2AKYA

High-resolution structures of adenylate kinase from yeast ligated with inhibitor ap5a, showing the pathway of phosphoryl transfer
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
218
structure length
218
Chain Sequence
ESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKLGKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of adenylate kinase from yeast ligated with inhibitor Ap5A, showing the pathway of phosphoryl transfer.
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Adenylate kinase
molecule keywords ADENYLATE KINASE
total genus 75
structure length 218
sequence length 218
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2akyA00
3QE0A 3ICEA 1Z8FA 2DYKA 3TH5A 3ZD7A 1E2KA 4E22A 5ANRB 4A2WA 3K09C 3NH6A 1XJ0A 4Q7MB 4V02A 5FI0B 4AIIA 3FFAA 3I3SR 3NDPA 2GBLA 5H68A 5HTKA 1OF1A 3QF4B 4Q1EA 1KNXA 4IFEA 3ZVNA 3ZS8A 2ODWA 1DBSA 1AGRA 5J40A 1KJYA 4PC1A 3ZZTA 2GESA 3P4XA 1FNMA 2G1JA 1X3SA 4BFXA 1WMSA 1RJ9B 5KO2A 4EPYA 1A2BA 5CLQA 1OFTA 5JEEA 3FYHA 2X2FA 4B35A 2ZJ2A 2R8RA 1NJFA 2PEYA 4FXPA 4OI2A 1R0ZA 4L4UA 2HT1A 5KYKA 3H84A 1Z22A 2FU5C 1ETUA 2A30A 2F3TA 2KE5A 3A8TA 1OB5A 4I1UA 1W47A 1FTNA 4EPWA 3TR0A 3PEVA 1N6PA 1R7RA 4S35A 1GRNA 3AF2A 1QHSA 3H2YA 1QHHB 4URVR 1SULA 2BMEA 2CCKA 4K81B 1AIPA 1JXMA 2KJQA 4QGAA 5K8TA 2QP9X 4LYAA 1G18A 1KI4A 1P72A 1RRFA 1J90A 1RPZA 1FW6A 1KO4A 1YZTA 2JAQA 4NP6A 4JLVA 4HB3A 2J1LA 3K0FA 5GJBA 3QBTA 1UEJA 3T5DA 1HYQA 1GUAA 2ZE6A 3ADBA 1RC8A 2XJ9A 3CR8A 2FX3A 4BLQA 2G6BA 4LYHA 2PLFA 4JLPA 3K70D 1P2TA 1LNZA 2OILA 4QG7A 4TYQA 4Q1CA 2XAUA 2D4HA 5FBLB 3DZ8A 3SJBA 2YWGA 4M9XA 3TSWA 1E9RA 1CU1A 4P31A 3IIJA 2ZRFA 3HPRA 3FKQA 4XVRA 2OUKA 4Q18A 1UADA 2CXXA 8OHMA 2OCPA 3SQWA 4X8OA 3KKOA 4JBWA 4HUQA 3TGPA 3W8RA 2G0TA 4YLGA 3TK1A 2VHTA 1I4LD 2H16A 3BORA 4TLCA 4WXPA 1DAEA 2QN6A 1FZQA 3GLIA 5H8WA 1IM2A 1H65A 2C5LA 2IYQA 3TUZC 1DEKA 3EA0A 1G7SA 3C7KA 1F60A 5AUOB 3L8YA 1AS2A 1E0KA 3GMTA 1YR9A 2ZRLA 5SZJA 5SZIA 3KQKA 1G3UA 3R9WA 2V3CC 1E9AA 4OQXA 2NMVA 2IYZA 1G4AE 2J9RA 2XJ4A 1CJMA 3OF5A 1PLJA 4GOXA 3FDIA 5CDFE 2GHIA 1B0UA 2ZJ8A 1J8YF 3KXLA 3SC3A 3RWOA 1E2EA 3GLHB 3ONWA 4GP7A 4IOJA 3QVUA 4PAQA 2ZUDA 3ADKA 5EXTA 2GEVA 4O25A 3K70B 2AR7A 3CRRA 1OFHA 3VR4A 1YE8A 3LH5A 2JLWA 4LJ8A 4ZCIA 3L0PA 1YKSA 4DDUA 1GRQA 1VG1A 3TAHA 4P3YA 4DLRA 3CPEA 3U3RA 2J0SA 4IEIA 2C78A 4G01B 2CK3A 2YOFA 4O2LA 3T34A 2R6DA 121PA 1DOAA 2Y8EA 4Q66C 3M6AA 1OYYA 3GJ5A 4LCBA 2BMFA 5FR1A 5SZKB 5TB5A 3LQRA 5DLQC 1AJEA 1E9DA 1SXJB 2HLDD 3AVQA 3WHKA 2WHXA 2Z83A 4KODA 3RRYA 5A5GA 3CPHA 2QTFA 3PUZA 5FUXA 4BWYA 2A7QA 3U61B 1E2DA 2D2EA 3K0CC 4TTRA 4BLPA 2QM8A 1VG9B 1HT1E 1NLZA 1M1YE 3VR1A 2R62A 2CVFA 1XDBA 3HPQA 2ZJ5A 2CK3D 4RY2A 4QJ3A 1JJ7A 1NMYA 3OIVA 2OV2A 4MGIR 1JR3D 1KAGA 2RGBA 2P6NA 4FWIB 4BLOA 2X8AA 3AF1A 2ZYTX 4CEIA 1HQYE 4RD6A 1WA5A 5EXXA 1RRGA 1ZM2A 4MITA 1NN3A 1QHXA 4RSGA 3UG6A 4KU4A 2WIBA 4R9UC 3EZ9A 3RC3A 1PVOA 4AWXA 5KSZA 4A0FA 4DEXA 4XWKA 4AI6A 1GILA 4Q7KA 5KSYA 1KNQA 4WA7A 2WAXA 3I61A 3RRMA 1M7HA 3K0AA 4TLAA 1H8HD 4BLTA 1JQLB 1XCMA 2ONJA 1F2UB 1NJGA 4KBGA 4PAMA 5JHHB 5DI3B 4BRUA 4EAQA 4I4LA 2GCOB 2IYVA 1Q20A 2JJ1A 2WMNB 1BYUA 3THXB 2W0MA 2OM2A 1EFUA 4TLBA 3BIFA 5E7IA 1KI3A 2QE7D 3TIFA 4HEJA 2D06A 5IDVA 4C2TA 1CEEA 2FPMA 3HU2A 4NYMQ 3A1VA 1JJVA 3QXCA 4OKSA 3IDQA 4BFTA 1NN1A 3A1SA 2OT3B 3NBFA 2XZPA 4ACBA 5FUWA 1E0SA 5HCIA 1DO0A 4XD7D 1W49A 1N25A 2GF0A 1SXJA 4A4DA 3SYNA 4HDCA 4KBFA 2O8DB 1KJWA 1Q0UA 1SVOA 1N6LA 2G3YA 2ZRCA 3NHAA 4LJYA 5AJWA 1R5NA 4Q19A 5FL7A 1X6VA 2VHCA 1OHHA 3WRYC 4PPQA 4A8JB 3MWYW 1GL7A 1R8SA 3NXSA 1GKUB 5GJCA 3DKVA 3K0AB 3M1IA 4GPTA 1TPZA 2ZIAA 3QPUA 1TF2A 3PITA 4B71A 1G21E 2IBMA 1S8FA 4N0EA 1UJ2A 1XWIA 2YC2C 1GITA 2EWWA 2WM9B 4M1YA 1M74A 1S9DA 3OE7A 2WOOA 4FD2A 2BBTA 2V6JA 4TYNA 3U7HB 1IAQA 3HJNA 5L3SB 2PZFA 3QENA 2WWFA 3PJRA 3UATA 1G6HA 3LXRA 3QY0A 1D2EA 3BH7A 1KK1A 1W0JA 1EFTA 4W7SA 1JR3E 1R5BA 4M1TA 5JEDA 4UNNA 3CZQA 1D9ZA 2VSFA 4JT4A 3VMFA 2GZHA 2XNSA 1EFRA 4Q47A 4P0TA 1T6NA 2J3EA 1DTSA 4JS0A 3AV0B 1DAFA 2EFHB 2G77B 2D7CA 4FMBB 2VQSA 1P2VA 2FNAA 1CP2A 4EFNA 5F9HA 4GSYA 3I1FA 1R4AA 2P3SA 1S1MA 4L5BA 5HE8A 2WTUA 2ZRAA 5FBQB 2Q9BA 4A2QA 4A1FA 2VRWA 2J46A 4G0NA 2IXEA 3Q3JB 2O0JA 3SZRA 1LF0A 2HYDA 4MRVA 3CBQA 3R7WA 2WZQA 5FTNA 2H7VA 4ZV4A 2JLZA 2RHDA 3SJAA 1T3HA 1GAJA 3Q8XB 5JCPA 2BEKA 1YZGA 2ZM5A 3TJZA 1UKYA 1OW3B 2BC9A 3MFYA 5GJVC 1XTSA 1R0XA 2JLXA 1NMZA 2GWHA 2QROA 3LD9A 4NHOA 4AYWA 1XNJA 1N6IA 1EFHA 2PJRA 1FFHA 4C7OB 2AXPA 2EFEB 3CWQA 1BH2A 3QKSA 1HT2E 1S4QA 4JMPA 4MRPA 3S1AA 3G0HA 1W2GA 1UBFA 2VP0A 2ZSBA 4OHYA 1XRJA 2PT7A 2JJ8A 1NIPA 4MKGA 3AB3A 3AGPA 3NBZC 1G6OA 1YZLA 4KFTA 2WBLC 1F2TB 1VIAA 4OK6A 4B3CA 5DN6D 2RH5A 1U98A 5HZKA 1K5GA 4TZ6A 4Y0AA 5BXQC 2ATVA 2PZEA 5DIFA 1VKJA 4RKEA 3VNUA 3FGNA 2P6UA 1ZNXA 4US2R 1U9IA 4RZ3A 3SJCA 1W48A 3B2EA 3GCGA 3UG7A 1ZU5A 4ZDWA 3VR6A 1IOZA 2HLDA 2W58A 4M1KA 3LBNA 1OH6A 2V6IA 3AKDA 3LDAA 3UANA 2F1JA 1VG0B 1XCPA 2DFNA 2ODEA 3MLEA 2WV9A 3ZJYA 4NU0A 2IYWA 4TMKA 4OHWA 4HI0E 1GWNA 2OLKA 1ZD8A 4C0AC 3CR7A 3SE0A 5EJEA 3DO6A 3E2IA 5K8IA 4LI0A 1FQKA 3AEZA 4HLQB 1A7JA 1KIMA 1XEXA 5AUQA 4MDEA 3JVUA 2O8BB 1WF3A 4PZYA 3NC0C 1W4RA 4A0RA 4MA4A 1E1RA 1DELA 5A0FA 4O2RA 2FV8A 1XB2A 4Q7JB 2GZDA 1TEXA 4D4MA 1U9IC 4KVGA 2FMXA 1G3RA 5KU1A 3BH0A 2NQ2C 4TQ9A 5KHOC 3L8ZA 4N3NA 1Z28A 4PR0A 3RC8A 1Q1ZA 2H1LA 4C7OA 3WP1B 2IL1A 4GI7A 4TMTA 2OHFA 3P1JA 3DKPA 1XU4A 2YWFA 2IXGA 3AF4A 1JEDA 3GD7A 3CF0A 3NEYA 1UBEA 1DG1G 3SBEA 4TQAA 4QNMA 4V0ME 2O8CA 1OKKD 3A58B 1SVSA 2B92A 3B1VA 5DI9A 1TQ2A 1XCGB 2X2EA 4PC3A 1W1WA 5HR5A 1G16A 3IQXA 3MAAC 1Z2CA 1W0KD 3LX5A 4V0NA 1P60A 3CRMA 2FPKA 2GXAA 2GEDA 2GJ8A 1E2JA 1LW7A 3ZIAD 5EP3A 2W83A 4DRZA 1SKQA 1VYUA 3CUEF 2FOLA 2WWHA 5B30A 3FOZA 2ZXUA 3GJ4A 5FL7D 1VCIA 1JR6A 4TN1A 1IY0A 3ZLJA 1E96A 1NSTA 2FSGA 2C9YA 4LHVA 1T5IA 4Q1BA 5EE0A 3KFXA 2UVQA 2REXB 4OK3A 3T1VA 3K9GA 3PUVA 3BE4A 3ADCA 2ZUCA 1HTWA 1XXHE 1FOEB 5TV2A 4JVMA 5LD2B 1NVVR 3VKHA 1MR3F 1ZM3A 1E2LA 721PA 2ZE8A 4P32A 3N5CA 4KFUA 2QT1A 3IIKA 4IHQA 1C9KA 1XX6A 3LBIA 4I1OA 1DARA 1P9RA 1R8QA 4B2PA 1NG9A 1P62B 2OAQ1 3AP2A 1TF7A 3V4RA 1W36C 1I4DD 5TARA 5JJIA 1TF5A 3MCAA 1JB1A 3TE6A 2F7SA 5G3ZA 4Q4HA 4W5HA 1PUIA 4ARZA 4TMWA 3AP3A 3VHXA 1CKEA 4Q4AB 4W5WA 5C2JB 4Z8XA 2ZSEA 2Q3FA 1YZKA 4D25A 3A4MA 4JL5A 4P4SB 5D3MA 4QM6A 4C0KA 3AVOA 1QVRA 3DDCA 4B76A 1QVAA 2DCUA 1SXJD 3ICQB 1G19A 3OESA 4YMUA 1N2CE 4IRUB 1FMLA 5DHAA 3N70A 4URZR 2EQBA 4ZIRB 3WXMA 4A0HA 2NZ8A 4BFWA 5JRZA 5J4HA 4B75A 4V03A 3IKJA 3K9LA 1MH1A 1G9XA 1COWA 2G83A 1ZCAA 2K5UA 4BFZA 5D3MB 3WMGA 4BGDA 4JL6A 3PV0A 3H4MA 4QBFA 3K0FB 1GSIA 2XSZA 3I32A 3KB2A 4YMSA 3ZIAA 3EA5A 4BZQA 3EW9A 4B48A 4QC2A 4C0HA 4F91B 1DAHA 4MYCA 1KY3A 4X8MA 5CK4A 2WWXA 2PBRA 1Q12A 1TUIA 2CLDX 3QEOA 4FW9A 5DI3A 4AK9A 1ONBA 2AHOA 2Q9CA 2QTHA 1P4SA 5FI1B 1ZINA 2FJUA 3RHFA 3CF6R 4OQNA 3P20A 4HLDA 3W5IA 3GP8A 2QQ0A 4PO1A 5L3RA 4OHZA 3VR3A 1WE2A 3BB3A 1Q1BA 4GRAA 1J99A 1CTQA 3FE2A 5CYPA 3QSYA 4TT3A 3DOEA 3DZDA 2VSXA 3VKGA 3B8HA 4GZLA 1A5TA 1T0JB 1Z5ZA 4HAUA 5AR1A 2HT6A 2C9OA 1CS4C 1GNPA 2X77A 3MRSA 5AWFC 3W6OA 2F9LA 2ZREA 1KMHB 3RDPA 4KYUA 4D6PA 3PUWA 4Z51A 2F3RA 1AS3A 1NY6A 1CR4A 4CF7A 4NBSA 1GNQA 4E07A 2VP9A 2IYLD 2R6AA 3D8BA 3NIBA 4P4SA 3B60A 1ZBDA 3EZ6A 2I1QA 4EKDA 3MG9A 3U5ZB 4RFVA 3D6TB 3B13B 5EUQB 4GL2A 1H8HA 1VCNA 2AN9A 4H1VA 4QHYA 4WAUA 4DDVA 1U99A 3SYKA 4E03A 4AG6A 1QHNA 2YC4C 3EPJA 4QHSA 1DAGA 4C4PA 1XTJA 2QEQA 2HXYA 4C0JA 3VU9A 2NGRA 2BBOA 4QGHA 1BOFA 4DZZA 5J4KA 4UKDA 3GLIE 2D2FA 1FPMA 4HAXA 1E1RD 5FL3A 2GJSA 3ZDQA 2BKEA 4V0KA 1TQDA 2RGEA 2B7BA 3D7MA 4JLBA 2VL7A 1AZTA 4D0GA 4PQYA 3LA6A 4LBWA 4AKEA 3THYB 3ZGXA 3PENA 1VG8A 3Q7QA 1X8LA 1GTVA 1ZRHA 3DM5A 2QNRA 2J0QA 2QMEA 1P61B 2GVZC 1R0WA 4BFSA 1LS6A 1N5LA 2D3WA 3DM9B 1ZNZA 3CB4A 3C8UA 3IEVA 2BKUA 3ZZUA 4PHFA 4LV5B 3BB4A 4QHTA 1XMVA 1GFIA 1E2PA 2OSBA 3FKSA 3P27A 3R9IA 3THWA 4KJZA 2IYTA 3A4NA 4O0MA 4Q9JA 3VAAA 1PLKA 1YRAA 3FMPB 4DLTA 4DSTA 4PFSA 4LHYA 2HEIA 1W0KA 1T0HB 3K0EA 3OEED 4WXRA 1MO5A 3GFPA 4GP6A 1Z0JA 4K46A 1OH8A 4BLSA 1XTIA 5TY0A 1OLOA 3G82C 3RRZA 3SJZA 3UWKA 3GLHA 3LXXA 4ZKDA 2KBEA 2N42A 4DC9A 3FKSD 4DCVA 1UEIA 3HU3A 4DHEA 4I81A 3NH9A 5EUMA 3Q85A 2W6IA 1TAGA 2ECKA 2ODBA 3CZPA 2VP5A 3U3MA 3L0SA 4AYTA 4ZI3A 3QKTA 4TYYA 3O8RA 3FTQA 3EWAA 3IILA 2AWNA 4QNRA 3HYRA 2BMJA 2IUTA 1D2NA 1NN5A 4KVAA 4MGYR 3X1YA 3WY9A 2FSFA 4MKIA 1II8A 3H1TA 1SHKA 4LV6A 1M8PA 1VYTA 2AFHE 1G7TA 3K1JA 4UNQA 2VP4A 3R9XA 3K09A 4H1UA 3NC1C 2CNWD 4HSEA 4M9ZA 1QF9A 2Z4RA 4IVQA 1JALA 1IN5A 1JR3A 3MWLA 2QA5A 3THWB 4LX0A 1U0LA 4D82A 2AD1A 1CJVC 4RZ2A 3C41J 2ZRHA 3U7GA 4Q1DA 1SVMA 4URWR 5EE9A 4BFUA 3T35A 3LRPA 5E95A 2ZR9A 1KY2A 1HQCA 5AK0A 3AVXA 3Q72A 4LJ7A 1G17A 2RGNC 3GLFE 3IHLA 2AKYA 5FH9A 1NI3A 3ND9A 1LF5A 5JJKA 2YZ2A 2A5JA 2NO9A 3K9NA 1TU3A 5F2EA 4GBMA 4Q5IA 4CDGA 2FZLA 3N2EA 5KDOA 3FMOB 3LVRE 4KV9A 3QKUA 3LY5A 2JLRA 4UJ5A 1RKBA 3RS0A 2C8VA 1XMIA 2ZI6A 1J7KA 1W5SA 4BPBA 2DB3A 1N0WA 3GFTA 2H92A 5JWHA 4ZO4A 3RS5A 3HWSA 1JPJA 3NWJA 5FTMA 2RHMA 2OCAA 5JSZB 4LHZA 1JECA 3M4YA 3W6PA 1KI1A 1NVUQ 3B9QA 1B23P 2NO7A 1IN7A 4FMDB 4EJSC 2QPAA 1QZXA 1KI7A 4B74A 4C0SA 1Z3IX 1GDDA 3DMDA 4MKHA 1G7CA 5JMTA 1ZP6A 4WIAA 2QZ4A 3T15A 3TLXA 4LSGA 5SZHB 4CGZA 2ZITA 3KJIA 1T9HA 5KPDA 3RSOA 1M6NA 1Z6YA 4QRHA 3KXIA 3THYA 1Q3TA 4C30A 5GVRA 2VO1A 2IW3A 4RZXA 2WWIA 1C4OA 1H8EA 2AXNA 2QTVB 4R71A 4A92A 1PUJA 3GQBA 1BO6A 4QJ5A 4A6PA 3NBXX 4YDSA 3HP1A 1SKYB 1ZD1A 4R7ZA 5C4MA 3B6EA 1WRBA 3LX8A 2ZRPA 2ZU0C 1NG1A 3B5JA 4ZDIA 4ASUA 2JIZD 5BQ5A 4AKGA 2G88A 1DAIA 1KMQA 3KTAB 2GJAA 4F7WA 2ZR0A 2XTZA 3UMFA 1II0A 1A4RA 5C46F 4MGZR 5FPHA 5KPJA 4A8JA 4DWJA 1XF9A 3QKRB 3QXSA 4OQLA 1W0JD 2FF7A 5GVSA 2JCSA 4RCZA 4DSUA 5JSZA 5P21A 3ZVLA 1N6OA 4WOPA 4WZ6A 1UKVY 1A2KC 2OAP1 1OV4A 4DLWA 1YRBA 2B8TA 3A4LA 221PA 1OXTA 4NPHA 2DR3A 4US1R 4GZMA 2QMOA 1PZNA 3BH6A 1CRQA 4NTZA 1QG4A 1S96A 4ESVA 4HLUC 4M1WA 4FMDF 2RGAA 2EFDB 5CIWA 4XWOA 1D9XA 2YOGA 1G3IA 1KSGA 3KJEA 3UKDA 4YQFA 5C1BA 2VH5R 4DBLC 3A36A 3O8DA 3K0SA 3K53A 2DHRA 1HUQA 3VHLB 2R9VA 1VHTA 2P2LA 4OI1A 4URXR 1YR7A 3TKLA 2HF8A 1FX0A 4OQMA 3HR7A 4C0BA 4DEYA 4NE2A 2ANCA 3KKPA 2ZJBA 2QMHA 3OEHA 4OI4A 1XD2B 1K6MA 2FZ4A 3O8BA 3WRXC 5JS7A 2H17A 3SOPA 2YOHA 3U44A 3RYTC 1N6RA 3ZS9A 4AG5A 4TLEA 1VPLA 1PLLA 2V8OA 5J5CA 1R10A 4RJLA 3S1AB 4LZZA 1EK0A 5E7JA 1W7AA 3I92A 5CYOA 4DLVA 4V0MA 2ZAMA 4BZXA 2HYIC 1QG2A 3OIUA 3MUFA 1HH4A 3CO5A 4HATA 3IPXA 4DIDA 2J0UB 1ZU4A 1SXJE 2IEYA 2FFBA 1CJUC 2IT1A 2JDIA 3TAUA 1VYVA 1N6HA 2WMOB 2WWGA 4ZDJA 2E87A 4QGGA 3SHFA 1NRJB 3GLHE 3OEEA 1EFRD 1E2MA 1XEWX 2F9MA 5C18A 3KKQA 1GVNB 3Q5EA 2LCFA 4U7DA 4PPNA 3LVQE 3WHLA 2VBCA 1Z6TA 3K70C 2W2TA 3REGA 2R2AA 1E1QA 1ODFA 3DPUA 4A9AA 2TMKA 1U0HC 4ESHA 1ZVQA 2IX3A 1AA9A 3CNOA 3IEUA 1XMSA 2R65A 4FIDA 5ELXA 2C99A 4LDJA 1G5TA 1UKEA 2F1IA 2DFKB 3A1WA 4F38A 1HURA 5J4LA 1DADA 4LWZA 1P2SA 1P6XA 2QQEA 1G5RA 1E0AA 5FOXA 1DE0A 2J41A 2OBMA 2C77A 4GMXA 4JVNA 1EX7A 4G5GA 2LKCA 5HCNA 2QAGB 1IN4A 2QAGC 2Z0MA 2PLRA 4JJKA 4G3XA 2OXCA 3OEHD 2F1RA 1BKDR 3MJRA 5FPYA 2FSHA 4CEJB 3PUXA 5CIQA 4B3XA 1KDTA 1F2TA 4JL8A 1G8GA 2RCNA 4TL6A 3B85A 1J8MF 2ORVA 2F1HA 2OZEA 2ZETA 4DKXA 1CR1A 5JRJA 1U81A 1G20E 2O0KA 1UF9A 1CF4A 2B7CA 2FSIA 4B6EA 2BMDA 3IIMA 1OSNA 1AKEA 2A2ZA 2B6HA 1XPRA 4CZ2A 1MV5A 4WW0A 3SBDA 5LB4A 3GLGB 3OAAD 1QHIA 3P26A 2IS1A 3GJ6A 3KQNA 1U8YA 2BWJA 2OBLA 3IO3A 5CITA 4G5RA 3EIQA 4URUR 2ZANA 4OHXA 2O8FA 5KSOA 3VX3A 5JHGB 2XTMA 5KUTA 4XIGS 4QBHA 1L4UA 2CHQA 1ZJ6A 5H1YA 1SQ5A 4IDHA 1DPFA 2YHSA 1RRPA 1E1QD 1Q3HA 4RD2A 1XMJA 2WJHA 3BC1A 4M53A 1E9FA 2J45A 3BFKA 5CDFA 5GADl 2GCOA 3BB1A 3MMPA 4BQSA 1E2NA 2IYUA 5FR2A 1KKLA 2QP4A 4LHXA 5J4VA 4KFSA 3GJ8A 1VHLA 3QUSA 4D2IA 4YMTA 3I5YA 4A15A 1W46A 2VHQA 3AKCA 1NY5A 3FWYA 4QM7A 1GKYA 1GM5A 3DHWC 4Z8YA 3GLIB 1LS1A 2CJWB 4DT1A 1YR6A 4JVSB 4B43A 1G8HA 4NDZA 4PSKA 821PA 3K8YA 5K8UA 5JI2E 3ZH9B 5L3QA 2VTKA 3EIHA 1AS0A 2IS6A 5KDLA 1VCOA 4CEIB 3ADDA 1HV8A 1YQTA 2OEPA 5IK2A 2HUPA 1MO4A 1WP9A 4MYHA 1ZCBA 3C14C 1AQYA 2A9KA 3E5HA 2Q3HA 4LPSA 4LJAA 2ZSFA 2CVHA 2QRZA 1ANKA 4AYXA 1G5PA 3BGWA 2XZOA 4QXAA 4E09A 1YR8A 3CX6A 1R6BX 3KJGA 1V5WA 2Z5FA 2WWWA 4EPVA 1XEWY 1NBMD 3VR2A 2KI5A 5IK2D 5LDDC 4BASA 1W36D 1L4YA 4IXNA 2FGKA 1IONA 5GJWC 2P67A 3K0CA 4MRSA 3M0EA 4NCIA 1X1RA 4V0LA 1L8QA 5CJPA 4IDQA 2QBYA 4IOKA 1Z6GA 1XTRA 3AUXA 2GETA 5EP2A 1E6CA 1E98A 4JLDA 3K9HA 2UZIR 4F92B 1US8A 2GK6A 2J7PD 2JLYA 1OH5A 1CXZA 2R44A 2BVNA 4BFVA 1ZUHA 3GJ7A 4M4SA 3HU1A 1EXMA 5JWOA 2J0VA 1II9A 3B1XA 1W4AA 3D31A 5EE3A 2WPDD 3AH8A 4CW7A 2PCJA 1E9BA 1IXZA 2W0SA 5EP4A 5HPYB 3SFZA 5B2ZA 3UMSA 4CT5A 1HE8B 4DUGD 4Q9KA 5B64A 4KYIB 2CLSA 3Q9LA 2N1BA 1M7BA 2BOVA 2PT5A 3I8XA 2PX3A 1W2HA 4U00A 2O5VA 4M22A 5JFGA 5KOYA 1VCMA 1F2UA 5C4GB 1GL6A 1OXVA 1HA3A 2WPDA 3OFNA 3FHTA 3F5FA 4Q00A 5CJ2A 4HUTA 1ZD9A 2RGXA 4JLNA 2PZGA 1XEFA 4XOIA 2RB4A 3NKVA 5BWMA 3PEYA 3T1TA 3U6KA 2YVUA 4UXIA 2PMDA 2YYZA 5J4YA 4NYIR 1IY2A 2JJ1D 3FHOA 5J47A 2FFHA 2ZRGA 1ZUIA 2DWQA 3DMNA 2XXAA 3SU8A 2FWRA 1WBDA 2O8DA 1OIVA 2JEOA 1E3MA 2F55A 2FH5B 4HAYA 2WJVA 2IYRA 3CKLA 2GXUA 2JJ2D 4EPTA 3QNUA 4QOSA 3LW8A 4A36A 4B44A 1AK2A 3KUDA 4M1SA 3RSLA 3I73A 1T4GA 1R2QA 1SVLA 3IO5A 2FDCA 2REOA 4FN5A 3U60B 5EZ5A 1XJCA 5HKKD 3IPYA 3OZXA 4JVLA 1AN0A 1Z47A 2YV5A 1OHHD 3EZ2A 5KNDA 4B34A 3MGCA 2GVDC 2XX3A 3UK6A 1XXHB 2CL7X 2DFLA 4BZPA 4PSAA 1ZUNB 3I8SA 3MWJA 5CK5A 5FFMA 1XTKA 4GNKA 2SHKA 3W34A 3QKRA 3AVWA 3FB4A 5LD2C 2BCJQ 3QBVA 2ZI4A 3EG5A 3EX7C 1E2FA 3B1YA 4EQ6B 3WBKA 3UIEA 1JPNA 2JDID 3PCRB 4X8LA 4LJ9A 2ZRNA 1AKYA 2AK2A 4QBIA 4B3DA 3OE7D 4MKFA 4D81A 3EPLA 1CR0A 1MT0A 1VECA 4JJZA 1KHTA 2WJYA 4AY2A 4JKIA 2AK3A 4IDNA 1TQ4A 3RANA 1G1MA 2P65A 1UKZA 1W4CA 2AD5A 4H9GA 4S2EA 4BUJA 5LPNA 1KGDA 3U4QB 1MRNA 4B2LA 1MRSA 4IDOA 1WQ1R 2ZTSA 3NBYC 5EE5B 1JI0A 3THXA 2IS2A 1Z2AA 2HJVA 3AVVA 5HE9A 4KFRA 4B2IA 1Y63A 3W6NA 1R5OA 1E79A 1E9EA 2B21A 4DDTA 2WVJA 2XB4A 2RMKA 1YZQA 2NO6A 5CM9C 2RGDA 3WBJA 4B3GA 2ATXA 4OQFA 2Q3MA 1WBBA 2HCJB 1NIJA 4B47A 3QJYA 5DYIA 2UKDA 1UAAA 4NL4H 3AM1A 2E1RA 4WZBE 1II8B 4HYYA 4TL7A 4DB4A 3KKMA 4PC2A 3TVDA 5E7MA 4PHGA 5TVKA 5AUPB 4PQFA 1X1SA 1Z0FA 5IT5A 1XZQA 1AQUA 4HDQB 2O52A 2ZJZA 2CL6X 2Q0HA 1GG2A 3RS7A 2GAOA 2IC5A 3BD9A 2V1XA 1Q57A 3GLFA 5DO9A 1AGPA 4DLYA 5BW8A 3T1OA 2E9SA 1IJEA 4ZDKA 3AQ4A 2PJZA 2ZS8A 4LGMA 5HKKA 2H18A 1OH7A 1L7VC 2OFWA 2AKAB 3TR5A 3NTUA 3ASZA 5TXGA 1RYHA 3C15C 3C16C 3RS3A 2XNDD 5DH9A 5FTJA 3L2OB 2DY1A 4EIWA 1OXXK 1Z0DA 1YZUA 3NVAA 4KXFB 4UNRA 5BYKA 2ZJOA 4XSGA 4DCNA 1KDPA 2BHRA 2HDNB 5AJVB 3U3OA 4HAVA 5E4FA 3ZZ0A 4DCTA 2IA5A 3D3QA 2WSSD 2VHJA 3BXZA 3E1SA 2YWHA 2QY9A 4QBGB 1BYIA 1HE1C 2WKQA 4R2IA 2WAYA 4TYPA 2OFXA 1DAKA 4X8HA 3WP0A 4TZ0A 2C03A 4PZLA 2G0NA 2LKDA 1O3YA 5TDHA 3CX8A 1F48A 3AVPA 3A1TA 4PPGA 3CONA 3QKSB 3WNBA 3ZVMA 5KDDA 2N46A 2ZR7A 2WSSA 2ZRMA 3EASA 3QEJA 4IW3B 2BDTA 4PAOA 4RD0A 5EE1A 1QHYA 3PVSA 2QAGA 2ZYWX 1EESA 3W5JA 1E79D 1OFIA 3TSZA 3F3YA 2ZSDA 2P5TB 1WCV1 3B82A 5DE3A 1MOZA 2GKSA 4KCGA 2BBWA 1TU4A 2EYQA 3TW8B 2YKGA 2C2HA 5L3QB 4MRNA 3GJ3A 3QF4A 2XEXA 3TNFA 3TRFA 3NHBA 4MUAA 2IEZA 3EARA 4PHTA 5EP1A 3T61A 4DT1B 3BFXA 3QXHA 5G41A 4TTPA 3THOA 4ACAA 5L3VA 1NSFA 4JZKA 1KI6A 1MABA 2BV3A 3VFDA 4NMMA 3QF7A 1WXQA 3ASYA 3R8FA 1S0UA 3LV8A 4XWAA 4DLZA 1ZNWA 1JAIA 2A78A 1W36B 1LVGA 2OCBA 4IDPA 1KOFA 4Q7LA 1KJZA 1OB2A 3T1QA 4JKYA 2ZYUX 4II7A 1EGAA 1W5TA 1U8ZA 2VA8A 2XGJA 2KWIA 2FEMA 4EDHA 1P7CA 1N0UA 3B78A 1GZSA 3KTAA 4CIDA 2J7KA 2BJVA 5LBIA 2V54A 1ZNYA 1FQJA 1E2IA 4Q48A 5EQTA 3B1WA 2JATA 4F4CA 3LBHA 1T3LA 1G3MA 3ND8A 4Y0VA 3EC2A 1AM4D 4TTQA 3CNNA 4KITB 1ELOA 4A6XA 4LY6A 1M2OB 5JBQA 1U8AA 3RVBA 1E4VA 1GRRA 3QPVA 4Q9HA 1XPOA 4ZKEA 1TMKA 1YHNA 3CWZA 2D7DA 1I2DA 5L8VA 1Z0AA 2A5FA 4NYIQ 2J87A 421PA 2ZVPX 3W3ZB 2W6JD 2IWRA 3WNCA 1OJLA 2YNMA 2ZS7A 4FCVA 2EFGA 3BBPA 4JLOA 5LB2A 4ERNA 4V0OA 2ONKA 1SVIA 1NP6A 1T3SA 4TLDA 5KNBA 1D6JA 1K8RA 1N6KA 4HAWA 4PO9A 2WKRA 2PCLA 3I72A 1GL9B 2EWVA 5DISB 2KBFA 2R6FA 2ANBA 5JJLA 1XD2A 2HXSA 2ODNA 3CIOA 3CW2A 4Q01A 4LHWA 4BEBA 1JEEA 4EJSA 2CLCX 4MH0R 5CB8A 1QBKC 4Q4JA 4M1MA 5DGXA 3OAAA 3KXKA 4DUGA 1OE0A 3F0TA 2X1VA 2RGCA 4TYWA 4UNSA 2VP2A 3CRVA 2BJWA 1XFAA 2JIZA 2XTNA 2MMCA 5FBVB 1S9HA 1X86B 2IYYA 3FPAA 3JZMA 6Q21A 5G53C 1FUKA 2IHBA 2WKPA 1E9CA 1P5ZB 2D74A 3SEAA 4DCUA 1R0YA 5JS8A 1YJ5A 4ARZB 4W5JA 4UXJA 3QXXA 5KNCA 4JLJA 4OJKA 4W9MC 4M1OA 4M2LA 1U94A 4B3FX 2P5SA 2QL6A 5UKDA 1IQPA 4J0QA 3H0KA 4I1VA 2ZI5A 1NL3A 2VF7A 4GOKA 3RAPR 2PX0A 4EPRA 1FNNA 2XOKD 4GMDA 1JAHA 1P2UA 4CEJA 1NMXA 3EAQA 4TL8A 4MGKR 2GA8A 5BN3A 3CPJB 4WZAE 2OCYC 5D3QA 2I4IA 1GOTA 4DLSA 3PR1A 1FL9A 3O47A 2ERYA 4PTLA 4LK2A 4ZIRA 1GIAA 4IOMA 4JBYA 4QGFA 2C9CA 4M21A 3U3JA 4CYMA 2OLJA 3TUJC 4N0DA 1IN6A 3A37A 2QP3A 3KUCA 4UNPA 2G9NA 2XSZD 2ZRIA 4AC9A 1BS1A 4FI3C 1NBMA 2CCGA 1J70A 3AUYA 4HDOB 3V9PA 5AUNB 2OO7A 4PSVA 3TMKA 3VTKA 5HZHA 3I62A 1RYFA 1Z6XA 2W00A 4FCWA 2XNDA 3Q5DA 5K8LA 3LNCA 4G5OA 4POAA 2R6GA 2Q6TA 2A5DA 1Z6AA 1RE0A 1OYWA 1ZIPA 2DFTA 4QL3A 3BS4A 3G5UA 3J81k 1S1CA 3A6PC 4MYUA 1XXHA 4Q1AA 3MD0A 4JYCA 1KMHA 2WOJA 4BE7B 4RCYA 1NBME 2FEOA 1T91A 3EZFA 4P4UA 5FOTA 1XD9A 1KZ7B 3VX4A 4G5SA 1G291 3VKWA 1MO3A 4LPKA 4NCNA 2NG1A 3VNVA 3EC1A 4L9WA 3RWMB 3TVTA 1A82A 5AJYA 1V43A 2J0UA 4B32A 2I3BA 3FHCB 1N5KA 2AWOA 3KX2A 4LBVA 4HLCA 3TSOA 4URYR 1Z08A 1W4BA 3MJHA 4M9SA 1KDRA 4UXHA 2ZRJA 1KO8A 1LFDB 1Q1EA 1RIFA 5EXPA 2O8BA 3WMFA 1ZAKA 3KFVA 1XEXB 1QHGA 2GDJA 4FWTA 3OIYA 2EFCB 1E4YA 2IUSA 2QU8A 4JLKA 3PQCA 4LOAA 4IVPA 4KHZA 4NYJR 2RKOA 1WDTA 1LTQA 3KQUA 3OHMA 4TMZA 4TQUS 5FUVA 1ESMA 3LAWA 2ZI7A 1OIXA 2QPOA 4XJXA 621PA 3KJHA 4TSFD 2ZUBA 2LWIA 4G5QA 4DSNA 1QDEA 2IYSA 3TW4A 3QG5A 1LY1A 3N2IA 4Q9IA 2HF9A 2C04A 3DEFA 2NO0A 4PPFA 4PX9A 4LUCA 5FBWB 1S2MA 4Z1MA 1D2MA 4IVRA 1KK3A 1NLYA 4PHHA 4CVNA 4PC7A 4C9BA 3U4QA 2ZE5A 4RFSA 1G8PA 3P32A 3AF0A 2PH1A 2GZAA 4OI0A 3E70C 2OFOA 3U7EB 1BMFA 4B73A 5FOWA 3AVUA 1F5NA 2BM1A 1UDXA 1VIYA 2NIPA 2AFIE 4JBXA 4XH9B 5CLLA 2QSZA 1OKKA 1Q1QA 1ZW6A 2PL3A 4L8GA 4R2HA 4CEHA 3QXJA 4LJ6A 2FFAA 2CBZA 3CH4B 3GLFB 3F8TA 1OXSC 1XP8A 4AURA 5BN4A 4OBEA 5AJZA 1US8B 1FP6A 2JLQA 4BECA 3PFIA 1VDZA 4Q1FA 4A0GA 4CRWB 4D4JA 3EPKA 4GDFA 3SR0A 2A5YB 2ZI9A 1DS6A 5BN5A 4JLMA 2YJTD 2JASA 3RS4A 5JCZA 2QBYB 5JECA 1OIWA 4HZUB 4R98A 1T5LA 2FE4A 2O0HA 5DSZA 4E5UA 2QM7A 2L0XA 2C98A 2J5XA 4L9SA 4TMVA 1NNEA 2DBYA 3ZQ6A 4F4IA 3C4JA 2OBNA 4D26A 2IF2A 4D0LB 2CE7A 1ZYUA 1P75A 4D80A 4LJ5A 1VMAA 2EVWX 3L82B 4L16A 2ORWA 3QVVA 4KLZA 2JLVA 4WBSA 1Y3AA 3RRNA 1FMJA 2ERXA 2V55B 3IHWA 1O87A 1RVDA 2GF9A 1OFUX 2GBLC 4AKIA 2J7PA 4HB4A 1NVXQ 1P9WA 4HLUA 3O8CA 1QRAA 4PO8A 3HR8A 4NKRA 2XITA 1ZM7A 3MSXA 1DVRA 2CNWA 4EJSB 1Z29A 3REFA 2XZLA 2QENA 5AJXA 3SNHA 1MO6A 1N5IA 2IYXA 1CLUA 4DDWA 2OE2A 1TADA 2CCJA 3DVLA 3EXAA 4Q4HB 3U2QA 4KO8A 4NCJA 4QKQA 4DCSA 1RRCA 1KDOA 2GILA 4A8JC 2V4ZA 1M34E 1JQJC 2QSYA 5FUYA 3SDZA 3PIRA 2WJJA 5IF9A 1KYIA 3AKYA 3QPWA 4HAZA 5DYGA 3KL4A 4YONB 3X1WA 4Z1MD 4YXWA 4PZZA 4RVCA 3TQCA 1DO2A 1EFCA 4D4LA 4Z54A 1CBUA 3IGFA 3OFND 1SKYE 2X19A 4JLAA 3IQWA 5E3HA 4I1SA 1NLFA 3ETLA 2IWHA 1ZC4A 2GCNA 1E2QA 4Q4LA 4QJ4A 2VSOA 4LBZA 1T8TA 5CB6A 1CULC 3BK7A 2FG5A 2CHGA 1T8UA 4XVUA 1YVDA 2QE7A 4NYJQ 2O8EB 1NF3A 2NZJA 1XBTA 1OT3A 5BYJA 2BCGY 3WYAA 1NKSA 4LC0A 1E99A 4DJTA 4K8OA 2WIAA 4YXWD 1CJKC 1HY3A 4MQBA 2IF0A 1GP2A 3R7WB 3CRQA 3GLGA 4P33A 1M7GA 1D5CA 2GAAA 2GEUA 4IJMA 4HZUA 3LLUA 1E2GA 4OYHA 4BEJA 4EQ6A 4LYJA 4XVQA 2V7QA 1HEIA 1EX6A 3T12A 2JJ2A 2IS4A 3AGQA 4DVGA 2CL0X 4YMVA 3ZD6A 4MYTA 3ZYCA 2OG2A 2QRNA 4B6FA 4BRWA 5F3WB 1NN0A 4AD8A 2GXSA 2QG6A 2OESA 2CE2X 4HB0A 3T06B 4A82A 3W8NA 4KSBA 3ECCA 2ZSAA 3KQLA 1YU9A 3L0OA 1TX4B 1G7RA 3X1ZA 1LV7A 4QFMA 4NYMR 2OXRA 3R20A 3C5HA 2WJIA 3ZVRA 2FGJA 4RD3A 3H86A 3BJIC 4ASUD 3FFBA 4DXAA 5L3SA 4AKHA 2ZJYA 3IBYA 4DIEA 3KKNA 3OIWA 3GEHA 3HDTA 3IUYA 1YZNA 3PXGA 1N5JA 3NDBB 1KKMA 2WICA 5FPKA 2XOKA 5IHPA 3AP1A 2CJWA 2VP6A 5A4JA 5B58C 4HB2A 3GFOA 1KO5A 1N3BA 4DSOA 1E94E 3LFUA 5EZ6B 3W90A 3BERA 1EWRA 4NONA 3Q7PA 1U90A 3JZAA 5JWRA 2GCPA 4OHVA 2F6RA 4IOLA 3R8CA 2H8KA 2ZPTX 2Z6VA 1XPUA 4C0LA 2ZYVX 4MDFA 3EIEA 1IY1A 1VTKA 3DL0A 2EW1A 2BM0A 2Q21A 1G64A 2ZQ5A 2ZAOA 4LYFA 3QG1A 2FA9A 4XTRA 3AVTA 2NPIA 2QT0A 2VYFA 3PUYA 4NCHA 1IHUA 3BOSA 2AX4A 4ON9A 4XSHA 5F9FA 3PEWA 1DAMA 1IJFA 3PEUA 5EXSA 1X8KA 3LO5A 3QIAA 1F6BA 2V7QD 3TBKA 3SFVA 4D0NA 4UJ3A 3SS8A 3IBGA 4D4KA 1E9SA 2VEDA 2ZE7A 4Q9LA 1FP7A 3SI7A 1ESNA 5KTYA 2IUUA 2YINC 4RKFA 2Q9AA 5DNYB 4EFMA 3X1DA 4EUNA 5M04A 4BLRA 1LB1B 5FOSA 1EG7A 5FOUA 2KB0A 4ZPXA 3SHWA 1OXUA 4DLUA 4KAXA 5JZVA 3B9PA 3PG5A 4PXAA 4HZIA 4CEHB 2FFQA 1P9NA 4GFDA 3TUIC 2GXQA 2GJ9A 1KTVA 4YC7A 3MWKA 2AL7A 2GJKA 4U5XA 5FPTA 3UPUA 3NG1A 5FPSA 4JYBA 3AVYA 3UMRA 1KI2A 1C1YA 2ORIA 3EWSA 1ZC3A 2VIIA 3W3AA 4M9QA 5DHFA 3GPLA 1I2MA 4O3MA 2QGZA 3GJXC 2W6ID 3VU9B 2C96A 4N1AA 5FOVA 4FMCB 3BRWD 3X1XA 1JBKA 2GRJA 3CRW1 2V9PA 4B33A 1XD8A 2VF8A 2Z4SA 4IKEA 3U3KA 4FMCF 1P3JA 1UDWA 4ZCLA 4Q4AA 1XTQA 2WSMA 1SVKA 4MUBA 2MMGA 1TNDA 1GNRA 2QPTA 4M8NE 2IK8A 2A3RA 4ZCMA 2ZROA 3RABA 4EPXA 2QUZA 1G8YA 4JT2A 4RD1A 2BIFA 2JGNA 1KI6B 1MABB 1J2JA 4NZYA 1WB9A 1KI9A 2F43A 3HYTA 5TMPA 2WWYA 4RD4A 3U44B 1E2HA 3LQQA 4LBYA 1KO1A 1BMFD 2W2VA 1DG3A 4US0R 5FTKA 3C5CA 4EFLA 521PA 2J59A 1IBRA 3KQHA 1KSFX 4I99A 4ITRC 3LWNA 2RGGA 3VQTA 3VR5A 1BIFA 1UBCA 2R6CA 1E32A 2JA1A 2VLIA 3WMEA 3V00A 4DB2A 3CLVA 1U2RA 4LV8B 4L15A 2ZU6A 4XD7A 4CT4B 2ZEJA 1QHHA 3FMIA 3KB1A 2VPPA 1P73A 1GKIA 4KLNA 2XXAB 1I4TD 2V1UA 2H5EA 2DWPA 1FUUA 2PEZA 1KZGB 3UXMA 1G8FA 2HCBA 1OPXA 2B8WA 3WYGA 1F3OA 3QQ5A 1NVVQ 2QMUA 1S3GA 2D62A 2CEAA 4G1UC 4YMWA 2CHVA 3FVQA 2ZI3A 4Q21A 1Z0IA 1JNYA 4HUQB 4PQRA 3WNDA 2EU8A 2NTYC 1RFLA 4GOJA 4ZI2A 2W6JA 2IHYA 4MRRA 4RFSB 3AKEA 4BFYA 3U6BA 2RAPA 5G40A 1RJ9A 1MKYA 5FTLA 3GEEA 3GJ0A 4WVFA 4B3BA 1Z83A 1H8ED 3GEIA 4JIMA 4PANA 2PMKA 2QGNA 1UBGA 2MSCB 2ZJAA 3RS2A 1TEVA 1Z07A 3CM0A 4P4TA 5JLJA 4YDHB 2CMKA 1IN8A 1K5DA 1JXOA 3LLMA 3QOFA 1G3QA 3LW7A 1FTSA 5FBRB 4NH0A 4KSCA 4KI0A 1W44A 4LJ4A 2DWOA 2XB2A 1KI8A 1PV4A 1X8JA 3EPHA 4Q4JB 1N6NA 1E0JA 2QAJA 2HV8A 1Q21A 4RZUA 3DOFA 1N0VC 4GT1A 5CM8B 5G3YA 4C0QC 3KDSE 3FMFA 1Z0KA 1PJRA 4NCKA 1Q44A 3GLGE 2NOAA 3P4YA 1AZSC 4TWZA 2WJGA 3V4FA 4OL0A 1G41A 4TSFA 1S3SA 2QI9C 3NEJA 1NKTA 2MSDB 1CR2A 3SYLA 3T5GA 1RW4A 1E69A 2HJGA 2O8FB 4C2UA 3SN6A 4C3ZA 2GK7A 4UQOA 3A1UA 1XJQA 1SXJC 1FX0B 4XTCS 2I1VB 1XZPA 2NPFA 1ZM4A 1ZMXA 3I5XA 2GTPA 1CJTC 3W9YA 3ZQJA 4IXMA 2UZ3A 3BWDD 1UPTA 1KK2A 2G1KA 3L43A 1G4UR 2JLSA 5IRCD 1SHZA 1SVWA 4TMXA 2YWEA 4F4JA 2ZVQX 4U02A 1KK0A 1KSJA 4FCTA 2GNOA 2JLUA 2KSQA 2W2XA 2ZS9A 1KSHA 5F98A 1CRPA 1RZ3A 1COWD 3CH5A 1ZM9A 3B1ZA 4LC1A 3RNLA 1TQ6A 1KAOA 4ABYA 2P6RA 1TTTA 3BAFA 1TUEA 4TL9A 2F43B 2QORA 4LRWA 2ASEA 2REBA 2EYUA 3QI2A 4OJQA 3CX7A 2C95A 3WYFA 3U7FB 2Z43A 2IXFA 4Q03A 2O8CB 2ZRBA 3L0IB 5DN6A 4IEEA 4M0LA 5H70A 4PC6A 3BFVA 3UWOA 4JSYA 1CIPA 3KZ1E 3TQFA 1UFQA 4Q02A 2BEJA 2ZRDA 3I4LA 2A5GA 1U0JA 4ILEA 1NVWQ 3SQXA 4OK5A 2FPLA 4F93B 2BBSA 2DPXA 3JVVA 1TL7C 1Q22A 2MSEB 1KO7A 4IFBA 1IXRC 4TT3D 5KSPA 2CDNA 3AF3A 2O8EA 2H57A 3RLFA 1EWQA 1L2TA 2NO1A 5B57C 2RGNA 1SGWA 1ZIOA 2VHUA 3X2SA 1Z06A 1D8TA 3B7GA 4A2PA 4DLXA 1Z63A 1IXSB 2FN4A 4FINA 1SZPA 2ZRKA 4JSTA 1UM8A 2P0EA 5JI3E 1A1VA 3CNLA 3EZ7A 3CF2A
chains in the Genus database with same CATH superfamily
3QE0A 2XADA 3JWIA 5DFAA 4XE5A 1PT6A 1Z4NA 3TBHA 3CC8A 4HNQA 1PJBA 4E22A 1EVQA 5ANRB 4EG0A 2CNKA 3AIIA 1Q0TA 1XJ0A 1FXWF 5HTOA 3C87A 1KAHA 4UFPA 1TYAE 3M89A 3DMPA 3M6WA 1MW8X 1YFKA 3OLWA 2GBLA 4I4TF 5TMEA 3GJQA 4BVEA 5ALHA 4CM8A 4J6FA 5B1YA 4IFEA 1BAPA 3BBLA 3NAQA 4BMCA 1DBSA 2GI4A 2OP0A 2P68A 3ZZTA 2G1JA 4M1EA 3WLNA 4MI3A 2OAGA 1VFPA 1AG9A 2XRFA 4XQCA 4YALA 3RK1A 4N40A 3WYNA 4KGDA 1FA9A 5JEEA 3FYHA 4J49A 1VLJA 1IVNA 1C9NA 2X2FA 3INYA 5E6SA 4B35A 4HNAA 1GLNA 2AT1A 5J2TF 5HQJA 1W93A 4UUQA 4FXPA 1YASA 3EISA 4OI2A 2XPCA 4F2GA 4OXRA 3PQFA 3UQZA 1FSPA 1FS6A 2P2YA 2HU5A 2WUEA 3H84A 4KFCA 1XA3A 1QBGA 1JHVA 1DIRA 1PUXA 1NE2A 4KC0A 1MO2A 1SC6A 2OBXA 4O6VA 5TJ9A 5BR4A 1IXYA 4C29A 1EDBA 2V65A 4EPWA 4U0KA 3RUAA 3HDJA 3ZYZA 1WNTA 2B7LA 1AGXA 1E0DA 4IJUA 2X4GA 3UUEA 3AF2A 4JB8A 4YRCA 3H2YA 4D02A 1TD1A 1O2DA 2BMEA 2CCKA 1WLYA 4GLLA 5KYXB 1ZLYA 4NLLA 2QP9X 3FTFA 1QONA 1P72A 4IDAA 4AY3A 3MYYA 1GN9A 1FW6A 4X6UA 2A6PA 4C88A 1E1MA 1KVQA 3IMCA 5GJBA 4IQFA 1HYQA 4BBAA 2ZE6A 1I4WA 4G24A 1NVEA 4Y7CA 4BDSA 2WG2A 3FCYA 2FX3A 4FYHA 4MTCA 4RLQA 1L5MA 3RUHA 1QYXA 4IAOA 3K70D 4K6OA 2WZBA 1LQUA 4KG7A 4TYQA 5AD1A 3F6SA 1Z5NA 3DW1X 2FMIA 4I1IA 3DZCA 5A71A 3KP1A 3QGMA 3ENQA 1YK1A 5AOVA 3WIVA 2Q4RA 1TCUA 1VLVA 1ND5A 2Q0QA 1EP1B 2CJPA 4JI8B 1PJTA 1RM3A 3UBMA 3KKOA 5HSGA 3TF5A 1U6IA 4JUBA 4FZ3A 4WH0A 3NXKA 5IARA 1Y8QB 1Z2DA 3W8RA 4RPGA 3LF1A 2VHTA 2BR4A 1AKTA 1I4LD 3M34A 4WXPA 4V2IA 2HWWA 4OLFA 5LQRA 1I5OA 2AVDA 3LP6A 1P19A 2JJYA 5FWAA 2H2HA 4QXQA 3EA0A 5KOJB 2HC9A 2F90A 2H4JA 3M5CA 5LJIA 3GMTA 3MGGA 4YYEA 3JWJA 1DFHA 4O59O 3COSA 3VPHA 2V3CC 2VKTA 4FC6A 1G4AE 4PCUA 7REQB 2XBMA 4B5KA 4KAFA 4MPPA 1J8YF 3CEMA 4ALMA 4Q6WA 1SC4A 2CW5A 2IU3A 2P0YA 3FJ1A 4M0MA 4MWBA 1SMKA 3TTVA 1JVSA 4EKIA 1SCUA 2WUGA 4M0PA 2NU6B 3KV1A 2FPXA 2PY6A 2GFHA 3GLHB 3EN0A 3ONWA 5TQJA 3UB2A 4PAQA 4BEVA 4F72A 1PR1A 1Z12A 5I7AA 5EXTA 5CA1A 5GIOE 3JXEA 3DFIA 2AR7A 4EG8A 5CURA 2CMDA 1YE8A 4RPHA 1TGVA 2B1JA 3NTXA 4LJ8A 2Q2OA 3L0PA 1C8KA 3CLKA 3B3QA 5BRAA 5BV8A 2DPHA 3U3RA 1KC3A 4QTZA 3GELA 3H6KA 2B4YA 2C78A 2PSSA 2MDTA 4O2LA 3W8FA 4U2FA 3T34A 1Q92A 4E5NA 1XRNA 2F17A 3M6AA 1OYYA 2NAPA 5E1OA 5FR1A 3HNRA 3CWCA 1EUZA 5DLQC 2R1TB 3DLBA 3MWFA 4TWBA 3AVQA 2FXIA 5EI5A 1IG0A 1X3LA 3VR4D 4B7ZA 3CPHA 3V4OA 1ZGBA 3G8DA 4TXJA 1E1DA 2CJFA 3U61B 3STWA 1E2DA 3K8QA 2D2EA 1VG9B 1HT1E 2RONA 1M1YE 3QPAA 5E6SB 5FWYB 5K03A 1P18A 5TQ0B 5JXIA 3HZOA 2CK3D 3AXSA 5D1NA 4RY2A 1KYQA 3N1UA 4W7IA 1JJ7A 3OIVA 2O3TA 2OV2A 1QZUA 4MGIR 2OCXA 5DWQA 1KAGA 5CR9A 1GTRA 1JT9A 2RGBA 2P6NA 1C50A 2Z3VA 4KH1A 5ILGA 4BLOA 5JV5A 3ZJUA 3OP4A 2YWCA 3AU9A 1JLMA 1RRGA 3AL2A 5EXXA 4EKEA 4MITA 4ER5A 3UG6A 1RJFA 2X86A 1IEWA 4AX8A 2PZMA 1WXWA 3EZ9A 5DCUA 3RC3A 1Z5VA 3VZBA 4AWXA 5KSZA 4DEXA 2WHRA 4JBIA 4MV7A 4IIJF 4N0MA 4XWKA 1IBKB 1CQXA 1MIHA 5AJHA 1XLUA 2NSDA 3PFCA 5KYYA 4Q7KA 2QVXX 1RXEA 4WA7A 4NE9A 4JEIA 4R1OA 5JS6A 2RCYA 3RRMA 4RL6A 3JZFA 2AZTA 4G4IA 1EK6A 2A9RA 2ZUUA 1R27A 3MUNA 4TLAA 4K9OA 3T1YB 1L7EA 1XCMA 4O0LA 1SHUX 3H3XA 4KBGA 5JHHB 1LZLA 1CQWA 3W8DA 3WO0A 3FDXA 4W7HA 1JLLB 3EXEB 5D2CA 5HIJA 4FI3F 1KGSA 4RPLA 2NNWB 1EG2A 2W0MA 4TLBA 3EDRA 3BIFA 2A1UA 1KI3A 2QE7D 5E7IA 3X0DA 5C8ZA 2D06A 5IDVA 1ND6A 3IKVA 3LUJA 5I8WA 5E6RB 3THXB 4HH3C 3RFTA 2FPMA 2Z58A 3HU2A 1VLMA 2V0NA 4ANFA 1PGNA 4OKSA 4CMEC 3JR7A 3PI7A 3L9WA 1NN1A 3NHRA 4MV9A 1R5JA 1YXMA 4BZPA 5BR8B 4ACBA 3GGCA 1CZUA 4P0PB 5C1PA 1MJ5A 1JEAA 1DO0A 4XD7D 1NQWA 1W49A 2P27A 3K8OE 5IAKA 2XGMA 4WKNA 1BW9B 1ECGA 1U02A 4KBFA 1IRIA 5EHIA 4UMFA 2DAPA 4GYKA 3RYCA 5AVOA 3IDZA 3NIDB 5FL7A 1VCHA 1X6VA 2UVDA 3U26A 5CXQA 1IC6A 4L1KA 3WRYC 3ZDDA 4PPQA 4C5BA 2SCUA 1GL7A 1X1QA 4EJ2A 1GKUB 4F4FA 4ZI7F 2CN1A 3GB9A 4GPTA 4OHPA 3UJPA 2B2XA 1TCBA 4N18A 2X9VA 1JEYB 1ESEA 3OZUA 3PNLA 3IKMB 3UUFA 2IBMA 3JQ7A 4N0EA 3TPZA 2HQRA 3KUKA 5K3FB 1I5RA 3WIBA 1VMIA 1XWIA 4OGLA 2AJTA 3L8MA 1M74A 1S9DA 1X19A 3ZCPA 4BIIA 2WOOA 1N7IA 3AHEA 2C2WA 1HDIA 2BFCA 2V6JA 4E5DA 3U7HB 4TM8A 2CEKA 4NNPA 4NVRA 2FPIA 1PQYA 5AJUA 5JG7A 2C1ZA 4S1TA 2B6NA 1ZI9A 2IX9A 4N7BA 1G6HA 2GQ0A 2PGAA 4O8CA 5IJ9A 4MK4A 1D2EA 1V1MB 2BEUB 3EIUA 3RVDA 2WVHA 3COWA 1VE6A 3BH7A 3BMNA 3TNJA 1PEKE 4CMJA 1KK1A 4DZTA 1JLKA 2UYOA 3EXHB 1JR3E 3PPIA 5JEDA 1GZUA 1QTNA 5FNVF 1YB4A 4YX9A 1ODCA 1D9ZA 3AHCA 3NI2A 1VI2A 4XA8A 1V2HE 4P3PA 2VRCA 2WE7A 4BAUA 4Q47A 1T6NA 2R751 1Q1NA 5F35A 5GGYA 4JS0A 5ALTA 3AV0B 5CG1A 1DAFA 2DFVA 3I9KA 1GPWB 3A1EA 4WBNF 1CP2A 2R86A 4EFNA 3CY6A 3ISTA 3L6UA 1PN3A 3I1FA 2OKGA 4L5BA 5JUWA 5D6NA 1IJBA 4XM2A 4FMPA 1J1IA 4N82A 1NT2A 1TVMA 3G7SA 1BRTA 4A1FA 1L8XA 3AVWA 2VRWA 2EJWA 4G0NA 5C1DA 4OFZA 3U4HA 2IXEA 2O0JA 4DIOA 2CFOA 1LF0A 2FY8A 4XSVA 4D8XA 2FPGB 3CBQA 3C7CB 4MRVA 2W8ZA 5FTNA 4CUJA 2Z04A 4ZV4A 4CF6A 2A59A 2BLNA 2H4YA 3WLAA 2GPYA 3T7JA 1U0NA 1W85A 3ITNA 3KQVA 1GAJA 4EO4A 5JCPA 1WZIA 3HJFA 1XLTA 2AV6A 4HO1X 1GEEA 1MZVA 1ETHA 2C2OA 4BKMA 2PBZA 1NMZA 4YP6A 2GWHA 4NHOA 5IH7A 2PRZA 5C0OE 3T41A 1J22A 1IWOA 3HKCB 4XUGB 5FLXA 3NVKI 1O6CA 4GPZA 1FFHA 1EQ2A 2AXPA 2EFEB 3QTTA 3CWQA 4P4LA 3G5TA 2VJLA 1HT2E 2C9MA 5CNIA 1EXNA 4EO7A 1BDJA 2XNKA 2P79A 4JMPA 1J21A 1YIOA 3DP7A 2WTEA 2ZSBA 5BSGA 1LPAB 2CVOA 3D2BA 1M83A 4C4XA 4QT0A 1K27A 3GAZA 3EZYA 4DIMA 1ZL2A 1I3LA 3GK3A 3NBZC 3A14A 2ACWA 4GNRA 4HQOA 4KFTA 3AESB 3JRXA 3JZDA 4GLOA 3M83A 4OK6A 1CYEA 3T3OA 5CYFA 1U98A 1USWA 1WMFA 3MYRA 4AZWA 5HZKA 4TZ6A 2WJ6A 2Q49A 3VR4H 1QIJA 2UZ4A 1TB4A 1VKJA 3QBDA 1QIFA 1ZNXA 3L02A 3NM4A 4LXGA 4UOEA 2QM0A 3EVNA 5I3ZA 3DUFB 2XQJA 3EFOA 3H5VA 4GXQA 2Q3EA 3DFKA 2YV2A 3AYXB 4M1KA 4ER6A 4KPUB 3LBNA 4AZVA 2Y99A 3D6AA 3TKYA 1U0BB 2JK1A 2AMFA 3GP3A 1JX6A 1ZOSA 1OH6A 5KSYA 3G1TA 3ROMA 3LDAA 2F1JA 2HLHA 3U7QB 3UK1A 1Y7TA 3MLEA 3IUMA 1EDZA 1IQRA 4HI0E 3ZVKA 3SE0A 5EJEA 3COJA 3E2IA 1THZA 1U11A 5K8IA 2QR2A 4HMPA 3KSAC 4ALNA 1T25A 1KIMA 4MWOA 4F9EA 4UW9A 4HGPA 4PQEA 3JVUA 4MDEA 2I0FA 4RENA 4TS1A 4P7GA 2QDXA 3NC0C 1W4RA 5EJ8A 1AUPA 4L76A 1EB8A 2G5CA 1GAWA 3K1AB 8AT1A 2VHEA 4B6SA 2KMLA 2FV8A 1XB2A 4D4MA 2Z9CA 2YL2A 3D8TA 1JHMA 3JYOA 4I5FA 5C52B 1VE5A 7ADHA 4GECA 1G3RA 3IB3A 4NSNA 3ZEIA 5KU1A 5LR6A 3R6TA 3OA2A 2NQ2C 2WB2A 1MIOB 2CVPA 1MAHA 3F4LA 3GRZA 3JASA 3L8ZA 4N6GA 1Z28A 3N2ZB 3O0TA 4TWRA 4PRYA 2AOUB 2P69A 1WCWA 2Q6IA 3TOXA 4ZVQA 3WP1B 1GNTA 2R4TA 1NOIA 3R2JA 3BFJA 3PSAA 1UPBA 1CUVA 1XQYA 1M2FA 4IQGA 4ZVRA 2Y1CA 3C45A 3RREA 4CFZA 3NHUA 5LMZA 4RY9A 3AF4A 3NEYA 2X8WA 1DG1G 4TQAA 1S02A 1C9YA 4QNMA 3CVXA 3DDNA 4V0ME 4S1PA 4YRTA 4XQGA 1N5MA 4M8SA 1DSSG 1K98A 1QM5A 2GTIA 3IUSA 1PYDA 1XCGB 1U9YA 4PC3A 2X0FA 4LFAB 1G16A 4GKAA 2VHXA 1T9ZA 1JHRA 2PT9A 4PAGA 3H97A 3IQXA 1FU8A 2HI0A 3MAAC 1Z2CA 3IDOA 4OMUA 4ZJYA 1L5QA 1P60A 2XUJA 5H0IA 4JY7A 4YAJA 4HAIA 2FPUA 4BUCA 3WQQA 1E2JA 1LW7A 4DFDA 2IOQA 3C6MA 1LPPA 1N0HA 1VYUA 1FUYB 2PR2A 3C8ZA 3F7NA 4HH4A 5CGQB 2E89A 2WWHA 3U1VA 5B30A 1T2VA 3IMFA 2IZ7A 3JQCA 2XCRB 3GJ4A 2VHVA 2NU8B 4NS4A 1JR6A 2WKWA 3F1LA 3ZLJA 1NSTA 1SBTA 2HK6A 3QELB 2C9YA 4JUIA 4LHVA 3G6KA 3AEQA 4TSKA 2C07A 5ERYA 3L4SO 2GPAA 2IRWA 5EE0A 4ZU1X 1RCTE 3FXAA 4B4WA 4RTLA 3KC2A 4PNHA 1EXDA 1X38A 2REXB 4OK3A 3K9GA 4BJHB 1YOBA 2BI4A 4URHA 1XXHE 1FFSA 5DEIA 4JVMA 4NU5A 1NVVR 3VKHA 4I36A 3W5VA 3R7DA 3W9UA 3OPYA 1DC5A 2DHDA 2ZE8A 3GRKA 1P3DA 4P32A 1SUBA 1QE3A 4KFUA 1QV7A 2BH9A 2PIAA 2P11A 4GUAA 3OT5A 1XKTA 4RLFA 2Y9PB 2ODTX 2ZB2A 1PQUA 2R7MA 2GD0A 4U6NA 4XDGA 1QAMA 2J4FA 2AW5A 1BXKA 1ZQ1A 2ZKIA 4MMZB 1W36C 4PSUA 3CVVA 3QE3A 1NRWA 1DXHA 4WACA 4W6ZA 4RQUA 4R1TA 1A9TA 1F8GA 4JNCA 3VOSA 3TVYA 1RI5A 4JK3A 4QAJA 1J49A 1JB1A 3FUXA 4HSGA 5JANA 4CWAA 4EUEA 1Z7YA 2XUHA 4WWHA 1PUIA 4ARBA 3VBCA 1D09A 2O2JA 4ER0A 1X9GA 4PIMA 3I6YA 4W5WA 1EGVB 4C4SA 4MWZA 3D4LA 2ZSEA 4GAEA 4XEHA 1KKUA 3A4MA 2XUIA 3EFEA 3RUCA 1K7CA 3JU3A 1B16A 1QVRA 3JYQA 4RGYA 2EBWA 4S2UA 4A73A 1AC5A 4RTJA 1M1NA 1SXJD 3EXHC 1KHHA 3ND7A 4FK8A 4MRMB 2C0PA 3DMTC 5I4BA 5KWJA 4JAVC 3VNSA 2XB8A 3FNGA 1N2CE 5LMUB 4MWSA 3L6DA 4TV9F 4LNHA 4FB4A 3FB1A 3S2EA 4XM1A 4EB3A 2C7BA 4P1ZA 3B6ZA 4O4JB 1IM8A 3SHTA 2R3SA 4CN9A 3V4LA 1J0BA 5LUAA 3LX4A 3JCZA 4D41A 1COWA 1FFDA 4ZD6A 2EJVA 2V7GA 4BFZA 4NABA 5D7BA 3WMGA 1Z33A 4BGDA 5JATA 4QUGA 3L7LA 4FNOA 3U4CA 2BGRA 4QBFA 2MTBA 3K0FB 3NANA 5REQA 2XSZA 1M6HA 1E7QA 3LCUA 4I2NA 1S2GA 4YMSA 2V9CA 3EW9A 2XMBA 4QC2A 3ZIAA 4B48A 2VPWA 3PQ3A 5ALRA 1NJ5A 3ESYA 4X8MA 3DBLA 3MXTA 4IIUA 2PBRA 4V1CB 5C4IA 2OAEA 1RQRA 1TUIA 4FW9A 3ZK8A 2MT9A 1M8KA 1ONBA 2Q9CA 4AFNA 2WSLA 3II6X 2IGTA 1UEXC 3HZRA 5BV2P 4CIWA 2WAAA 2IV2X 2GRAA 2I3AA 3ZU6A 3K1YA 4YCCA 5GZ3A 5JJCA 4ETMA 4F9FA 1I2BA 3W5IA 3CF6R 1BMDA 2P3QA 2XVXA 3P20A 3TNDA 1QX4A 2BGWA 2YYSA 4C6TA 1NNUA 2JIOA 2HF2A 3GX1A 1AZLA 3A32A 1WE2A 4TTJA 2UUCB 1Q1BA 1M6VB 2EZ4A 2JIPA 3AR5A 2Z1NA 5ALDA 1IEQA 1K92A 2VSXA 2IPLA 2WTAA 2Z09A 3DZDA 4GZLA 3HL4A 4QYWA 3RVLA 4B09A 4E7OA 1NZFA 2X58A 3FROA 5CW2A 5AR1A 3ZR4B 2JC3A 5I3CA 1M5RA 5FO1A 3EXG2 4D92A 3BTUA 5JROA 1BVUA 4MCHA 3PCXA 4DCPA 1A76A 5I9SA 1D8AA 3W6OA 3L18A 2PUHA 3HEMA 1G9TA 5HZGA 4KYUA 3COPA 4Q34A 2ZJ7A 3LQKA 4CHGA 1NVDA 4YJDA 4YAWA 2F3RA 5DGTA 5KBYA 4YMIA 1E92A 1GNQA 3NIWA 1TYEB 3PQ6A 3BWCA 4KO2S 2R6AA 2VDPB 3B60A 1OILA 2I1QA 2GNPA 1KY4A 1A50B 4NF2A 4Y18A 1DIAA 4RFVA 1C7JA 1QIDA 2P4EA 3D6TB 1AY0A 2GCEA 3HCNA 4NU8X 2AN9A 4R31A 4RVOA 5EIHA 4C04A 4GL2A 1NF2A 3V8RA 1MP0A 3BGDA 4REQB 4M36A 4IIJB 1D1QA 2WTMA 4RH1A 5DGDA 3UMYA 1PT9A 2Q8QA 5LQSA 2YNMC 4QHSA 4WBXC 3HO1A 4CBVA 1XTJA 1KQGA 2HXYA 1Q7RA 4QRDA 3VU9A 4QGHA 3DLHA 3N0RA 2FDRA 4UKDA 3IT3A 3PNKA 4HDKA 5DCYA 3VNAA 1ZMOA 1OD6A 4HAXA 1XDGA 3VJKA 1W30A 4V0KA 1AVTA 4I5DA 3G2IA 1WAMA 2GN4A 1UIMA 2NLOA 5FRDA 3ROEA 4D0GA 3O4FA 3LA6A 3THYB 3A6KA 5G0TA 3C5VA 1R4ZA 3D1LA 4P4NA 1JSZA 3IX7A 4NDNE 3FLAA 1X8LA 3VI3B 1SXHA 4V0RA 2QMEA 2VNKA 1Z88A 2VCHA 4C6TB 1KP2A 3PJDA 1LS6A 4BFSA 1N5LA 1LK5A 1QSGA 2DQKA 1L6IA 1RLMA 5IULC 3KR1A 4B3HA 2BKUA 1RXCA 4I5EA 4PHFA 4LV5B 1GZ3A 2EATA 2CL5A 3QEKA 2P4UA 3NHZA 5GZ1A 3IEPA 1L5KA 2G9ZA 3D0RA 3FKSA 3A31A 3G9ZA 1ECBA 5KYVA 4A10A 2IYTA 1NKVA 2V7XA 3O93A 1F4PA 4JOBA 4KDFA 1JIUA 1CLEA 4LAFA 2GSDA 2YBDA 3VAAA 3GEBA 4BO0A 5K7SA 4K9QA 3QUBA 5L45A 3TZKA 1O1YA 3MB8A 2Q8NA 4GP6A 4K46A 1SKMA 1SA0B 2JIMA 1OLOA 3G82C 3RRZA 3UWKA 1GNSA 2Q2QA 3GZ4A 3LYHA 4P53A 3A6JA 5FBHA 1KEUA 4P54A 5KWVA 2N42A 5TF4A 5EZYB 3L8FA 4V39A 1AF4A 2Q9UA 1UAYA 4I81A 1T8PA 4PX3A 1F0YA 2PVSA 2W2LA 1VA5A 2UAGA 2ECKA 4RY0A 4DCCA 4YRKA 2RJ3A 3OQIB 4AYTA 4ZI3A 4ZHQF 5IDQA 3QKTA 3FTQA 4KTVE 2QI9F 3M6UA 1PJSA 2ONZA 3HYRA 1BZYA 4QNRA 5TQ2A 5JSFA 1OX5A 1RZRD 3ZOKA 4RKRA 1YDHA 1Z2PX 4YGYA 4LCJA 4V1CI 4E4TA 1II8A 3H1TA 3LHSA 1SHKA 1MAUA 1Z3CA 3L7OA 4M0FA 1M2EA 4UPDA 1AX9A 3UJ9A 2EKLA 3K1JA 4UHHA 4IJVA 5CCXA 4YAIA 1VBKA 1ONPA 3LPNA 1PG0A 2HQ1A 3FF1A 5FWNA 2RIPA 3CF4A 2HFJA 4LX0A 3L46A 2ASVA 1H3FA 2W2NA 3BG5A 3RC9A 5ED0A 3U7IA 2AD1A 1KBZA 1SXQA 2ZP1A 4RZ2A 5HK9A 4QYIB 3U7GA 3HVKA 1JDTA 4FXOA 4ZU3A 5F5XA 3L41A 4DHWA 1DV2A 4RKYA 4PLPA 5EIBD 1HTTA 4DR6B 7YASA 3AVXA 3Q72A 1G17A 2RGNC 1FIUA 3I52A 3GLFE 1ONNA 2AKYA 4GICA 4ROTA 4BV3A 1KORA 5KNCH 3KSUA 4GDMA 1LF5A 1ORHA 2C1XA 2A5JA 3HY3A 5JISA 1Z73A 4DVJA 3PD1A 4K8RB 1K63A 2BP7B 4FFBA 2AC7A 4Q5IA 1XRMA 1PVOA 2WWTA 3FMOB 3FRIA 4KV9A 3QKUA 5IG2A 1KZYC 2W70A 4DDKA 4WNCA 5IXYA 1W5SA 4BPBA 1H3EA 5A9SB 1UIRA 3BXPA 3IPLA 5JWHA 3ZY5A 5BQ3A 1UJBA 3FNQA 3HXOA 4GRIA 1DQRA 3HACA 1AKVA 4G0OA 4J1TC 1UBNA 2KS6A 2YJZA 4JWTA 3LBYA 5FOQA 2GYYA 2EP5A 4E7PA 3M4YA 1IIBA 1KI1A 4LDQA 3B9QA 1GO2A 2PH3A 1A2OA 4H27A 4RJKA 3SKYA 3C6KA 5L95A 1GA4A 3PPVA 1IN7A 3R6LA 2PDAA 5JMTA 4MKHA 1G5HA 1G7CA 4KQEA 5A3SA 3T15A 1A27A 5KWSA 2UUBB 3BTOA 1UXJA 4QTUB 4UM9D 4CGZA 4G1MB 2C94A 1S5PA 3RSOA 4PYIA 5CD9A 3NT4A 5J5VA 3L7NA 4C30A 1KTIA 3AF5A 2PRYA 2HEGA 4RZXA 5FLYA 2AXNA 4N8SA 5GV8A 2DPGA 5IH3A 3SIXA 3ZDFA 4R71A 3GQBA 4X1KA 5B3LA 4K0KB 3NTLA 1WZ2A 1A8HA 1HO3A 4JA2A 4R51A 5AICA 3TNLA 2HGZA 3E9NA 5H9WA 2HY7A 3CXUA 3IPRA 9ABPA 2EBUA 2ZRPA 3VV3A 5BN3B 1M1NB 1XAIA 2TECE 3IR6A 1XYYA 1G60A 4MHOA 3FHLA 1P1RA 1QLHA 3OMXA 1DAIA 3T5MA 1KEEA 1KMQA 4AJJA 3PLAE 2RAFA 4R0NA 4BMDA 3ZU3A 5IC5A 4N4AA 4F7WA 1AHNA 5AOAA 2F3SA 1OJ7A 4I4NA 4IRXA 2ZUTA 3UMFA 1PX2A 3X43A 4XUCA 2VQFB 4GU5A 8ATCA 1A4RA 1TK2A 2GA9A 2QYSA 1UPCA 3CF4G 4X5OA 2WWRA 2XT6A 5IHXA 3F9IA 4A8JA 2FR1A 2J3QA 3L0CA 1MVNA 2RAVA 4MNTA 3ZWXA 1TZ2A 1V26A 1XDSA 2JIBA 3H4IA 2Z2KA 3KZOA 3P2OA 3QXGA 4IKPA 3SXPA 3DOIA 3EEYA 3WAJA 3DEIA 2R8EA 2KM1A 4WZ6A 1QQAA 1MAVA 4MS1B 3DONA 1OT5A 1YRBA 4HL6A 4P22A 3U3XA 4YUVA 3F1KA 1G5FA 4MJ7A 4U7HA 4WUTA 3RJ9A 4GZMA 1K75A 2DEUA 4NTZA 3QE4A 1QG4A 2QJOA 4NESA 3ZXIA 1S96A 2DGDA 4PGAA 5J2TB 2JGKA 2F4VB 4YJFB 5E9WA 2LW7A 2YOGA 5C1BA 2CB0A 3KJEA 3UKDA 1RABA 4BNDB 4R9SA 3WGYA 1V1JA 1POXA 2RK4A 1UZNA 4KRYA 5FA5A 3K0SA 2O5RA 3ZK7A 2XYRA 4CKCA 1U2EA 2BFMA 2YMLA 3HCAA 2PVCA 2DR2A 1VLZA 2OD7A 2JH8A 3TKLA 1FX0A 1PWHA 2HF8A 4H4EA 2VDRB 4HX5A 5C8YA 3B48A 3HR7A 2YQ4A 3P9CA 1A71A 2ZJBA 3FSEA 2M9MA 4N5DA 5ECGC 4D9CA 1XD2B 1K6MA 2FZ4A 3WRXC 4JNKA 4HN2A 3G5MA 3OZFA 2FCRA 3SOPA 4MAFA 4JJ6A 4FFLA 1YOVB 1JTEA 2X0IA 5COBA 5E4YA 3TL3A 3VKUA 5M2QA 2V8OA 5J5CA 1R10A 2IKSA 3DT6A 4F6LA 1I1QB 3S1AB 5HIAA 3RAFC 4MDHA 2V6FA 2GBFA 5TPWA 1GPLA 4G26A 3O26A 4V0MA 2ZAMA 1J0CA 1L7XA 5C8YB 4WGFA 3VAYA 1XDDA 1CD5A 3ICWA 3OICA 5A2QA 1IK6A 1WHTA 5IJAA 4AMZA 3CO5A 4DA6A 4DMFA 2BDUA 2YXPX 1N34B 1ZJ5A 1CZHA 2Y93A 3NTQA 3CLUD 1Q6YA 4ZARA 4DIDA 1E7MA 1SKBA 1ZU4A 1FVHA 4D97A 3TAUA 2B8EA 1N6HA 4L02A 1QYIA 2E87A 2IXTA 3EVBA 1P8AA 4MKRA 3SHFA 1E6KA 2M1XA 1BXZA 5DT2A 3ZDXB 5CA0B 5MHTA 4FU0A 1DIHA 5ICCA 5C18A 3QVTA 1QKKA 3OO0A 2C97A 1GYQA 2FXVA 2Y0EA 1BGWA 3D7RA 2WG1A 3F6EX 3JW8A 3R5SA 3ORYA 3M5DA 4OF4A 4BB9A 4PPNA 1D7AA 4X9XA 2ZVDA 3LVQE 1F2VA 4EG6A 1U7HA 4DKJA 1P4HA 1HLFA 4P7JA 4X44A 3L6EA 1VSQA 1H0KA 1F9AA 5ESDA 2R2GA 2JHFA 3VZPA 3WOHA 4P5PA 1XCBA 1RWOA 3TQOA 2ZM6B 1OMOA 3ABRB 5IAGA 2I7CA 4S1OA 5EZYF 1JJFA 2DBVO 1WEHA 3EIFA 2RJNA 1AA9A 3CNOA 1XMSA 5ELXA 4TMYA 1DINA 1K97A 4Q24A 2HA5A 3K5IA 2NSLA 4PZEA 4DYHA 2AOTB 2DFKB 5J4LA 4MP8A 1DADA 5ELMA 1QOZA 4WN9B 3ZGYA 5KTKA 1DE0A 1E0AA 3D2LA 2J41A 1NVAA 4R9RA 1Z75A 2W9XA 4W5HA 3ZOZA 4N3AA 4G5GA 5EZSA 2O50A 2QAGB 3GDOA 5L7WA 3JSXA 5BMOA 1OASA 3B38A 1XZCA 2ZBRA 4ZQFA 2A33A 2R68A 4BC0A 1TJ4A 2I6GA 4CFYA 2PLRA 5TMBA 5KWEA 5EJIA 1P77A 3MBKA 2Z4TA 4G3XA 1MPTA 3SP1A 4AXXA 2F1RA 3MJRA 3X1MA 3Q12A 3CZRA 1CIVA 16PKA 2C9DA 4GS5A 4RDHA 4DNXA 1AB5A 3OJEA 4QUEA 4FYWA 3UICA 3WKEA 1SHTX 4Y2UA 4RPCA 1I0ZA 3WTCA 4JL8A 2YBEA 1EWVA 4EVRA 2RCNA 1BX1A 2VPQA 1J8MF 1KDZA 1UMCB 2CD9A 2H06A 1CR1A 2AG8A 5JRJA 3PNOA 2XUGA 3YASA 1SU8A 3QNWA 1UF9A 3TL2A 5JY1A 3OMLA 2FSIA 3CNEA 4B6EA 1EPUA 3FMVA 2EQ5A 4BGVA 5AHXA 2NXJA 1N57A 2D59A 2YV3A 3Q1KA 3ANNA 4MZXA 5ULLA 4CZ2A 3AM5A 4WW0A 3SBDA 5HG0A 4R1PA 2OO5A 3PT9A 2VUHB 1QHIA 1WB4A 4JLWA 3UWSA 4XIJA 3GZTB 4Z7QB 3R3SA 5I5EA 1Z15A 3KQNA 3QFCA 3S5JA 3K0KA 1AO3A 2WY2D 3ILHA 4IDCA 1QR2A 3JZIA 1SCUB 2O8FA 2G28A 2JGDB 5B37A 5KUTA 1ZRMA 4XIGS 4LXIA 4QBHA 1C3EA 4L9AA 4QXOA 2YHSA 3LSYA 2XYVA 1E1QD 4R3UC 5CDFA 3BC1A 1C3JA 4M53A 4NHEA 1GT6A 3BFKA 4KH0A 5AKJA 1KDYA 3BB1A 3MMPA 3T95A 5AKYA 2BFDB 3ENWA 1YKFA 1E2NA 3K9FC 2G9QA 4OKIA 5AIAA 4HTFB 2WQ6A 1VHLA 3QUSA 5I7SA 1B00A 4A15A 1R0KA 4IVNA 1NRIA 4UHDA 2C9BA 5IFLA 2F9FA 1S7CA 3TCNA 3UWPA 5T57A 5ADVA 3NHLA 4H4CA 3SSOA 3HZHA 3QFRA 1Z2NX 3AY3A 3NDRA 1VDMA 3K30A 4R1QA 5AHKA 5A2GA 1WDLA 3F96A 1G8HA 1TLTA 4C20A 5K8UA 5JI2E 3RSQA 5L3QA 3EIHA 4W5QA 2OM6A 1JIIA 1R16A 3ADDA 1HV8A 3OT4A 4KXWA 1NBHA 2OV1A 2HUPA 4MYHA 4QVGA 5AI5A 1MJGA 1ZCBA 3DTYA 3H19A 2A9KA 3THSA 3VPSA 5ECWA 3IQGX 2BFAA 1KFCB 3R77A 1FFGA 1JKIA 2UYHA 1NV9A 5BW5A 2I9PA 3UEOA 4AYXA 4TLMB 2KHZA 4AN0A 4YRLA 4NJEB 4FEYA 4HVLA 1WF6A 1D3AA 4QXAA 3RIHA 3K9BA 1YR8A 2WI8A 1DDIA 4G1FA 2WYOA 2YXBA 3L7BA 4X64B 4BFLA 2GM4A 1F5SA 1D6MA 5AVVA 1GD1O 3WDLA 2H59A 3D4NA 1JEQB 3VR2A 2KI5A 1W36D 1PHRA 1B73A 1L4YA 1IONA 2P67A 3N3BC 3A9CA 1KEZA 2YWBA 2NZYA 4MUKA 3ZY6A 2ISSD 2VPZA 3DTVD 3WK4A 3KPJA 1A8QA 1LLQA 1FP1D 4G89A 3WE7A 4QELA 1H0RA 2PN1A 4OSOA 1GNLA 3ZJ5A 1RMQA 3KEMA 2G1AA 1DRWA 2R25B 5KCMA 2BVNA 2IU6A 5TR9A 3HVHA 1TVCA 4WKCA 3KZXA 3EQZA 1F38A 1CRLA 1T34A 2FOXA 3O83A 5HRUA 5G0WA 1W4AA 5DLYA 2WPDD 1O95D 3I09A 5IYZA 3AH8A 5DN9A 4UCXA 1YQDA 4ZV9A 2VDVE 4UVEA 1XJ5A 2EHJA 2FR0A 3GA7A 2Z2IA 2C3PA 2ZSKA 4LOHA 2XMCA 4R8SA 1XCJA 3G2QA 7MDHA 3UH0A 2C7QA 1D0VA 2EIHA 3I8XA 4PCAA 4BYGA 4FKBA 4A7PA 1W2HA 2WD7B 4AUNA 1G8AA 3FTPA 3RBVA 1D7OA 2DBQA 2BISA 2QTMA 3CLUC 1FCJA 5K3FA 4M88A 1QGZA 3FHTA 1G59A 2OP1A 4Q00A 5CJ2A 4HUTA 4TTIA 3LI2A 3GRAA 3U62A 4CN8A 3K0BA 5DXFA 5TS2A 4HPXB 3VR5H 3LC2O 5TT0A 4CF4A 1CY2A 1KFKB 2EC5A 1JNXX 1U8FO 4IHKA 3EDOA 3PEYA 2VHZA 3AYZB 1WZCA 2LUOA 2I67A 1A69A 3HI6A 1ZXBA 1C8LA 3OBBA 1JPVA 2C7RA 2XXAA 1JU3A 2O8DA 1SIUA 5CT6A 5BNTA 1F8YA 1E1KA 1OIVA 3STVA 4RXUA 3C2QA 3EVTA 1LGYA 3DAYA 3DB2A 4Q6BA 1E3MA 2JH3A 3W0LB 2R87A 4BN5A 2PSHA 3O4RA 4MVJA 5L4SA 4D56A 3T1HB 1EHYA 3Q3VA 1X42A 4B44A 1AK2A 5D7NA 2J6CA 1NVFA 3H2JA 5E6RA 1J07A 1M67A 2WYUA 1XHFA 3I73A 3IO5A 3LQ2A 4YUZA 2B4QA 5B58T 5AM5A 4DV4B 4FILA 4JVLA 3UO8B 1OV6A 1Z47A 1RYEA 4V3BA 1C4KA 2OYSA 4D8UA 1A98A 2W7TA 4KGXA 4RYLA 1TKAA 4B34A 3A9RA 2O06A 2QRJA 2RGUA 4PSAA 4ZO9A 3G3EA 4GNKA 3W34A 2SHKA 3T3GA 3QKRA 3KQYA 2QX8A 4DS3A 4EATA 1DXQA 1X39A 2NVUA 3KHSA 3NW9A 3R5JA 5KTSA 1EUQA 3EG5A 4KPYA 3OVMA 4XLZA 3SLKA 2X0DA 1GCGA 5A9SA 4LJ9A 3SPXA 1CRWG 2ZRNA 4DNOA 3L1JA 3HDVA 1E4EA 4MKFA 4N49A 4YP9A 4D81A 2A0XA 2W48A 1PDVA 2FVYA 4LNUB 4MVJF 1XCOA 1I3CA 5MN5A 4I6GA 5CAEA 4XIFA 4MS4B 4FBGA 1ODLA 3OLVA 5AM4A 4L5AA 5AXDA 3FF4A 1R9JA 4CR7A 2AK3A 2QYHA 4AY2A 3RANA 1W4CA 2PV7A 1KGDA 1TK3A 2LD4A 1MRNA 2O20A 2ZBVA 2BEUA 4KQ9A 4PLYA 4H3KB 4QXPA 5EMLA 5FDFA 5KYTA 1WQ1R 3OQ6A 3NBYC 5AHWA 2YHIA 3MRVA 2HJVA 4ND5A 2IS2A 1S89A 1VKHA 4YRQA 4KFRA 5L53A 1X0VA 2R5NA 5DULA 4K05A 4DG9A 4F1WA 3UOAB 1R5OA 1E79A 2CUTA 1FFWA 2YDYA 2WILA 4LNUA 2G82A 4H3HB 4G0UA 1AGNA 1FUIA 2RMKA 3HBFA 4QECA 4KI7A 2RGDA 3WBJA 3IR5A 3P9NA 4AS1A 4PYJA 3TG2A 5IBPA 3OQB