A 3WDJA 1ZVHA 1I1CA 4JFPB 4HUUA 1WAAF 2IGFH 2DOCA 3D6GA 4P5TD 5IG7A 1HI6B 4PP1D 4F8QA 1U91B 3OKDA 4KI5E 3EW3B 1T0NB 5J6HA 3QQ4A 4FP8L 4KKNA 2QADD 5EFIA 3O4LA 1R3KB 2J4WH 3L3HB 3SHSA 3VXUD 5F88B 1ZA6B 2QKIB 4P46C 3ZDYF 3MNVB 4F2MB 4ZD3H 2GITA 1GSMA 2I9LB 5IVOA 4Y4KD 1BD2A 3CUPB 4O58H 1L0QA 3MV8A 1F00I 1K85A 4HZLA 3DX9B 4ZQKB 4LNRA 3SDYH 3FKUS 3U9UB 2DQHH 3HB3C 3INUL 5JMOC 1JMZA 3ZYIA 5KANG 1RZFH 4XP6L 4WUKL 4M1GH 4KJPC 1ND0B 2NNAA 1OSPH 4P23B 4NKDA 1HXYB 1CYGA 2E5EA 2QSQA 1J0HA 4L4TB 2AP2A 3MLYL 3O9WD 1NANI 4OCMC 5FYJL 2CUIA 3WD5H 3NIFF 1WWWX 4JRYB 1S9XA 3RWIA 2OTWA 3V4PL 3U7WL 3E8UL 3DX6A 4B41A 5BJTA 5JZ7C 1AKJA 1MJ7H 3DHJA 1T80A 2M8XA 1I75A 4LASL 2VO5A 3LMJH 1MIEH 2UYLB 3KXFE 3PWLA 4RAUA 4QRUB 3LRHA 2BNQA 5F1KC 3EO1A 1B0RA 1AKJD 5JW5B 5IHZB 1QUNA 3QJHA 5D9SA 1NCUA 3ARXA 3TYGL 3L6FB 3WFBH 3GIZH 1U8JA 1WFUA 4R0LC 2N7BA 4MCYA 4WI4A 3QI9B 3OB0K 4RIRA 4LP4A 3Q3GB 4OF7A 4FTVB 3BKML 4X8JA 1B2WL 4QHNA 4DVBB 3EGSB 1IC5L 4QRSB 4YJZL 1CD1B 4GUPA 1YY8A 2X1OA 1CBVH 3ULUD 3BT2H 3MRQB 2HLAB 3GMRB 2QQKL 1SEBA 2W0KA 4L4TE 3EYSL 3QUKB 4MLSA 3VWJC 4Y5VA 1B4JH 3R06B 1GHFL 3SGDI 4HJ0D 4L9DA 3X17A 3BZFA 3VXRE 2BOBA 5IEHA 3NZ8A 2L0DA 2XT1B 5H2BA 1CTNA 4NBYB 4JO2L 3BYTA 1W72L 1L9NA 4HAGA 1PG7L 1OAUL 4MYWB 1UC6A 1T03L 3WDIA 2VLRA 1E6JL 1KJ3H 5JTWA 3EOBB 2BSSB 1ZTXL 3G08A 3NIDF 4LOUD 3DUUA 2BNUB 2VXQH 5IVZA 1YQVL 3HZYA 3HE6A 2MHAB 2IPTH 4JHAL 4N0RA 2Z31A 5CWSA 3B2UD 4D3CL 3QIBC 1GGUA 2BP3A 3LEVH 1A1OB 2UZYB 2VLKB 1EMTH 1ES0B 1OAXL 4HS6B 1SJHB 4G7YH 4HIJB 1NEZA 5CHNA 4ZFZB 4GW1A 3D2UD 4NQUA 1A9EA 2N7AA 4D9QD 2ZP0T 1L0XA 4WFFD 2UYLA 3PWLB 3D3VA 3H0TB 3OWEA 2X4RA 3EYOA 1T1WB 4X9GA 4H1LB 5DJ0B 4W6XB 1CGWA 3D85D 2C1PB 1P6AB 1UM6H 5JW5A 3RWCB 4OCSL 1LE5B 4OF0A 5ITFB 4JHWL 3LKOA 4ZG1A 3FHAA 3HC0A 2EDOA 2HRPH 2XY2A 4EXPX 4S1RL 1X4XA 4UNVA 5J9PA 4Y5YB 4XC1L 4I2XB 5DD1H 1U8JB 3S6CA 1QA9B 2VDKH 2Z35B 1N6VA 4JFHD 2XZCH 3EGSA 4UUJA 5I73B 1N0LA 4QHKI 4QTHB 2BCKB 5HGDA 1I4FB 3D9AL 3WHE1 5IKCB 2E27H 3QI9A 4G6JL 1WISA 5E1HB 2NTFA 3GSNH 3SDDB 2AEQL 1JHKL 3TFKC 4NKMB 4L5FL 3KXFD 1XAUA 1N5AB 2XZAH 4F7CB 4NKQB 2WV3A 3RGVD 3IJSA 3GM8A 2OK0L 2X70A 1AD0A 2DQUL 5FGCE 3B9DA 3UYRH 2BFVH 3FO1B 3MGAA 1X5XA 2VLJE 5GS2H 5CEYB 4PG9B 3WXWL 3NCYP 3JWDH 1IBGH 2WLYA 3MJ9L 4KDVA 1PZUB 5T1DL 4F7MB 3TNNA 4XPTL 1WC7B 1HWGB 3BVNA 1T0MB 2DJUA 3PWNB 2H8PB 1NBQA 3O3AB 3GKWH 4G6AD 1L7TL 1HHHA 1AGBB 1IGJA 4ZTOH 5HD8D 1I9JL 5C9JB 4K7FB 4KPHH 2ZUSA 3B2VH 1YYLH 2HJLA 3JTSA 4X98B 35C8H 1QD0A 3GRWL 3BDYH 1R6VA 4XBEH 5D7KD 3LQAL 3SKJH 1Q9WB 5EU3A 3S7GA 5CJQH 3CGTA 2ESVE 2VLKD 1U8IA 1JF6A 1DLFH 1QSEA 3MO1B 1R3LB 1NGQL 5C7XL 1HHIA 5HGBA 4IOSD 2QR0A 4IJ3B 2CLVA 2I9TA 1K2DB 3TWCL 3MLVH 3FTGB 4A6YA 4YHNA 4JFYA 5ILTL 5EB9A 1BIIA 5HYSB 5DRZA 3PP4L 3MV7A 3NA9H 5I8KL 4TUOA 1IZKA 1WFOA 5ADPH 5FB8A 3ARFC 3TO4D 3BN9D 5SV3A 3MLZH 4PD4J 1U8IB 3PP3H 5HVHC 3VFWB 2ZUQB 1M7DA 4MDIA 3KPMA 3RWEB 5F6IC 3RPIA 2JCCA 3GZKA 2ZSWB 4JPWH 1N0XL 2NY2C 3Q48A 4HZLB 4LLDA 4V1DB 2FSEA 5E94A 3UP1A 3RKDC 4RMQA 2D4FA 1RZ7H 1JF1B 1P7QD 2DD8L 5BS0E 4YHLL 3KPQA 5LGKA 1CFQA 1B6DA 3LKPB 1A7RL 4MNGE 3ARFB 5CCKL 1QLRB 3DURB 3U0WL 3MRHA 1MRDL 1T04A 3QUYA 5E6IB 4OFKA 5KSBB 5SWZE 1HQ4B 3F5WA 1QRNA 4NN6B 4HZAA 3BI9X 1P4LB 5DYOB 1LDPH 4KH2A 3MLUH 4PV9B 4Z5RA 5JIPA 4HS3B 1AR1D 3FOMB 1I3UA 5BS0B 1DL7L 1KCUH 5I17A 1FV1B 3KWWB 3PUCA 3VWJA 3VFSA 4D0BB 1DQJA 4YHLH 5ITBH 3WJLC 5F7DA 1QLFB 2F54D 1T3FA 1T21B 3DUSA 3IDGB 3W39B 2CLZA 3PWPD 1DFBL 4RX4D 4K9EH 5DJ2A 1FFPB 4KKAC 3GRWA 3VWJD 5E7FA 3U36A 2DLIA 1VEMA 3O3UN 1MNUL 2ERJB 3QIWD 4NHUB 5CINH 1HKFA 2G9HA 5EUOE 4KUCD 3C60B 4IS6B 2V2XA 1OGAA 3MR9A 5I8KH 3BWAA 1GGIH 4BUHA 5HVWA 4CVZB 3QHZH 1JV5B 3G6DH 4XXCA 5HI4D 5ILTH 5BS0A 4K9EC 4H0HB 4X0KA 3GM0A 3BUTA 3CXDL 3JTCA 1U8HA 3WXVH 1EXUA 2ZKHH 4LSRH 3RPKA 1C8PA 4NHUA 1CD9B 3NCYS 3F6LA 4KROC 4OCWH 4M48L 4I4WB 4P4KB 3CVHA 1M71A 3FOLA 3KAAA 4G6FD 4HDIA 4JKPH 4M9PA 2FNBA 4LSSH 2XTJE 3OL2A 3ULVD 1WTGT 5CJQL 4UDUB 4RBPH 4YX2L 5C07A 3SKJL 4F15B 3CX2A 4XBEL 3QH3A 5DJ2B 35C8L 3GRWH 5C71A 1TZIA 3E2HA 4ODTH 1R24B 3C6SA 4R0LB 1L7IL 1JYNA 4JRXD 4Z8FL 1I9JH 3PGDB 2O5YL 2X09A 1BREA 2EXYD 4M7KL 3F58L 5TF1H 3ILPA 5TDOA 2FWOA 4PJEB 1RK1B 2F58L 4NJ9H 1PX3A 2BRRL 5IVZB 4L1DA 5MENB 3ZKNC 5T1KB 4JM2A 1AE6L 3ZDXE 1PY9A 1QSEE 2MKWA 3DOSA 3BEWA 2D7NA 2KQNA 3O6FC 1ONQB 3QWOA 1A7PL 3FCTB 3HLAB 5DUBA 4PLJD 1T7ZA 5KSVB 3VH8G 4MNQA 3WO3B 1F02I 3G6AA 5F1OB 5GIRB 3I3DA 5HYJE 4ZUUA 2Y1VA 3FN9A 3AS0A 4ZSOA 3UYRL 1ZS8A 3DVGB 3VJ6B 4DFHA 2DQUH 2EZ0C 3ARQA 3L3JB 2WBJA 2LTQB 3LV3B 4LBEB 3SDAC 4PD4K 3MREA 2PR4H 5DQ9B 1OTTD 1X4YA 1P4IL 3GI9H 1G7JB 5I19H 3GSNL 4KGJA 3X14B 4G6JH 3MLSH 1DBJL 2BNRE 4FG6D 4JFXA 4KY1L 3GSOB 5JW3L 5L2KD 1PLGH 2FH8A 4B53A 4I77L 2XZCL 4K2UH 4JG0H 4NZDA 3SCMB 4ODHL 1XF2A 1QKZH 4M5YH 2JJSC 4XC1H 1VFUA 4JAMB 2VZVA 4TQEH 3MLWH 2HRPL 5D71H 4GRWF 4RRPG 3AM8C 1OW0A 1F42A 3O6KL 2AW2A 5HHPA 2NX5B 1B0RB 3VRLE 3MMEB 1RUMH 1CLYL 1S5HB 1J88A 3WO4C 4ORGB 1EX0A 1MIML 4OGAD 5I1CL 3IETA 1I1FA 2OYPA 4KTDL 1N6QH 1WLHA 4OUUA 3RU8H 4YXHL 2AABH 4ZAKD 1RZIA 1M7IA 3OKOB 1AQDB 2MCPL 1XGRA 1VGEL 3LEVL 4PGDA 4BKLA 3D0VA 4G8GB 3DMMA 1NGXB 3HG1A 2BRQA 4PJDA 4D3CH 3W9DA 5FK9A 3LKNB 1CL7L 4FTVE 5HDOA 5LCVH 4KKLC 4W4OC 3BVNB 3HFMH 2VXQL 3TO4A 5HTSA 4JAMA 5HHXL 3FT4A 7FABL 3NAAH 3JUZA 1IC7H 3KJ6H 3MV9B 1T03H 2YA2A 3L1OH 3VU2A 1KB5H 3HMXH 2DMCA 5EZJB 3UJTL 5MENA 2ZUWA 3P4OB 3P0VL 1OAYH 2F53D 3PDDA 4FFZL 4R9HA 3TEUA 1KCGC 4GBXA 4PJAA 3ZLQC 3FB5A 5CSGA 4JN2A 2ID5A 1A7NH 5JLZA 4GG8A 4U7MA 4OZ4B 3UO1H 1YUHB 3UTQB 3SJVE 3GSNA 1T1ZA 4H1LH 4P9HC 4P4RB 3W9DB 2VWEC 3DMMB 1A7BA 2QQKH 1BZ7A 1I7UB 5GS2D 5DA0B 1IM3A 3ARDB 2W9EL 1N2RA 2PYEE 4Y4FD 1EO8L 2VDPL 3VD4A 5TF0A 4M7LT 2C4FU 2F74A 4PJFF 1B2WH 5GGTH 3BKMH 1ZHKA 3EYQD 4X9FA 4UT6H 1EDQA 3VWKC 4HUXB 3DNKA 5KTEL 4Q7DA 4G8GE 2EYRA 3BIBX 3D25A 3CLFL 3UYPA 2HMID 1UZ8B 2X7LA 4WTXA 3BO8B 2VXTL 3QZWB 4A6YL 4P59H 5D7LB 4NO3B 1T1WA 3CXHJ 1J5OH 2F5AH 2P5EE 1K4DA 3WFCH 5JPNB 4WUUB 4YHKL 3QPQD 4KK8D 4PJFE 1JZ5A 2H2SC 5I73C 3UTPD 3PWVB 2W60A 4OGYL 5FEBA 4ONGL 3NBNA 4ORZC 2XRAH 5DD0H 5EU4B 2DWEB 5ESVA 3WS6A 3GSVA 3BN9C 3GUTA 3NZ8B 4WU5B 3V4PH 4YO0B 3GSRB 5J13C 5IOPA 4E5XA 1JK8A 1BOGA 2VKXA 1CVRA 5B3NA 1WBYA 4U1NA 4EDWL 2AK1L 1PQZB 1Z6JT 3MLYH 1CE1H 2DQFB 1OLLA 5IFAL 4PJ9D 5IVXA 4LPXA 5GGTA 5JR1L 5C2UB 5ADOH 4DKEL 3C9NA 1ZGLM 3DUUB 3MGTA 3AREB 3IVKA 1CL7I 2Q20A 4EUPG 4LIQE 2VLRB 1RZFL 4N0CC 3MJ9A 1X5IA 3LSOA 5A2FA 3VFUB 2HT4D 4JQIL 5KG9A 3FQTB 3UCRA 5F9JB 3ZKXB 5TQ2L 4GW5A 1T20A 5HHMD 2AJUL 3ULUE 2CKBA 1W8NA 4XTRC 3GJFK 5JPMB 4QHLB 5E4IA 3HE6C 4UBDC 2EEBA 3BKJL 4D9LH 1M1SA 5IQ7L 2I5YL 4PJFB 2Q76B 5KSAC 1N64H 4Y5VB 3ULSA 3ZE2F 3MRKB 1OGTA 2DLFH 3C60A 1AI1L 2CUHA 3P0YH 4HMEA 2P47B 4NYLB 2OR9L 1F4XH 4O2EB 3W82A 1ZHNA 5I8EA 4MVBA 5IMKB 3TO2B 1IQWL 2FGWH 2VUYA 4WTZG 4RISH 1OAZH 1U8NB 2P1YA 2Z92B 2GQHA 3LHPH 4UZGA 3OAYK 1DVFA 4JFQA 3HR5A 3IJHB 4LSTH 5L0QC 5FGRA 2H1PL 3EFFA 2HTKD 3EYVB 1QSEB 5E1AB 1BM3H 3MFFB 2DS4A 2HFEB 2NYYC 4JY5L 4QY8B 4HIEA 2VDLH 1RUQH 1TJIH 1XGQB 1YMHB 1YMMA 1T3FB 1BAFH 4QOKE 5BQ7B 1A6ZB 2YPLD 4DKDC 3PWJA 1MI5B 4I0PA 1Q1JH 4PGBA 4Y1AE 3MXWL 1UKQA 3C8HA 4U3XA 4HGWA 5DVOA 1ZEAL 4IRSA 4EDXB 2BVPB 4PJEE 1FL5B 2FLRT 4AMKL 2E8YA 1G9MH 4U3CA 3TVMC 4DUXA 2HWZL 2ZJSL 1S7UA 2AEPL 1R5WA 5E6IC 4J4PC 3VFMB 2EIEA 1C5BL 3F62A 1MCBA 3HA0A 1D5BA 3DETD 4MZ2A 6CGTA 4K7PH 4ESKA 1RZGA 5GS1B 5CEYA 4Z7VB 4PYHA 3RX8A 4PUBH 5CGYD 1BQHB 5CP7A 5F70A 2JB5H 1IRAY 1RJCA 1DQQA 2HA1A 2V6HA 4NNPL 5TE4L 3UTSB 1WWAX 4TSCH 1QNZL 4YZFF 1IC4H 2UWEA 4ZUTB 4C4KO 1RIVL 4KMLB 4TSAH 5J11B 5KSBA 4ZNEE 3CXHK 1MJUL 1LK2B 1Z9OA 4FQXB 5D6CA 4IHOA 5TPWL 2OTPA 4WDIB 2Y25A 1JWUA 3O9WC 1EGJL 3RVXD 3QUMH 1I4FA 2A9ML 5IKCA 1GIGL 1IKNA 3VDAA 2EDNA 3T0EE 1R3LA 2DMBA 3BE1H 3CDGB 4JQVC 3VFMA 3X11A 1A5FH 4JKMA 1X4ZA 4WFEE 5HPMB 2H26B 3SOBL 4A6YB 4WO4B 4X7EC 1OAQH 4LAQL 5C07E 3D69A 5B38A 2VISA 2XKUA 3QCVH 2XG5A 3G6JA 3K8KA 3MCLH 5GRWA 2WINA 5D7IB 5FA4B 2BVQA 1KC5H 1DQQB 1FRGH 3RZCB 2GTZB 3WHE0 4HKXA 4KRPC 1TZGL 2O93L 2ARJQ 4JFQB 1JZ4A 4TNVF 4JM2C 1BZ9A 3OTTA 2EDJA 3REWA 5IB4B 3X11B 1C12B 1Z3GH 2DQEL 3E6HA 1ZGLA 3EFFB 3BRFA 1QSED 1SYSB 1FPTH 2EYSB 5KVGL 1H3TA 1RIHH 5HBBA 3QUMA 1B0GA 1MCEA 3MRIB 3FQXA 4X4XA 4YFDB 2QV2A 2IPKA 1JFQL 4PRPE 3HI6H 1JYWA 4TVPL 2FYYA 2R2CA 4QTIL 3NIGE 4X9BA 3S36X 3GHEL 3MRDA 1AGFA 1TITA 5D93B 5FCUH 5FO8B 5F1SA 4GXVL 1P5UA 1LE5A 2A9NH 4U6YA 2EXWD 4M6OH 1AGBA 1D5XA 1IGJB 4P5MB 3EZJB 3O6FB 4KTEL 3GSQB 1OLZA 2WQRA 3RVVD 3HCVA 1D6VH 5LWYH 1RZGB 3G9AB 4HWEH 1GGCL 4R4FL 4KHTH 2R0KH 1D5BB 2QHRL 2R8SL 1MHPH 4PBXA 1WICA 4EZMA 2XNAA 1XGUA 1YEGH 1VEPA 4MB4A 3RVTD 2QL1A 5FKAA 4HH8A 5E5UB 2VE6B 4XCCL 5DGQA 1Y18A 1HYRC 3EYFB 3QNZB 3FRPA 4G6MH 4OI7A 4EN3B 5GZOC 3K74B 1LK3H 4UV4L 1MWAH 4MB5A 1QP1A 1FO0L 3JSSA 3BZ4A 2AI0H 3LRSA 4Z7UB 4LLQA 3NFPB 5EN2A 3FB8A 1GZQB 2ICWI 4TTGA 4PP2A 1CFVH 2R2HA 2CRIA 2HN7B 4JKLA 5BMFL 4NIKB 2NW2B 3DVFA 5GS0C 5FUOL 1Q9OB 2VL4A 3DI3B 5T33H 4OLXH 4OLUL 3OAUH 5DD3H 1OTSD 2CGRH 2F54A 5F89B 3CMGA 2ADIA 3RBGA 3DJ9A 2X89D 1N8ZA 1X9QA 2AXGA 3F6IA 2Z31B 3MV7E 5KS9A 3KHQA 5DMIL 3UC0H 3BGAA 1P9MA 2PXYD 4S10A 4M1DH 5BCAA 4LHUA 4HIXL 5E9DA 4U6VH 1YUHA 5F7EH 1BF8A 3PGFH 5JORA 5I1JH 4G9FD 4YHOL 2ZPKH 1DEEB 4NWTL 4X80L 5FO9B 1EHLL 4MMXC 1CFNA 3BW9B 4X7TB 1DUYA 1OL0A 3ZDYE 1KIQB 3D39E 4D0DA 3QFJE 3O4LD 5JXAL 2F74B 3VFOB 3U46A 5DZOA 3D48R 2CXKA 4P23A 4HG4J 1HINH 1URLA 3HNTH 5CEZE 5GRVK 3OKYA 4PRID 1ZLWK 3TM6A 4MJ4A 2IFFL 1KT2B 5DTFA 15C8H 4PB0H 3O4OC 2AKRA 5F72S 3O6FA 3MYJB 4P2OC 3K4DA 3E0GA 3MBXL 3V6ZA 2Y6SD 3RQ3A 1HYSC 1MRCL 4UNTA 3MJ8B 2NY4C 5JHLH 5EA0H 4NHCL 3S96B 4RGOH 4X6DB 4NWTH 4X80H 2HLFC 4PJGA 1ZK9A 3V52H 5I1JL 3MV9A 3SE8H 4Z6AT 4S1SL 3X13B 2L4OA 3UDWA 1A6WH 4NRZA 2HG5B 3REVB 2J1KA 5LXGL 1AO7B 1WZLA 3UJJH 3J7HA 1F8TH 1OM3H 4C54A 3VW3L 4OZ4A 1CXKA 5F9OL 1FCCA 3OAUL 4YDJA 5DD3L 5CGYC 4K3JH 2GITB 2IAMD 5ERWB 1A3QA 5HYIA 2VLMD 5FM5M 5DJ8B 1IQDA 1S5IH 5AAMA 3HR6A 1QVOA 4MXQD