2AL7A

Structure of human adp-ribosylation factor-like 10c
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
166
structure length
155
Chain Sequence
SKEEMELTLVGLQYSGKTTFVNVIAVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GTP-like conformation of GDP-bound ARL10C GTPase
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords ADP-ribosylation factor-like 10C
total genus 55
structure length 155
sequence length 166
ec nomenclature
pdb deposition date 2005-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2al7A00
3FVQA 4C2UA 5AUNB 1XXHA 4LBYA 2RGDA 3B9QA 4YLGA 5KNCA 1VIAA 1QHNA 2ZVQX 5K8IA 2O8FA 3B9PA 2OAQ1 2AXPA 2Z43A 2FU5C 1XJ0A 2VP9A 3A4MA 1IY1A 2GXAA 2GK6A 3AKEA 1NRJB 3A8TA 1VG0B 2GWHA 5C4MA 1NN1A 1DPFA 2OCAA 2D06A 5AJWA 3SFZA 3R8CA 3C41J 3AF1A 3GJ8A 3H84A 1Z28A 4IHQA 1IY0A 4K8OA 1KGDA 1PV4A 2IBMA 2O5VA 5CJPA 3QNUA 2F9LA 3NC1C 3OEHD 4LX0A 1IAQA 1W2GA 3CPHA 4E5UA 1NLYA 1JJVA 1R7RA 3WYGA 3B1VA 3MRSA 5BYKA 3WNCA 1SXJC 2GCOA 5EE9A 1QG2A 2A5JA 3AF3A 1TQ6A 4QGFA 4NCKA 1Z2AA 1FNMA 1YHNA 1IN7A 4BLTA 2FMXA 3C5HA 3PUZA 3KDSE 1DELA 4Q7LA 3GFTA 4TL8A 3RYTC 1TF7A 2QPAA 4M53A 5DISB 4BRUA 4OI4A 1ELOA 3LRPA 5E7JA 3EASA 4EPXA 1YRAA 3SQWA 1SKQA 1XTIA 1FQJA 1J2JA 4Q1BA 3W6PA 3RWOA 2XJ9A 1W2HA 4TYQA 3TSZA 5DYIA 2WHXA 3QKUA 1I2DA 4RFSB 2PT5A 1RE0A 4EPTA 2QBYB 1GOTA 3U3MA 3THWB 3FFAA 3GLIE 3IEUA 2JLXA 2OM2A 4F93B 2NO6A 4RD6A 2DWOA 3MJHA 4NCHA 4A0GA 1Z63A 2JGNA 3TKLA 4ZCMA 1OJLA 4GI7A 4UXIA 1QZXA 2BV3A 2WJJA 4TMZA 5KSZA 3F0TA 4CT4B 1WA5A 3WRYC 3K8YA 3LAWA 3BH7A 4Q21A 2JJ2D 4QKQA 1T3SA 3VNVA 4Q02A 1BS1A 1MABB 3UXMA 2BBWA 2HXSA 5TDHA 5FI0B 3NBXX 2IWHA 2HYIC 2JLRA 4ESHA 4YDHB 4IKEA 4D26A 4MYHA 1KY3A 4URYR 3K9GA 4HATA 1LV7A 4AYTA 2IYSA 3OF5A 1MO5A 4KXFB 3GJ0A 4ZDJA 2ZSBA 2ZE7A 4HUQA 4AURA 1UJ2A 3OHMA 3H4MA 2G0NA 4WZAE 3EXAA 4XSHA 3ZIAD 4HDOB 4NL4H 1BKDR 3TNFA 1P60A 1H8HD 1VG1A 4Q18A 4HDCA 4EPRA 1PUIA 2JIZA 4XTCS 1TUIA 4BFSA 4RFVA 4DSNA 1TAGA 1Z29A 2AFHE 1AS3A 3KXIA 1ONBA 3Q85A 4WVFA 4PAOA 3W6NA 1VYUA 4PAQA 2VP6A 1IJEA 1TNDA 221PA 1CF4A 3WHLA 1H8EA 2RAPA 1LS1A 1W0KA 4CF7A 3G82C 1CBUA 2ZE5A 1KHTA 4H9GA 3RC3A 2OCYC 5G40A 1CJMA 1EGAA 2YWGA 3IBYA 4Q7JB 5KO2A 1NLFA 2ZJ8A 2LCFA 1OV4A 5EQTA 1QHXA 4GT1A 5L3RA 1E4YA 3LQRA 4L4UA 1CLUA 5FOSA 1TL7C 4F4JA 3NC0C 3PCRB 3B6EA 5SZIA 4US1R 5J4HA 1OYWA 5CM9C 3AVWA 4LK2A 2Q21A 3QXHA 3CW2A 2J59A 5GJVC 1N5JA 3PUWA 1A7JA 1UDWA 3BAFA 4QJ3A 1ZNZA 4HUQB 2ZRMA 3BJIC 4GZLA 3T1TA 4PANA 3MWKA 4KLZA 4LDJA 1SULA 2LKDA 4WZBE 4DWJA 1N5IA 4R71A 1N5LA 2MSEB 4NH0A 5DN6D 4OI0A 1M74A 3PUXA 1KSGA 2BCGY 3UKDA 4P4SB 3DOFA 1Q1ZA 3ECCA 3UWKA 1DADA 5CB6A 3TVTA 2R6DA 1B0UA 4DSOA 2C8VA 1XEWY 721PA 1GL7A 1XTRA 2G83A 1KSHA 2R6FA 4BFYA 4CZ2A 1X6VA 1HE1C 4JT4A 4KO8A 5EZ5A 1GNPA 4LPSA 1Z47A 1XU4A 1F6BA 2KJQA 3GJ6A 5CJ2A 4ARZA 3LA6A 3O8DA 2XTNA 2YZ2A 1OXUA 4PC7A 5FTNA 4US2R 1S0UA 2HUPA 421PA 3K0FB 1KAOA 1KJYA 1R2QA 2K5UA 1KKMA 1T91A 3B1ZA 3U3JA 5J4LA 2XTZA 2RB4A 5HE8A 4QOSA 4OQMA 1IXZA 3U3KA 1QHHA 3MD0A 3PUVA 2QM8A 1G4AE 2F43B 4IDNA 2C04A 2VF8A 2FV8A 1OB5A 3O8BA 4V03A 4Q9JA 4XIGS 4LZZA 4DLWA 3EPLA 4WAUA 4XD7D 2DCUA 4GZMA 2A9KA 4EFLA 5J47A 3QUSA 4FMCF 1CXZA 2WWIA 3KKOA 1P75A 1CP2A 2FE4A 3Q72A 2IUSA 1SQ5A 1KI2A 5EP3A 4DCNA 1JAHA 3VR3A 4JYCA 1E2MA 1VCNA 1Z22A 4W5HA 3B85A 1SGWA 3BBPA 4GMDA 4DC9A 3O8CA 4I4LA 3RWMB 4A0RA 1WXQA 2DYKA 4Q4HA 1RFLA 5FPYA 2VIIA 2BHRA 3RS7A 3VMFA 2FZLA 2WWYA 2QA5A 5HZHA 2QZ4A 4BZPA 4M1OA 2AL7A 1OIVA 4NP6A 1KI6B 1KO7A 4PQRA 4Z51A 5FPTA 1KK2A 2WKPA 2GJ8A 3CNLA 2BBTA 3ADKA 3F3YA 4PC2A 3WNDA 1FZQA 2WIAA 3MJRA 1GVNB 4CW7A 4UJ3A 5KDDA 1QVAA 1P73A 1YKSA 1E9FA 2QSYA 4FCVA 4LJYA 2IUUA 4ABYA 1IXSB 3QF4A 4O2LA 2BM0A 2ZTSA 3DDCA 3NXSA 2ZSEA 4QG7A 2B6HA 3B2EA 2GNOA 1F5NA 1D9XA 1DE0A 1T6NA 4DUGD 2CCGA 3FMIA 4B73A 1XEWX 1Z08A 3BH6A 2XNSA 2RGCA 4YONB 1E2KA 2AWNA 2ZUDA 1KIMA 1E4VA 1Z2CA 3UG6A 4EUNA 4XVRA 3EZ7A 1UEJA 5F9HA 3UANA 1AN0A 1TEXA 4JBYA 2ZUBA 3EZ6A 1J90A 1U9IC 3GQBA 5H70A 3TJZA 1E98A 1UKZA 2RGBA 4MKGA 5JCZA 4S2EA 1A1VA 1OKKD 1I2MA 2ASEA 3AKYA 2V6JA 4CDGA 1CR0A 1UAAA 1HA3A 1IN5A 3VR5A 5B30A 4OJKA 1DAFA 3IQXA 5D3QA 3FHCB 3K70B 2JJ1D 1KSJA 4L8GA 3QSYA 3U3OA 4DT1A 4OHXA 2VLIA 3C14C 3QBTA 3SJCA 2HJVA 4Y0VA 3ZVNA 1XZPA 3K0CC 4PR0A 4BGDA 4NYJR 4MRVA 1Z0FA 5JWRA 2QG6A 2B8WA 3FFBA 3FMPB 2OUKA 2ZR9A 3FB4A 1UKVY 4DBLC 2GXSA 1T0JB 3P20A 2ZUCA 3ZZTA 4GPTA 4TLDA 3CX8A 5KNBA 1SVKA 1UDXA 4C0KA 2ZRBA 2O8EB 4C0BA 1LVGA 1GL9B 1R8QA 1YZUA 2ZRKA 1IQPA 1TMKA 1XFAA 2D2EA 2HLDA 2XAUA 4MGKR 3ZD6A 4PPFA 1GRRA 1YR9A 5CITA 2IYXA 3OESA 3THXB 1XB2A 2GVDC 1NJGA 1UBGA 1RVDA 5ELXA 1ZBDA 3I4LA 2OFXA 5KSPA 3CR7A 4ARZB 2C99A 1W48A 4EKDA 4BFWA 3I32A 2IYUA 2J7PA 2W6JD 4M4SA 4TTPA 3PIRA 2ZSAA 3THXA 2J0UA 4YXWD 2G0TA 1TF2A 3OE7D 1XBTA 1OH5A 2VP2A 1ZW6A 3CB4A 4FIDA 1R0XA 1Y3AA 2R62A 4ILEA 3LH5A 2ZI6A 1I4TD 4B35A 3W5IA 2OILA 1N3BA 2OCBA 1F2TA 2RCNA 3IIKA 2QTVB 2A5GA 1DO2A 3QE0A 4NMMA 5HTKA 4QGHA 1RJ9A 4ACAA 3AVXA 4TLBA 2FPMA 3Q5DA 2ZE6A 3T61A 2BWJA 3X2SA 4ASUA 4DDVA 2ZI4A 2G6BA 1BYUA 4DT1B 1KI3A 2PH1A 1OH8A 4WXRA 5CM8B 2CNWD 4KYIB 3D6TB 1WP9A 2A5FA 4PFSA 4OYHA 3PUYA 3RS5A 4B71A 2F1RA 3VAAA 2HYDA 3T34A 1KI4A 2BIFA 2BOVA 3AUYA 3LXXA 4KV9A 2G77B 4JZKA 3C4JA 4DEYA 1UM8A 5BN3A 4ZO4A 1II0A 3TUZC 2EFGA 1ZUNB 2HF8A 4D82A 4W5JA 4URZR 1A2BA 1SZPA 1OXSC 3NHBA 1FMLA 4Q03A 2A2ZA 1C1YA 2G1JA 3T5DA 3X1WA 1I4DD 3HU3A 4GP7A 1FFHA 4K46A 3X1ZA 3ONWA 4HB0A 1W4BA 2BCJQ 4W5WA 2QORA 4QRHA 1JAIA 3SEAA 3D3QA 4OHYA 3KJGA 1DAMA 2WKRA 2JLYA 5BWMA 2J1LA 2ZRCA 5JLJA 1P4SA 1RW4A 1TEVA 2VP0A 5DI3A 4EJSA 4DRZA 4LRWA 3MMPA 1RJ9B 4JLDA 4QBIA 4ZKEA 2FSGA 3W5JA 5JRZA 1P2UA 1OIXA 3LY5A 2ZSFA 3NWJA 4CRWB 1N6PA 2JEOA 4HAVA 4DJTA 4YMVA 3ZS9A 5LD2C 5K8LA 4KITB 5K8TA 2UZ3A 3IHWA 2Q9CA 1NG1A 2IEZA 3TBKA 4PSVA 4CEJA 5BN5A 4Q48A 2QP9X 2XOKD 4M21A 1RZ3A 1NIJA 2J0UB 1G9XA 3KJHA 1RYHA 4MGIR 5FL3A 2Z5FA 2R65A 3IILA 2DFKB 5AK0A 2ONJA 2JLZA 4Q1FA 1L7VC 4RCZA 3VU9A 2Y8EA 1VYVA 5JMTA 3BRWD 2OG2A 3KJIA 1K6MA 4HYYA 4C3ZA 1KDPA 3OFND 3FKSD 1ZC3A 3QKRB 5FTJA 2WOOA 4B3FX 4GRAA 2Z83A 2ZJOA 4JLAA 4JLKA 4LBVA 1W36B 2J41A 4I1SA 3EZFA 5AJXA 1G6HA 1OXVA 3D7MA 4U00A 3AQ4A 1OFIA 2IWRA 1EFCA 1QDEA 2R44A 2YKGA 3MWJA 2ODEA 3KB1A 4EPWA 2HDNB 3FGNA 1QVRA 3R7WA 4J0QA 1HH4A 2H5EA 4UXHA 1S1CA 4JJZA 4V0KA 4Q1DA 3VX4A 1ANKA 1ZYUA 4D81A 3CPJB 3I8SA 2NIPA 3SNHA 5E7IA 3VU9B 2AKYA 4BQSA 2QROA 3SHFA 4PO1A 4W7SA 1IM2A 1KDRA 2RH5A 1RRGA 3FPAA 1J7KA 1NVVR 3A1UA 2CEAA 1D2EA 4TL6A 4C4PA 2IA5A 3QVUA 2GJAA 3CRW1 4AKEA 3RRYA 3X1DA 1G18A 2Z6VA 3D31A 1NF3A 3DL0A 2WV9A 1DAGA 1P5ZB 4GMXA 1JBKA 1NSTA 5EZ6B 1DVRA 1NKSA 3P32A 5EJEA 3PXGA 3UIEA 1KO4A 1S9HA 1D6JA 2C2HA 4DCUA 4A6PA 4MDEA 4IXNA 1JQLB 1BH2A 1XZQA 2G88A 4A0HA 1E1QD 3LNCA 1ZD1A 4US0R 4EPVA 1G8HA 1KY2A 1OSNA 3N5CA 3WNBA 5HPYB 5FL7A 1BOFA 3THYB 4PXAA 1G19A 1R8SA 4JVNA 3WMFA 2C9YA 2Q6TA 4QHYA 4DEXA 3VX3A 1U98A 3ZIAA 3A37A 3QENA 4HLUC 2XJ4A 2HT6A 1OFTA 3CIOA 1CRQA 2OESA 3C5CA 1H8HA 1JEDA 1UKYA 4DCSA 4DLRA 2BMJA 2PX0A 4OQLA 4WXPA 5JFGA 3IQWA 1FPMA 1RIFA 2EWWA 5CLQA 1E2FA 2NGRA 2WMNB 3L0IB 1G7SA 1XTSA 2DFNA 2GXUA 2QM7A 4B48A 3THOA 1IY2A 1G3QA 1VHTA 4NDZA 1US8A 5BN4A 2IXFA 2YVUA 4LJ6A 4L16A 1ZM7A 4Q1AA 3C16C 2OBNA 2F1IA 1XMIA 5CYPA 4TLEA 1ZVQA 5AUOB 2A78A 1HT2E 2GZAA 4LYHA 4CEHA 3AVVA 1A5TA 3RSOA 2JLSA 2EW1A 1KI1A 4PHFA 1NSFA 2FX3A 4OK3A 2IX3A 3VNUA 2ODNA 3GFPA 4Q01A 4F4IA 4O3MA 3TRFA 5DGXA 2VL7A 1G16A 3KKNA 1F3OA 2F1JA 1G1MA 2W2VA 4Z1MD 3K0AA 5JEEA 3KZ1E 2F1HA 4FI3C 1YJ5A 5L3QA 2V1UA 1MR3F 4LV5B 4KCGA 1NIPA 4B6FA 4KBFA 3V9PA 2F6RA 3GLGE 2WMOB 5KPJA 1DO0A 1E1RD 4HUTA 3RAPR 4TMKA 1C9KA 5FOXA 3J81k 3BFKA 4CGZA 1AQYA 1EWRA 4HZIA 4BLRA 4LI0A 2I3BA 2QNRA 4Q66C 4EDHA 1W5SA 3WY9A 5H68A 2I4IA 1EG7A 3CPEA 3REFA 4ZDKA 5AUPB 1FX0B 1MV5A 2A5DA 4IEIA 4ITRC 5LBIA 2VHJA 2A30A 3PG5A 5B2ZA 4B47A 2ZQ5A 1XX6A 1S1MA 2P6NA 4A9AA 1E0AA 1COWD 2QAGA 1T5LA 2N46A 4HEJA 1ZCAA 3NHAA 3T06B 2YOFA 4RZ2A 1AK2A 4P0TA 1GKIA 4E03A 4BEBA 4M1SA 2VHQA 2ZEJA 4BPBA 4P31A 4JIMA 4MYTA 3ZGXA 1NLZA 2ATXA 1FTNA 2OLKA 5HKKA 2XXAA 1KTVA 1R0YA 3DO6A 1AKEA 4LOAA 1KAGA 4A0FA 5GJCA 2CHVA 4BLQA 3Q7QA 1GM5A 4Q4LA 4KSCA 3LBHA 4LC1A 4OHVA 2IYRA 3AVTA 2IYZA 2D7CA 3O47A 4XD7A 5SZJA 3SYKA 1Q20A 4AWXA 2WZQA 1QRAA 2BM1A 3RHFA 2YC4C 1XPRA 2R8RA 3K0AB 2CJWA 2GDJA 1DARA 3SQXA 3SR0A 3ZVRA 3Q7PA 4TMVA 2Z4SA 1W4RA 4ON9A 2FH5B 1HQCA 2JIZD 3NVAA 1KMQA 1MOZA 1PLKA 1WQ1R 3F5FA 2C5LA 4D2IA 3EIHA 4C0JA 5DNYB 4JLJA 3U7EB 1ZNYA 4PAMA 1N6IA 4AKHA 4BEJA 2F3TA 1W0KD 1DAKA 1O87A 1SVWA 2ZVPX 3OE7A 2B7CA 3QXCA 4N0DA 3R9IA 2ZXUA 1CJKC 8OHMA 2ZRAA 2OXCA 3K9HA 2PMDA 3NEJA 2PL3A 3JVUA 1C4OA 4TQUS 1N0VC 3QG5A 4FINA 2XB4A 1II9A 2WWXA 1F2UB 2QEQA 3LBNA 1XMJA 3FTQA 1D8TA 4Q9HA 1IHUA 3AH8A 4URVR 3AGQA 4AKGA 3CH4B 3HYTA 3M1IA 3I62A 4DLVA 4R9UC 4DB4A 3AVYA 3NDPA 4HAYA 4QXAA 3IKJA 2HCJB 4ZIRA 4YDSA 4AI6A 3A6PC 4U5XA 1P72A 2YWEA 1LY1A 2VHCA 4D0NA 2GRJA 2X8AA 1ZAKA 3L8ZA 4JLBA 5JS7A 4X8MA 4PPNA 1U9IA 1VYTA 3KTAA 3WYAA 5E4FA 2EFEB 1L4YA 4TYYA 3TQFA 1QF9A 2GEDA 3MGCA 5CDFA 3GLGB 2IS4A 5DN6A 4E22A 2IC5A 4B2LA 2BMDA 2MSDB 1ESNA 2GEUA 1Y63A 1AIPA 3C8UA 4TYPA 1TQDA 3FWYA 2OHFA 4AYWA 5CK5A 4FWTA 1DBSA 3ADCA 2FN4A 2YINC 1G8GA 1NN3A 3U60B 2DBYA 2FZ4A 1I4LD 3K0FA 4JT2A 3TVDA 3RDPA 2PZGA 4I1UA 1MABA 2YNMA 5JBQA 1EESA 4LV8B 1U81A 1CEEA 5FOUA 5FH9A 2V6IA 2ANBA 4M9QA 3JZMA 1OFHA 3FE2A 1Z3IX 2HLDD 2ZRNA 4M2LA 5FOWA 3CZPA 3RS0A 1HURA 4II7A 3DM5A 3QVVA 5FOTA 4HI0E 2W00A 2GCNA 3EWSA 2TMKA 1WBDA 3VQTA 3EARA 3I8XA 3I5YA 2V1XA 5CDFE 2CL7X 2O0HA 1MO6A 5C46F 2NZ8A 3AKDA 1PLLA 3QXXA 3I5XA 2I1QA 1NBMD 4QHTA 3ZQJA 4D0GA 1A2KC 4DDTA 4JVLA 1M7HA 1ZIOA 1H8ED 1W36D 4PHGA 4A2PA 4Q19A 4YXWA 5TV2A 4MRRA 1Q1QA 1Z6XA 4BRWA 1M34E 2AD1A 2XOKA 1Q1EA 3B8HA 3FOZA 3S1AA 4U7DA 1G291 3NBFA 2EU8A 4TSFD 1N0WA 1E6CA 1DG3A 4MKFA 3UWOA 5DH9A 5DO9A 1KSFX 1SVIA 4IJMA 4ZV4A 4CEHB 3GLFA 1SVMA 1JALA 3FKSA 4TMWA 4JYBA 1JEEA 2OO7A 4ZI3A 1WBBA 1RRCA 2GCOB 1VECA 4WA7A 4B6EA 3DKPA 5A4JA 4BFUA 1AA9A 4KODA 4G0NA 4QC2A 4JMPA 3B78A 3IO3A 1P2VA 4P4TA 4RCYA 4DCTA 2KE5A 1B23P 3W8RA 5EXTA 2JATA 3U6KA 2NMVA 2GETA 1E9AA 4XWKA 2ZYWX 3EA5A 4FN5A 2DY1A 1NG9A 1R4AA 3GJ5A 2WWWA 3T1VA 2CLSA 4Q9IA 5LD2B 4BASA 1GKUB 4JLMA 4DDWA 3K1JA 4LHYA 2NO0A 2N42A 1JB1A 3GEHA 1CRPA 1XMVA 1OYYA 2CVFA 2HJGA 5FBLB 3MLEA 2OFWA 4D4KA 2BEJA 3GJ3A 2QT1A 3NG1A 5A0FA 5TMPA 3VHLB 1IOZA 1NN0A 3SE0A 1L8QA 3CRVA 2B92A 1G41A 4TQ9A 4C7OB 1Q0UA 2CXXA 1S96A 3HYRA 3LW7A 3RANA 1NVVQ 1X86B 3WHKA 3SC3A 2RKOA 2QT0A 3ICEA 2V54A 3E5HA 3CWZA 5JI3E 1T8UA 5KUTA 2CJWB 4IDQA 2R2AA 1KO5A 1SKYB 5EP2A 5FUWA 1UADA 4Q5IA 5BW8A 4NHOA 4BWYA 4NYIR 2GJKA 2GXQA 1TPZA 4FD2A 4M1YA 4WZ6A 1WDTA 2IF0A 4IOLA 3RSLA 2GHIA 4D80A 2WOJA 1P3JA 3ZH9B 1HYQA 2FGJA 1VDZA 3ZJYA 1CR4A 3HP1A 2V3CC 2F43A 3R7WB 4CYMA 3KQHA 1KZGB 3FDIA 1QHHB 2W58A 1JECA 4RFSA 5CB8A 1ZINA 4ESVA 1Z8FA 3W3ZB 4ACBA 1N0UA 4Z54A 4U02A 5FUYA 1QHSA 1T9HA 2FNAA 3EPHA 2CL0X 4MQBA 1GSIA 2ZIAA 4DLUA 1M8PA 4P4UA 2GVZC 2J7PD 2W6JA 4PX9A 5CK4A 1GDDA 3A4NA 2OEPA 2DFTA 3EW9A 5FUXA 4KHZA 1HQYE 4POAA 5AJZA 2PX3A 1FOEB 2IXEA 4NKRA 1G64A 2IYLD 1SVOA 4IEEA 2ONKA 1R0ZA 4KSBA 1Q21A 2QSZA 1DG1G 5K8UA 3GD7A 1SXJD 5E95A 4Q9KA 4KI0A 1UPTA 1EFRA 2VA8A 1Z6GA 2QUZA 2H57A 4HDQB 2O52A 3L2OB 4NU0A 3LX5A 1WRBA 4B33A 3TW4A 5FPKA 1OW3B 5FBRB 2F7SA 4EQ6A 5C4GB 2WBLC 2QMUA 4B2IA 4DLXA 4LGMA 2IEYA 3PJRA 3U4QB 2WM9B 4ZCIA 4S35A 3UMFA 2YHSA 5EE1A 3TAHA 1E0SA 3TUJC 4UQOA 3AV0B 1HY3A 3KTAB 4MRPA 3RS4A 2H8KA 4RD2A 4V02A 4XVQA 2LWIA 1D2NA 3K0SA 1JI0A 5G3YA 1GRQA 3BK7A 2DFLA 2JCSA 2JJ1A 2QP3A 4URUR 4G5SA 3E1SA 3CF6R 3T5GA 1VPLA 5IF9A 2A3RA 3KQNA 3CBQA 3KKQA 4AG6A 3EWAA 4A4DA 5KSYA 1S8FA 2QY9A 2VO1A 4RY2A 5HCNA 1Z6YA 1KNXA 3I3SR 3P27A 1ZP6A 5F9FA 1ZM9A 2QMOA 3CKLA 2ZPTX 1G3RA 2HXYA 3PEUA 4DB2A 2PLFA 5C18A 1F48A 1L2TA 4C9BA 4M22A 4NYMR 4AYXA 3LFUA 2N1BA 5E7MA 4BZXA 2XEXA 1ZJ6A 1R5OA 2YOGA 4ZDIA 3THYA 2C9OA 5F3WB 1GL6A 1Q22A 1V5WA 1D2MA 3U4QA 2ZYTX 3TW8B 4HZUB 1CU1A 5UKDA 4C0HA 2IS2A 4QM7A 2FFAA 1N6NA 3WBJA 2R6CA 4IOMA 1T3HA 2CCJA 2REXB 4DZZA 4UNQA 3TAUA 3PENA 3EIEA 2AX4A 2W2XA 5TXGA 1BMFD 1YZKA 3KB2A 2ERXA 1V43A 2IYWA 4C30A 2FSFA 4A2WA 3REGA 4AKIA 3W34A 2YWHA 1AZSC 4EAQA 4V0LA 4ASUD 3AM1A 2G3YA 2W0SA 3UG7A 4V0ME 4M1TA 2H7VA 2WTUA 3G5UA 3QXJA 1NVUQ 3EC2A 5C2JB 2VEDA 1YU9A 2WJHA 4LWZA 4OKSA 2IXGA 3QKSB 3EZ2A 1FL9A 3BS4A 3QKTA 1TF5A 2JASA 2WAYA 3N70A 4PHHA 4PO9A 1NKTA 4LYJA 1HEIA 2FFQA 4M9XA 2WAXA 2FFBA 4B3GA 1M7GA 1TU4A 1U0HC 4KFRA 4QL3A 1GTVA 4BE7B 3QY0A 3L0SA 4HB2A 3L82B 4QFMA 3PQCA 3U44A 3IIJA 4CT5A 1U2RA 1AKYA 1OH6A 2GBLA 2JDIA 4PZLA 3I92A 3DMDA 4D0LB 3GLGA 1NJFA 1RYFA 1JR3D 1FQKA 2ZRPA 2ZSDA 4EPYA 4Q4JA 1T8TA 2FSIA 2XITA 2XSZA 2CHQA 2NTYC 1Z0KA 2YJTD 3CR8A 5FOVA 1BYIA 1GITA 4RZUA 1MRSA 2CHGA 5EP1A 4AIIA 4QBFA 1P9WA 3QG1A 5J40A 2ZJBA 3EG5A 4Q7MB 5GJBA 2VHTA 2JLUA 2NOAA 4DKXA 1XD2A 3TUIC 1E2HA 1U8AA 4JS0A 1J8MF 2IW3A 2H16A 3L0OA 1ZNWA 1ZIPA 2C95A 2O8CB 1OIWA 2R9VA 2FEMA 3W3AA 4CIDA 2ZU0C 4MRSA 2EVWX 2ZE8A 4Q47A 3ND9A 1G7TA 4MH0R 5DI3B 1GAJA 3MAAC 1Z83A 2X19A 1GG2A 1OHHA 2O0KA 2JA1A 1XEFA 4URWR 2ZU6A 2O8FB 3DHWC 2ZRHA 2XNDA 1W47A 3CO5A 4GP6A 2VQSA 1DAEA 1XRJA 2DWQA 1ZNXA 4Q4AA 1E79D 1XCMA 2HEIA 3OFNA 4G5OA 3W9YA 4DLSA 4D4JA 1R5NA 1YVDA 3MCAA 2WPDA 2J45A 1LNZA 3B1WA 4AD8A 3RS2A 1X1SA 5H1YA 4DLYA 2PLRA 4C0SA 1TADA 4Q4HB 1VTKA 3CRMA 1P9RA 2O0JA 4X8LA 1Z5ZA 4TSFA 1HUQA 4Z8XA 3RVBA 2OFOA 1N6OA 1AGRA 1YZTA 4PC1A 4Y0AA 4N3NA 4UNRA 2GESA 3KFVA 3MSXA 3OAAD 3B82A 4OI2A 4EFMA 4IVPA 2C77A 4NYJQ 3OIUA 2ZAOA 1HT1E 5EXXA 1EXMA 2R6GA 4IW3B 2PZEA 1Z0JA 5IHPA 5L3SA 1GUAA 1E2GA 2CVHA 2AD5A 4URXR 1YE8A 3GFOA 4EIWA 1IN4A 3T1OA 5CIQA 3L0PA 4MYCA 4LCBA 3QPWA 1XPOA 1JR6A 5KNDA 1G3IA 3IUYA 3QBVA 3GJ7A 1E1RA 1HV8A 3GJ4A 2J46A 4HB4A 2Z4RA 5EXSA 5L3VA 5FPSA 4P3YA 1MT0A 2P6RA 3AF4A 1CULC 1QHGA 2E87A 2WIBA 3E70C 1E1QA 2NG1A 4A8JA 4NZYA 3VR2A 4OHZA 4TWZA 2XXAB 3LWNA 2PCLA 5M04A 1W4CA 4ZPXA 2J5XA 4R98A 1EWQA 2VP5A 3C7KA 4RD0A 1NI3A 1CJUC 4I81A 1II8B 3LVRE 5DE3A 2FDCA 3SZRA 1COWA 1VKJA 3THWA 1TUEA 4W9MC 4DSTA 3ZLJA 3LO5A 3NTUA 5FTMA 2QBYA 3U7HB 3KXKA 2P5TB 3GLHA 1S3SA 3DOEA 4O0MA 3DEFA 5JHHB 2JLVA 2BKEA 2ZS8A 5EE5B 4WBSA 2OBLA 3K53A 1MRNA 4RVCA 1KMHB 2X77A 1E9CA 2P0EA 3QKSA 1Z0AA 2C96A 2CCKA 4QHSA 4TYWA 1U8YA 1DS6A 3JZAA 3OIWA 1RC8A 4DIDA 2IYQA 1EX7A 3A36A 1Z0DA 1FUKA 2GAOA 2A7QA 1X8KA 4HLQB 4UNSA 5EUMA 3GP8A 3EX7C 4TT3A 2F3RA 1U99A 1SVSA 1XDBA 1ZU5A 2ZJZA 3GPLA 1T5IA 4UNNA 5B57C 3ZQ6A 3BH0A 1YQTA 2AK2A 5EXPA 4JBXA 4V0MA 2ERYA 2VSFA 2FGKA 2WJIA 5KTYA 2EFCB 4PPGA 1E9RA 2BC9A 2EYQA 1LW7A 2BKUA 2MSCB 5J4YA 4Z1MA 4EFNA 4RZ3A 2GTPA 5J4VA 2WWGA 1U8ZA 1WMSA 1E9DA 3BB1A 3GEIA 3NH6A 2QMEA 1J99A 1IXRC 1X3SA 2ORVA 1FMJA 2GA8A 4OQNA 2V4ZA 2V8OA 2VYFA 2GF9A 3UATA 4WOPA 4D4LA 2DB3A 3AVQA 5CYOA 1W5TA 3EAQA 3IIMA 4QM6A 2ORWA 5DHAA 4MITA 1KI6A 3LLMA 3UMRA 2RGNC 1JPJA 4BUJA 5A5GA 3SU8A 4OQFA 5C1BA 3CUEF 5IK2A 4KAXA 2ZYUX 4CEIB 4BFVA 1G7RA 2CK3A 2LKCA 4B34A 1ZRHA 4D4MA 1UKEA 2FFHA 2FJUA 3DMNA 1W49A 1CJVC 1GIAA 2OCPA 3LV8A 4TLAA 4M9SA 2FG5A 2H17A 4XH9B 3JVVA 3BE4A 2QE7D 4LBWA 3BIFA 4L9WA 3LBIA 3ADDA 3ASYA 3EZ9A 1PZNA 1XTQA 3IPYA 3IHLA 5SZHB 2C9CA 4YC7A 2OBMA 4QJ4A 3CM0A 1XNJA 5D3MB 1G7CA 5J4KA 1DTSA 3R9XA 2NO7A 3MWYW 1EX6A 3U44B 4TMTA 2ZREA 1YR7A 2OXRA 1P9NA 2V7QA 2ZI7A 1BIFA 2EQBA 4LHVA 2GK7A 3A4LA 3VR6A 2IL1A 2QAJA 1KZ7B 2PCJA 4KYUA 2XB2A 3GLHB 3CWQA 2A5YB 3LQQA 4JKIA 4M1KA 4A15A 4TQAA 4TN1A 3UMSA 1XF9A 5KDOA 2GILA 4TLCA 4F91B 4Q9LA 1E2IA 1AZTA 4YMTA 3RRMA 2CLCX 4RKEA 2ZJ5A 1DAIA 5BXQC 2YV5A 2ZITA 3B7GA 4LJ8A 4DXAA 2PMKA 1XP8A 4OI1A 1XTJA 3ZDQA 3FHTA 2GF0A 4I1VA 1JXOA 1J70A 5CIWA 1E0JA 4OL0A 1CR1A 1VCOA 3QQ5A 1Z6AA 1WCV1 1DAHA 2FWRA 3QPUA 4N1AA 5JS8A 2D2FA 4Q1EA 3QI2A 1AS2A 3OEHA 5HE9A 2NO1A 4GL2A 5DSZA 4QBHA 1BMFA 1G3MA 4LYAA 2ZI5A 1ZM3A 1OFUX 3BXZA 4JLNA 1G5PA 3SYNA 4BLPA 3LX8A 4FMDB 3CX6A 2QPOA 4LJ7A 3T1QA 1S4QA 1F60A 4Q00A 1KJZA 3CRQA 1E2DA 4EJSB 1R10A 2CMKA 4MUAA 4RSGA 5D3MA 1KO1A 4KLNA 2IS1A 1E0KA 1GFIA 2CLDX 2AKAB 1RRPA 2IYTA 1G5RA 5FTLA 1D5CA 5DIFA 3EPJA 3IBGA 2QGNA 3QXSA 1SKYE 3TSOA 2WKQA 4PQFA 1YZNA 2ZANA 3BB4A 2ZJAA 4P32A 2DPXA 2NZJA 4B3BA 4ZIRB 3TH5A 5JECA 2VSXA 2WWFA 2NPIA 3AF0A 1PUJA 3V4FA 1N2CE 1QG4A 2PJRA 1G8PA 3EA0A 5JJIA 2GKSA 3ZS8A 3ZVLA 1E2EA 2C98A 2H1LA 2RMKA 1ZD9A 1D9ZA 1W0JD 2IK8A 3CLVA 3HJNA 3MG9A 3SOPA 4CEIA 3R9WA 2J0SA 1F2UA 3R20A 2WJGA 1P2TA 1E99A 3LXRA 3B13B 4UNPA 2NPFA 4BECA 4IRUB 4C7OA 1EFTA 4WIAA 2ZJYA 4TTRA 1KKLA 4DVGA 4A92A 4H1UA 1E2PA 4I99A 5JZVA 3NEYA 1OXTA 1E2NA 1UF9A 2WSSA 3AP2A 1NMYA 1IJFA 2W6ID 5LB4A 4FMCB 3PV0A 3AUXA 3TK1A 4AG5A 3FKQA 2P65A 4NONA 4DDUA 5JEDA 1GNQA 3CNNA 1N6LA 2DR3A 1WE2A 2HT1A 2IUTA 5FPHA 4QNRA 4EQ6B 1XJCA 2CL6X 2QP4A 2YC2C 1NBMA 2HF9A 2VRWA 4MRNA 3Q5EA 3EC1A 1P7CA 2SHKA 2HV8A 4RD1A 4X8OA 4F92B 5LDDC 4NPHA 4XVUA 3B5JA 2DWPA 5JI2E 2QTHA 1M1YE 3PITA 1IN8A 2OSBA 3KQLA 2QPTA 3CH5A 2EWVA 2VPPA 4DCVA 1LF5A 3GEEA 3BFVA 1JR3E 1KOFA 2FEOA 2QRZA 2IYYA 1WF3A 1N6KA 1Q3TA 2AWOA 4NTZA 3U6BA 1VHLA 5F98A 3OEEA 2EFHB 2NO9A 1GP2A 4FMDF 5G41A 2W2TA 5E3HA 4FW9A 3SDZA 4AC9A 2BEKA 1H65A 1LS6A 3ADBA 3F8TA 4L5BA 1E32A 1FP6A 2REOA 2AXNA 4TMXA 3H2YA 1VMAA 4DLZA 2Q9BA 5DI9A 5TARA 4LC0A 1FW6A 4LYFA 5ANRB 4I1OA 4PSAA 3HR7A 5EP4A 1SHZA 3OZXA 3KKMA 1L4UA 2BVNA 1QBKC 3PEYA 2ZM5A 1Z0IA 2JDID 1TQ2A 3H0KA 4GFDA 4HAWA 2XZLA 3QOFA 3C15C 1E2LA 2AN9A 5KPDA 5JSZB 1LF0A 1JR3A 5G3ZA 5KU1A 3UPUA 2V9PA 2XSZD 5AUQA 3TE6A 4MGZR 1NMZA 1K5DA 2FPKA 4MGYR 5HR5A 2O8EA 1R0WA 1ZCBA 4A1FA 4Q7KA 1X8LA 2JJ2A 4MDFA 1OF1A 2PBRA 2GJSA 4G3XA 5IDVA 4HAUA 4NYMQ 3L8YA 3B1YA 4XOIA 4NBSA 4RKFA 2J87A 4CVNA 1BO6A 2G1KA 1S9DA 2XX3A 1W7AA 2YOHA 2REBA 3Q9LA 3DZ8A 2EFDB 1LTQA 3K9LA 3QF7A 4M1WA 4D25A 3QF4B 2ZAMA 3SBEA 1O3YA 3K09C 4KFTA 4LV6A 3MWLA 4OK6A 2BBSA 1CIPA 1UEIA 1GZSA 1KJWA 3W6OA 2KI5A 3VR4A 4TZ0A 3LD9A 4LY6A 1A82A 1E2JA 1P61B 4JKYA 1US8B 4AY2A 2BMEA 2HCBA 5J5CA 2XNDD 4DHEA 1AS0A 1OH7A 1G5TA 1JNYA 1LFDB 2IHYA 2P5SA 3V00A 1NNEA 2XZOA 1ZU4A 3RS3A 1OLOA 3NH9A 3PR1A 5H8WA 3KXLA 5JHGB 3AP1A 4NCNA 3DKVA 5KOYA 4MA4A 2ZROA 2WVJA 2P2LA 3PVSA 1EFHA 4MKIA 1QHYA 1S3GA 3E2IA 4F4CA 3GLIA 3BD9A 4PQYA 3KL4A 3KUCA 4ZKDA 5FFMA 3OAAA 1E94E 1LB1B 4FWIB 3NBZC 3VKGA 4LBZA 1N5KA 2GJ9A 2QQEA 4GBMA 3PEVA 4M0LA 3SBDA 3U2QA 3S1AB 4M9ZA 4E09A 1IONA 3AP3A 3HPQA 2OZEA 4B3CA 1EK0A 1SXJA 1NMXA 3I1FA 1ZM4A 2D74A 4B76A 3FMOB 1EFRD 3WRXC 3A58B 5JWOA 4RD4A 1CJTC 2L0XA 2B7BA 4XWAA 1JPNA 621PA 1XD2B 4BFXA 3I73A 2B8TA 2UVQA 2DHRA 2CBZA 2B21A 5BQ5A 121PA 3L43A 3AVPA 2RGXA 1CR2A 1KI7A 4HB3A 1ZUIA 2QQ0A 4B3XA 2Q3MA 4R2IA 3SN6A 1GNRA 4IDPA 5KYKA 4YMSA 2PEYA 2X2EA 3DVLA 2YWFA 4EJSC 3LW8A 3ZZ0A 4BZQA 2VP4A 4MKHA 2RGEA 1CS4C 2ZETA 2JLWA 4A8JC 4XSGA 1DOAA 4JJKA 2ZYVX 3ZYCA 4FCWA 1ZUHA 3RLFA 3TSWA 4WW0A 4P4SA 3EIQA 4BLOA 2ZJ2A 1XEXB 4JVSB 4PZYA 2C03A 2QENA 4TL9A 5KHOC 3IDQA 3SYLA 4KU4A 1Z6TA 1GRNA 4JLVA 2J0QA 2IHBA 5FBQB 2XTMA 1T3LA 1II8A 1P62B 3CRRA 4A36A 1G4UR 1PJRA 3KKPA 2BMFA 3T12A 2ZI9A 4LJ9A 5BYJA 3VKWA 5GVSA 5HZKA 2IS6A 3BB3A 5CLLA 1R5BA 5L3SB 3PFIA 2IF2A 3BFXA 2ECKA 3KQKA 3P4YA 2VSOA 1NL3A 3QEJA 2VF7A 4A8JB 1VCIA 2ZR7A 5IT5A 1XJQA 4B2PA 3VHXA 5G53C 2QU8A 1NN5A 2D4HA 1NVWQ 4G1UC 3CONA 1YR6A 2FF7A 2PZFA 3K70C 2MMGA 1JJ7A 5JJLA 4G5RA 3U7FB 4QGGA 3QPVA 4DSUA 4R2HA 4GSYA 5EE0A 1YRBA 3U5ZB 4QGAA 2ZRIA 4IXMA 2Q9AA 3DPUA 2UZIR 3TR5A 2W0MA 2QL6A 1YZQA 4HLDA 4UXJA 3I61A 4P33A 2ZRLA 1KK1A 4ZDWA 1KDTA 1SVLA 4NCJA 4L15A 4JBWA 5EUQB 2E9SA 3N2IA 4UJ5A 1E69A 4FXPA 1VG9B 3BGWA 3WMEA 3TIFA 2GZHA 1Z07A 4Q4AB 3KFXA 1E3MA 4JL6A 4B44A 3TQCA 3PEWA 2QN6A 3R8FA 3CNOA 3RNLA 4A6XA 3GLIB 4C0AC 3CZQA 4GNKA 4O25A 2NQ2C 4PTLA 2QGZA 2WWHA 3QIAA 4LHWA 3AVOA 1U0JA 1N25A 2F9MA 2Q3HA 4GOXA 1NY6A 1EFUA 1K5GA 3BERA 3GCGA 1FP7A 4A2QA 2ZRDA 3GMTA 3HPRA 4YMWA 3BORA 3B60A 3X1YA 3V4RA 1Q1BA 2CE7A 4GDFA 2C78A 4DUGA 4BFZA 2KWIA 2VBCA 3VR1A 5IK2D 1PLJA 2RGNA 2XGJA 1KI9A 1W1WA 3TGPA 5JRJA 1XPUA 2CK3D 3QEOA 1KYIA 1KO8A 2GEVA 3OIYA 3HDTA 4BFTA 4DIEA 4JSTA 1GILA 3MFYA 1AM4D 3RRNA 1XD8A 4HLUA 5SZKB 2G9NA 4E07A 4FCTA 5KDLA 3VKHA 3GLFB 2BBOA 4Q4JB 1FNNA 3KX2A 4QBGB 4R7ZA 4HLCA 2JLQA 1RRFA 1OT3A 1T4GA 1M6NA 1OB2A 3HWSA 2WJVA 2O8DB 1Z06A 5AR1A 1VG8A 1XMSA 4QNMA 4M1MA 1KMHA 1KDOA 4JL8A 1UBCA 2P67A 2O8BA 4TYNA 5DHFA 2VTKA 1X1RA 3TR0A 5LB2A 1NVXQ 2QAGB 3A1SA 4G5QA 2GCPA 2O8CA 2ODWA 1XEXA 3P1JA 1XTKA 2BJVA 3MUFA 4IVQA 2QI9C 3I72A 4FMBB 3IO5A 4LJAA 4JVMA 1XD9A 2J0VA 4DLTA 2P3SA 4OHWA 3CX7A 1OPXA 4A82A 3ZD7A 3M0EA 5JSZA 2QRNA 4TZ6A 3WMGA 2W83A 3VFDA 5FBVB 2OAP1 3QJYA 2OV2A 3ND8A 4YMUA 5KSOA 1OXXK 1OHHD 4IVRA 1VCMA 4LPKA 1G8FA 2AFIE 4M8NE 4L9SA 4N0EA 1W44A 3DM9B 5GVRA 4G01B 3AVUA 1G6OA 4YQFA 5GJWC 5TB5A 3Q8XB 1G3UA 1W36C 1E79A 5L3QB 5DYGA 4IFBA 2FSHA 1IBRA 4C2TA 1YZGA 5FR2A 4NCIA 1KNQA 2WPDD 3NKVA 3WP0A 5JCPA 1G8YA 2WSMA 3P4XA 4KBGA 5AJVB 4B32A 3NDBB 1G17A 1G20E 4HZUA 3K70D 4GOJA 5FTKA 5TVKA 2J7KA 1W46A 2O8DA 1U94A 1KK0A 2FOLA 3SHWA 3A1TA 1SXJE 4PC3A 4TT3D 2ZI3A 3AEZA 3LDAA 1HE8B 2AR7A 4IDHA 1DEKA 3BC1A 4TL7A 5JJKA 3H1TA 1NP6A 2I1VB 3GLHE 3IPXA 2RGAA 3OEED 4B3DA 3ASZA 3FMFA 4B74A 1HTWA 1U0LA 2CNWA 5B58C 2XZPA 3GJXC 2ORIA 4LHXA 1J8YF 1IN6A 3SJBA 5FUVA 4NYIQ 4CEJB 2V55B 1XCGB 5EE3A 2QAGC 3HU1A 3W90A 3HU2A 3IEVA 4TTQA 1ETUA 3EPKA 3D8BA 4IOKA 1Q57A 4C0LA 2OLJA 3RABA 1U90A 3TMKA 3AF2A 3G0HA 4NE2A 2Q3FA 2D62A 2VH5R 5TY0A 4PC6A 5LPNA 5F2EA 3ICQB 4OBEA 4LUCA 2OE2A 1GKYA 2ATVA 1A4RA 2UKDA 2D3WA 1XXHB 3N2EA 2CDNA 2BJWA 821PA 3AB3A 2H92A 5AJYA 4PHTA 2KB0A 4F38A 2JAQA 2WSSD 5FI1B 4LJ4A 1ZM2A 1E9SA 4JSYA 2W6IA 3GLFE 4MUBA 2IT1A 3WP1B 1FTSA 1OKKA 5B64A 3NIBA 3BWDD 4OK5A 2H18A 1ESMA 3ETLA 1AQUA 4B75A 2Z0MA 3UK6A 2AHOA 4JLPA 5FL7D 2OT3B 3B1XA 3ZZUA 4F7WA 3OIVA 1XWIA 4HAZA 2FA9A 4KVAA 1MH1A 4RZXA 4AK9A 5IRCD 1ZD8A 4LJ5A 3K0CA 4KFUA 1RPZA 2GBLC 2YYZA 3LLUA 5P21A 1AGPA 1SHKA 2RHDA 1Q44A 1E9BA 5AWFC 3SI7A 4KVGA 3T15A 5DLQC 5L8VA 1E9EA 2WICA 3BOSA 1TQ4A 4RD3A 4C0QC 2QMHA 4HSEA 1JXMA 521PA 1CKEA 1N6HA 1TX4B 4UKDA 1MKYA 2P6UA 3WYFA 3A1VA 3AGPA 4PO8A 2X1VA 1F2TB 3SJZA 4KJZA 2X2FA 3KUDA 4OQXA 4Z8YA 3SFVA 4XWOA 4QJ5A 4V0OA 2D7DA 2ZR0A 1FUUA 1VIYA 1ZC4A 4ZI2A 4OJQA 2WJYA 3A1WA 1Q3HA 1TU3A 1XXHE 1FX0A 2E1RA 4PSKA 5HCIA 3ZVMA 1K8RA 3QKRA 2GAAA 3LVQE 4G5GA 1PVOA 1RKBA 4V0NA 2RGGA 4HAXA 1WB9A 2BDTA 2ZRGA 6Q21A 1R6BX 1MO4A 1GWNA 1E96A 1TTTA 1MO3A 1NY5A 2RHMA 3M6AA 4K81B 2EYUA 1YR8A 2J9RA 4MYUA 1P6XA 1M2OB 4LHZA 4GOKA 2CE2X 3VTKA 3P26A 3M4YA 2JJ8A 2Q0HA 2ZS9A 4B43A 1AJEA 1P2SA 3DZDA 2J3EA 4D6PA 3W8NA 3U7GA 2KSQA 4RJLA 3NBYC 4PZZA 1KI8A 4JLOA 3RRZA 4H1VA 1SXJB 2O8BB 3FHOA 3K0EA 1Q12A 4XJXA 3CF2A 3U3RA 3T35A 1NBME 1S2MA 2ODBA 1UBFA 4IDOA 2PT7A 3CF0A 4ERNA 4KFSA 2AK3A 1T0HB 1QHIA 2QTFA 3SS8A 4PPQA 3SJAA 1UBEA 2FPLA 2QE7A 2ZRJA 3KQUA 1ODFA 1W4AA 3IGFA 3X1XA 3KJEA 2ZS7A 1KK3A 3H86A 1N6RA 3Q3JB 3AKCA 2IYVA 4XTRA 1W0JA 1X8JA 2KBFA 3WBKA 4JL5A 3TLXA 2ZRFA 2KBEA 5JWHA 3RC8A 2VHUA 3K09A 3K9NA 4BLSA 1CTQA 3HR8A 4IFEA 1M7BA 4O2RA 4Q1CA 4X8HA 3WXMA 3FYHA 1OE0A 1YZLA 2R6AA 1JQJC 2V7QD 2F55A 1UFQA 1ZMXA 2ANCA 4LSGA 2PJZA 5FR1A 1E2QA 2GZDA 4IOJA 3U61B 1XCPA 5FBWB 2MMCA 5HKKD 4ZCLA 3O8RA 1G21E 2PEZA 5GADl
chains in the Genus database with same CATH superfamily
3FVQA 2IV2X 1F2VA 3G0GA 3Q7SA 3BDVA 4LBYA 3G7NA 4Q12A 5KNCA 5BSWA 2ENUA 2G8LA 2ZVQX 4Q9AA 1ISFA 4X63A 5FF9A 3B9PA 4ALLA 2O8FA 4BB0A 2PGAA 5I9MA 3C3YA 2FU5C 2VP9A 2GR9A 1DX6A 2WG2A 4GLLA 2GK6A 3ONVA 2WHRA 4KQHA 3LC1O 1K3FA 3PKZA 1ZK3A 4RIHA 4CV3A 3W6ZA 2O1EA 1XZBA 4UZEA 4COKA 3V2UA 4W4TA 1WHSB 3FX2A 1P91A 3GBVA 1RLIA 4DIUA 4LDAA 3DOHA 1Y5LA 2IBMA 4Q3BA 4DYDA 4QYWA 3URMA 2XGOA 3RVMA 1BX0A 3NUZA 1NLYA 1R7RA 3PXXA 4JBLA 4MPTA 3WYGA 1VB3A 3ZU5A 1Y6GA 3FJOA 1SXJC 3GFBA 1GZ4A 3LCRA 5EE9A 1KOLA 5CA1B 3V4SA 1NJ5A 4WESB 5SV2A 3AF3A 3QUBA 4QGFA 2NXEA 3BRCA 3E15A 2NQTA 2FZ5A 5ITZA 3IB3A 3JQ9C 3K6RA 3FRJA 1YHNA 3QVGA 3B36A 3HV2A 4REQB 2ISSD 3DVSX 1A5BB 1DEAA 1Q1NA 5HDQA 3C87A 5B1HA 3LRTA 1D7OA 4GX5A 4AXXA 5E7JA 3EASA 1ZAYA 5IPFA 2QD4A 1PL8A 4Y2XA 4ML3A 5HIJA 1YULA 5IDYA 3ZK7A 4BP9A 1JHZA 2DHDA 3COVA 4MQMA 4RPLA 3P5BA 4NARA 5DYIA 1GY8A 3I9V1 1UAGA 2WHXA 1EG2A 3V1YA 4RFSB 3D0QA 1SMKA 1UM9A 1MIOB 1X1TA 1A9OA 1SRQA 2NUTA 3IJEB 2E7ZA 3V4LA 1H85A 3GLIE 2X0DA 3T3PB 2JLXA 4F93B 3NEAA 4FYWA 3ZY5A 4KN8A 1PD1A 2ZXFA 3QYJA 2I6UA 4Y9UA 3TNLA 1OJLA 4GI7A 5ALYA 1QZXA 5H3HA 4R51A 4TMZA 3SQWA 1Z33A 1WXFA 1ZA1A 4YGXB 3RUCA 4CT4B 5C1DA 2ZB8A 4LOIA 1ZJWA 4NJMA 1X7ZB 3HY4A 1JEAA 4M88A 1A8IA 1EHYA 2ZTLA 3BEOA 1JMVA 1Z5GA 1WY7A 4Q21A 3VNVA 1Q15A 1QIGA 4B9EA 3PR3A 3REQA 2BBWA 2F48A 3ABIA 2J0EA 2UVPA 3GP8A 1KBZA 4FSXA 1BNCA 4ETNA 3NBXX 3UVEA 2IWHA 3NNDA 2JLRA 4ONEA 3OPYA 4YDHB 1O96B 3UK7A 2DX7A 2A67A 1HM5A 4MVJI 3BXPA 5JDIC 4Y6PA 1RWKA 3PXCX 3K9GA 1S02A 1MPXA 1CY4A 2NV6A 1VL8A 2CYBA 2UYQA 3IQEA 1O9GA 3PQEA 2IYSA 5GV8A 1ODCA 3NT4A 4HYEA 3JAWA 2B4KA 4RQUA 2ZSBA 2HL6A 3FCCA 5AK3A 3OHMA 3TQHA 2GFIA 4WZAE 9ATCA 2EKLA 3FLMA 3QVJA 4NL4H 4TKUB 1BKDR 1P1CA 4RTLA 2QG4A 3A32A 4IV0A 3TNFA 4PE5B 4YRSA 4HDCA 3HKDB 4PLWA 2JIZA 5AW1A 1JLRA 4YRAA 2RBGA 1SELA 5K4GA 1FUEA 1AS3A 1N4DA 2POCA 1RC1A 3KXIA 3Q1LA 4WVFA 1RQXA 1Q6YA 1P7PA 4Y2QA 1ZW1A 4L08A 1OZAA 3UAVA 1IJEA 2PBZA 3VO1A 4LXYA 5C3MA 1CF4A 2RAPA 2RI6A 4RMNA 3VAYA 1C9MA 1XYVA 4LRSB 2YN0A 1P0QA 1ESDA 1UJNA 2QW0X 3DEHA 1K08A 3DLPX 3KYDA 4WT7A 4A10A 4BJHB 4UTVA 1MOPA 1I6WA 3E22B 1XHEA 3BA1A 1L5KA 4CFSA 4YK7A 3RC3A 3RIXA 3IJPA 3BSFA 1CJMA 1EGAA 3IBYA 4Q0MA 2IZ7A 4WJKB 4D9JA 3PSAA 2ZJ8A 1EP2B 2LCFA 5L3RA 2Z2KA 1KPIA 1TM1E 3VISA 1NF9A 2XB6A 1O0BA 1SCQA 5EIOA 3OFSA 2B78A 3B6EA 3MLAA 5J4HA 1OYWA 2I33A 3PDIB 4IG9A 4R0NA 2A8YA 4XW2A 3CZ5A 1ZQ1A 2COUA 2Q21A 1ZN9A 3Q3GE 2O2DA 3G2QA 2ZSKA 3T1YB 5GJVC 3WE7A 3ZQUA 5M29A 2BCEA 3E4DA 3DT9A 4MJXA 2ID7A 1FJGB 1G21B 4MW1A 5ED0A 2HJWA 5BSTA 1ZNZA 1CY0A 3QYFA 1WX1A 3T1TA 2W6OA 4KYTA 4BMNA 3OJWA 4M7RA 1TJNA 2WIGA 2DBQA 3KLBA 1ZI6A 4NH0A 4PTZA 4ZHQA 1M74A 4OI0A 2WM3A 2ECQA 3C8HA 4RK6A 1I33A 4HAIA 2PH7A 4DR7B 1BC5A 3KPVA 3QEMA 4WRRA 4G8DA 1A95A 1Y3FE 3GY0A 4R7TA 1EGVB 1KQOA 1OWPA 4IDBA 1I7QB 2CXOA 1QZTA 5AVQA 2NU8B 1VRCA 4L50A 3DHYA 5IMBA 4KREA 4Q34A 2HREA 1X6VA 1RKUA 3WB0A 4INJA 3QJ5A 5IVDA 4A73A 1QZ3A 1ZGCA 1R3UA 1U1IA 5CJ2A 1WUKS 4QEDA 2R60A 3IP6A 1JILA 4US2R 3PPIA 4WMLA 1S0UA 2MU1A 4WV3A 2QD1A 4CODB 2HK7A 3LECA 2A14A 3B1ZA 3TOVA 3U3JA 1Y89A 1NQ5A 2I29A 5DYYA 4NHEA 4RZQA 5HE8A 5IABA 4N7BA 3QVLA 3AG6A 3VHRA 1IXZA 2PQ6A 4H6XA 1BDBA 1EAMA 4JROA 1E89A 2NPOA 1MX5A 4AB1A 3HKBA 4B4KA 1LI5A 1U2PA 2F8TA 4IDNA 2H2HA 4ZO9A 1UMDA 2C04A 2VF8A 1QS0A 3FZNA 3I9NA 4V03A 4Q9JA 4XIGS 2YDYA 4E5MA 1DRKA 2BSXA 5DWQA 4WAUA 1G2OA 1JHUA 4GZMA 4I50F 1XJ5A 2A9KA 4EFLA 1TW3A 1FNCA 1P5RA 3CUKA 3D4PA 3QUSA 4FMCF 3FZEA 3VPBA 1CP2A 2F67A 4HMPA 1X7WB 4YI3A 3DWFA 4E70A 5C1PA 2CFOA 2YBEA 2O1SA 4ZAWA 3KQQA 5LP6C 3VR3A 5JUWA 1Z22A 4HQKA 4A1OA 3HVHA 4PZ9A 3TGWA 1QLJA 1U3WA 3RWMB 4IS3A 4CLOA 1CUDA 1P17A 1E5XA 3HADA 1FFGA 2WP0A 3L01A 2VIIA 2BHRA 3IKLA 3E8MA 4OA8A 5FPYA 4BNJA 5HZHA 5E4JA 3TOXA 5K0SA 4M1OA 4TSKA 5G0VA 1KZHA 4FHGA 4MVJE 1X9IA 1JXQA 2VTEA 3IE2A 3ENWA 1GU0A 1KK2A 3A6KA 3F3YA 4XB1A 3MN1A 3SAJA 1D4ZA 3LYHA 3W2TA 1BGWA 4ENWA 1TLTA 3ND5A 4RF3A 1CUJA 1IYZA 4KOAA 4B6SA 2CGEA 1YKSA 1E9FA 2QSYA 5F1YA 1KJNA 2IUUA 1IXSB 2Z5VA 1HDRA 1LRLA 1Z4PX 5IASA 1QGZA 2ZTSA 3DDCA 1WSWA 3PFNA 4U1RA 3DAOA 4B9AA 2XTJA 5FLYA 3WC4A 1DE0A 2R8PA 3HDVA 1J8VA 1F06A 5JS1A 2JL1A 2O3QA 4NEQA 1NV8A 4LWOA 4B73A 2MR5A 3BH6A 4M49A 4UAVA 4LIPD 5L9AA 1AKNA 1DMRA 2P3LA 4YONB 4I3HA 3MAJA 1WF6A 1KIMA 1E4VA 1MJHA 3CUYA 3HDJA 3GEGA 1GCOA 1H2FA 5GY7A 3BXGA 1YNSA 2FWNA 3UANA 4ENSA 1AN0A 2GCIA 3ILVA 4JBYA 2RGUA 1J90A 5H70A 1E7WA 2XCSB 1P0CA 4RVDA 5JCZA 1ZD3A 1M67A 4F46A 3ILXA 1QONA 2ASEA 3EY9A 3OX1A 1Q0HA 5CEJA 4ZYVA 5L7TA 3QTBA 4OUDA 5DNWA 2P9TA 1MU0A 4IF6A 1WO8A 3R7DA 2ARKA 2BGMA 3HCAA 2VDQB 1DAFA 3RVPA 3ZWWA 2ON6A 1V1MA 3LE8A 2H1VA 4OXNA 3WJ7A 4D9FA 1TT5A 5ADWA 1KSJA 4ZYYA 2CFRA 1IJKA 2IUFA 1H2ZA 2HJVA 4Y0VA 2Q6IA 3K0CC 2W2MA 2C5GA 5TJ9A 4FC7A 4MRVA 1QG0A 2YNMC 4NZNA 4WPGA 3FB4A 4GMKA 4RMHA 4YT5A 3Q98A 1NDHA 2JFWA 2KQUA 4U2DA 1PO7A 3SBOA 1G6KA 3T95A 3TDMA 4EG7A 2VNJA 3LGAA 4RACA 3BWCA 3JRNA 2ZRBA 5CJJA 3S2ZA 3EQ8A 1E4OA 5E1OA 4MGKR 1VL0A 2FUCA 2X8WA 2ZTVA 1EINA 1IEXA 3ORSA 1FMCA 4PPYA 3TD9A 5CITA 5EJ7A 4L76A 5KNCD 1NJGA 2HO4A 1RVDA 3PGKA 1FSGA 5K1ZA 2PZBA 2XE6A 4J3FA 2Q99A 5HJ2A 1P81A 3V46A 4HV4A 4Y8VA 2QUHA 4P9NA 4EKDA 4D4IA 3A70A 2Q2OA 4UD6A 5EWMB 3DW1X 4BFWA 3ETJA 3I32A 1SCKA 2UYGA 4W1RA 4XX0B 2W6JD 3OQ1A 1E1YA 3TL6A 1C9EA 3LC0A 3THXA 2V96A 4YXWD 3PDJA 3H4TA 3N6XA 4RTOA 2PJDA 2WC1A 3OURA 5A6VA 5HUHA 1Z35A 3NTOA 5HVNA 4N48A 4DUZB 2R3SA 1K3UB 2HZ7A 1R0XA 1V26A 1NRIA 2D0PB 2R62A 4OXYA 1DIHA 2HHLA 3CEPB 1I4TD 3T0FA 2OILA 1PJZA 1N3BA 4RPKA 5ILOA 2A5GA 2IY9A 4P7KA 2P9CA 1TE2A 2JGFA 2VRBA 3CXRA 4QGHA 1RJ9A 4F06A 3J7AC 2FPMA 4CNQA 4QZVA 2BWJA 1L5YA 1LNSA 4DDVA 2ZI4A 4N5LA 5F3DA 1SEPA 2PH1A 5AK4A 3U13A 4JOBA 3BICA 4PGHA 4AZVA 3FIJA 4HP8A 5L53A 4UBOA 1QZUA 1GD1O 1ZK2A 2JCGA 2JI6A 4NE7A 4UU1A 3DWIA 1F8GA 3RS5A 3I5UA 4U9IS 3CB2A 5D5HA 4YHBA 3AUYA 3WL6A 4WLVA 4D8YA 4IJWA 4Q05A 4EUFA 3QW4B 4Z3OA 1NKVA 5H16A 4DV1B 3KS9A 3EVTA 3LQYA 3MJDA 1DXHA 2G5PA 4ENUA 1PR9A 1VJGA 3HKCB 3ZNOA 3M7IA 2HF8A 1ZUNB 2GPYA 4CUJA 4D82A 4URZR 3G9TA 3HNOA 3R2JA 5CVJA 5A0TA 2FCRA 3NU1A 2D2IA 1TJ5A 1VKHA 8LDHA 4G81A 3NHBA 3C3EA 4B6JA 1KARA 1FMLA 3NTQA 4JR2A 4Q03A 4BQPA 5A4FS 4ER3A 1FMTA 2OYRA 1C1YA 2VXYA 2J9GA 1YDHA 3JTMA 4CMEC 1I4DD 4GP7A 4XFJA 4H0FA 3EXG1 1RC0A 3FHJA 1FFHA 2VI5A 3RIHA 1YI1A 3USCS 1W4BA 3Q7EA 3PDWA 4UPEA 1HT0A 2AGVA 2LZ0A 1V7PC 4UE3S 5H3CA 1GKKA 1TTHA 1AURA 3D3QA 3DTVD 2VDNB 2W2KA 1FLAA 5EESA 1DAMA 4QWWA 2YN4A 2J1LA 2NU7B 4E1VA 4JIGA 1ATZA 1JQBA 1EEHA 1NYLA 1P4SA 4B4VA 1TEVA 1OYVA 4ZVSA 4ZVUA 5DI3A 4PICA 1XAHA 4DRZA 4XEHA 4LRWA 2H5JA 4KNVA 1UP6A 4JLDA 4QBIA 4ZKEA 5BR7A 2BZ0A 3LCJA 1IZ0A 1OIXA 2HMSA 2ZSFA 3DWGA 3LY5A 3NWJA 4M0FA 1ZONA 4NFSA 1C3LA 3L7BA 1IUKA 5E2AA 3DDOA 3WK7A 2IU4A 3HYSA 5ECGC 4N5MA 3FTNA 3O0TA 1B0ZA 4ZT5A 2UZ1A 1PT6A 1U9CA 3HDYA 4KR2A 4E5DA 1YC5A 2HRBA 3HGQA 4M21A 1RACA 5ARCA 3S27A 2GZRA 1MC8A 4CM4A 5JD6A 1RYHA 5JXGA 3KKZA 2Z5FA 1HTBA 2A57A 3IILA 2ZQZA 3OF3A 3IKVA 4RCZA 3VU9A 5JMTA 2Y8EA 2Q0QA 1LTHR 4GUAA 3H8SA 5BOSB 1QFJA 5CB0A 1L5WA 4C3ZA 2RE8A 4NZ9A 2ZUVA 3DOCA 5T3UA 4KPFC 2WIJA 3CE9A 4XUGB 1E6MA 5E6UA 5FTJA 5JMPA 2Z83A 2J31A 5AJXA 2Y1OA 3OWOA 4WXMA 3GDHA 1QYVA 2E4VA 1NVGA 3TFQA 1OWLA 3B12A 4LVNA 4ECEA 1SEVA 4BBJA 1ZY2A 3KCQA 1CHNA 2ZBPA 3MWJA 3P9QA 4MIEA 2ODEA 1C0IA 2QHXA 3KB1A 4G0OA 1FYWA 1EFVB 3F5MA 3CRZA 4ETIA 1QVRA 4YR9A 4J0QA 1HH4A 2PZAA 3CR3C 2EQAA 1RRVA 2GN8A 4NDAA 2W2OA 3IOBA 3TRHA 4JJZA 3UMCA 1DFIA 2EF0A 4HKTA 4GVPA 3S2GA 2C4NA 3QBJA 4D81A 2NIPA 5ULLA 1YVRA 4ZOCA 3EBLA 1BXGA 3GLSA 2B9EA 2H6EA 2AKYA 5H4HA 3KQOA 4Y1RA 3N3BC 4PO1A 4W7SA 2AI3A 4O4LB 3G2KA 2VZ8A 1V1RB 1OBVA 1B16A 3PQDA 4AZ3A 2CEAA 4A6EA 4C4PA 5IX8A 3MOIA 3QVUA 3CRW1 4FS8A 5A02A 1HE3A 1W8IA 1N2SA 3D31A 3QY9A 2HPVA 3DL0A 4CQLA 3IVGA 1JBKA 5EZ6B 1DVRA 2DPYA 4Y98A 3UJ8A 3WQHA 1KO4A 2PT6A 2IY7A 2QX6A 3PGVA 3N6VA 3R0XA 4RK7A 1D6JA 3RFTA 4DCUA 5L95A 4MDEA 1BH2A 1LZLA 2G88A 5C8DA 4IYJA 5LUBA 3TLCA 3CF4A 4US0R 2DUWA 1G8HA 2VRNA 1ZK0A 2YR0A 3N5CA 4WZAA 3WNBA 3D8TA 2X0NA 4PXAA 5HPYB 3LT5A 3VHQA 5M2QA 1QC5A 2JIQA 2Q6TA 3GGJA 3QLUA 1V8PA 3A37A 3E1KA 2GK4A 5LJIA 4HLUC 4MJ7A 4XWWA 3KDAA 2AMLA 3WL5A 1RPZA 1CRQA 2HPAA 4ER0A 3UNXA 3F8WA 2PAFA 3FTDA 4DCSA 2HFKA 3RTAA 4DF3A 3OTOB 2O0LA 5JFGA 3DFZA 3PGXA 1FRZA 1GGVA 1OBFO 2Z8XA 2DE0X 4G36A 4GPD1 1RJWA 1U2GA 1GNTA 3E0XA 3EAFA 3PUKA 1I1NA 1PR2A 5E1DA 1XTSA 2I7DA 2DFNA 4BJ3A 2AOTB 2G4LA 2IEAA 2QN3A 4KPGA 1JKFA 2GI4A 3THOA 4P80A 1OAKA 1Z34A 4BTEA 1G3QA 3PDUA 3BILA 4UAUA 4NI5A 3V8NA 4EGAA 1ADCA 3KTFA 4P93A 3O91A 3OZUA 5BN4A 2YVUA 4O6VA 3H9EO 4ZU1X 5CFNA 3HXQA 5CVCA 1XMIA 5CYPA 2ZWMA 4GXTA 4G85A 3ZBPA 3JWGA 1YL6A 3Q5GA 2MINA 4LYHA 4FQ7A 3P9KA 1OR8A 4RA9A 2A9VA 4AULA 3S29A 2I4TA 3KEQA 3DAHA 3RSOA 1ZSYA 4INPA 1KI1A 1RHQA 3QUQA 5IU6A 4Q01A 4F4IA 2EP7A 2W71A 2HFJA 4HN9A 1M0EA 1EUCB 5HFNA 3PQ3A 3FNQA 3PE4A 2EWMA 3KKNA 2EAUA 2F1JA 3BK2A 1WEKA 5YASA 1KYVA 3SC4A 1MR3F 1NIPA 3NPMA 5F1PA 1PFGA 1XA3A 1VDMA 3E7FA 3HCPA 2F6RA 4H27A 4I14A 4PNPA 2WMOB 1K8QA 1DO0A 5H9WA 2PNJA 1EE2A 4ZVPA 5A6SB 4DM4A 3RF7A 4ZI7B 3ED1A 3RV3A 3ZOKA 1ISJA 3BFKA 1P1HA 2C0CA 4N7JA 1AKMA 1DSSG 2YZMA 5HEKA 4BLRA 2IEDA 2IXAA 3UMJA 2QNRA 4Q66C 4EDHA 4EHKA 1W5SA 2PG3A 3WGTA 1PUXA 4MR9B 4C22A 3DMRA 2GKGA 2I4IA 4Q9NA 3IVRA 1C3VA 5AUPB 1FX0B 1MV5A 2QN8A 2IP2A 2A5DA 2QY6A 1JBEA 4ITRC 5TS3A 2VHJA 4Z9FA 1QK4A 5B2ZA 3DEJA 2RH4A 3H2GA 2AMFA 4KIGA 3B3AA 3E27A 5GPBA 2P6NA 5DVZA 4YECA 3BZBA 4TWJA 4Z99A 4E4YA 3I2JA 2H11A 4A23A 1T5LA 4IDDA 1VRWA 3NHAA 4M6WB 3GA5A 2P78A 5BV2P 1GKIA 4E03A 1HYBA 2OV3A 4LEIA 4KB5A 2DUMA 3IUBA 1NQVA 1ZVKA 2ZBFA 1CZNA 3FPHA 1FRQA 4JIMA 1KAQA 4CT0A 1P2DA 4DR2B 2XUJA 4MYTA 2ATXA 1KMNA 5MDHA 2ZYAA 4J03A 5CURA 1W88B 1CDDA 1AKEA 4ND7A 1UXGA 3IBCA 3BWEA 3KDPA 3L05A 1Z68A 3Q7QA 1A9XA 1NQOA 5I9TA 3IH5A 3NW9A 4MUIA 4LC1A 1AK1A 1FSPA 2O3RA 1UKBA 1YFKA 2D7CA 3I6IA 3O47A 3SYKA 4BZZA 3IE1A 4AWXA 2WZQA 3GRRA 2ILVA 1JJIA 2WFLA 3RJMA 1N7JA 3K0AB 2CZGA 4MAMA 4OLBA 5EKTA 3BYZA 1PJ4A 4ND1A 2RG7A 3OVMA 4BEVA 1NRXA 2OHGA 2WE7A 4HWSA 3Q7PA 1WB5A 1GN9A 4DMFA 1GKLA 4I6EA 3KQYA 5FWXB 2X1LA 5EHNA 3TX6A 1HQCA 2FP4A 2JGAA 1C7QA 1USVA 3NC4A 4NE9A 1Y1PA 3NVAA 1HRDA 5BMOA 4YHHB 3DHEA 2CZQA 1OROA 3GP5A 1ISHA 3KK0A 1VPDA 5AVXA 4W5TA 3CKKA 4MV9A 4XCVA 4JX9A 4RQAA 3TTSA 3U7EB 1FDTA 1UOPA 3L6RA 2Q5CA 1QJ4A 2W8BB 4JAVC 4AKHA 1U7XA 4FK8A 4BEJA 1W0KD 4N0DA 1GA1A 2ZVPX 3OE7A 1XDUA 5C7IO 4P3PA 2PL3A 4Q39A 4TQUS 5BW5A 5C5IA 2E4UA 5KJ1A 4AJIA 4FINA 3NLLA 2XB4A 3MTQA 2CDCA 2WWXA 3NBQA 2QEQA 3LBNA 3AH8A 2BH9A 3DE1X 5JTUA 4AP9A 3I62A 3ESDA 2W4IA 4LS3A 3AVYA 1MW9X 4D9NA 4HAYA 2BISA 4RWZA 3WLLA 3H1FA 3AETA 3GUVA 4YDSA 3ZYZA 4GECA 1NZFA 5EHXA 5JFOA 1PBTA 2M98A 1KEEB 3PNLA 3VR0A 3B52X 4CV2A 4D0NA 5AOVA 3PTLA 3HSKA 3L8ZA 5D6OA 4X8MA 4FLFA 3AB7A 4PPNA 1OQAA 1VYTA 1XTTA 5E4FA 4TYYA 1L4YA 2NZXA 2AT1A 3FNFA 3R0JA 4FOLA 4G4SP 4KQEA 3MGCA 2AI1A 4CIVA 5DN6A 1EFDN 2R8ZA 3AZOA 2XXJA 3W5HA 4E22A 5FIUA 5KVSA 4FBLA 4RGYA 3I0MA 4ZJUA 2QLFA 3SR4A 5FFFA 1ESNA 1A69A 2GEUA 5FHQA 3C8UA 1CS0A 4E12A 5KMGB 4B0PA 4FWTA 4MWCA 1GARA 1DBSA 4KXQA 2Z6UA 5E9QA 2C54A 1CIVA 2HAEA 2XUZA 4HN2A 3VNBA 2PR7A 5FA6A 3ZU3A 2FYTA 3K0FA 3SQOA 5KQSA 5HQ3B 1L8OA 3GROA 4PZEA 1NU8A 1F0NA 2OO3A 2VRCD 4FFMA 1N2JA 3VH1A 1NW9B 2Q3JA 4XX0A 5E9AA 5H9VA 3SHOA 3RS0A 2ZRNA 5FOWA 1YOVB 1USWA 5GINE 1RP1A 5FOTA 4IY1A 2GHQA 4M0EA 2W00A 3RTEA 4TMYA 2X5KO 3OCZA 2K2WA 1L4EA 3I5YA 2O19A 5CDFE 2AJ8A 3RSGA 2BZSA 3LPDA 2B99A 3JATB 1DX9A 3T41A 2O2ZA 3R5JA 3PUJA 4UDXX 2ROQA 3AKDA 3RLIA 1LRKA 1DAOA 2X5JO 1M7HA 3WIDA 1HDZA 2OWDA 1H5QA 2VUSA 3S6JA 3DDNA 4MRRA 1U3CA 1Z6XA 1WHTB 1WCIB 2IOFA 1EUCA 1MB0A 4P3XA 4W6ZA 3B8HA 1R6DA 1SXIA 1DEHA 2RK3A 3LUGA 1DT5A 1SU8A 1A5SB 4IIGA 4WFQA 3FOZA 4U7DA 1KVUA 1TCBA 1K0UA 3NBFA 4W5OA 1Y9AA 1TI7A 1N0WA 1CVIA 1E6CA 1Z8DA 4PZ0A 5DH9A 1NXVA 4OYRA 2ZYRA 2QDKA 2EKDA 2VK1A 3IPLA 4ZI7F 4EJ2A 1P7VA 4QYTA 1JEEA 4R0VA 2CB0A 1EIZA 2BM9A 1OYOA 4ZI3A 3EG9B 3N5KA 5F78A 1Y80A 3ZUPA 1RRCA 1RQRA 2GN4A 2ZJFA 2X8BA 4WA7A 2OKGA 1J42A 3FR7A 3FZGA 3MJEA 4GZ5A 2PD3A 2GN9A 1C3OA 4HXEB 4CN9A 4DYVA 5IMSA 1AUOA 3RC2A 4QC2A 2AOTA 4KEAA 4RTNA 3P9XA 1JIVA 2A9RA 3CINA 4GH5A 3IO3A 4P4TA 4LF9B 4YO7A 2PZMA 4ERXA 3WL4A 5HRCA 3JRWA 2X6RA 3AUSA 4BUCA 3U6KA 3AM5A 2O2GA 5AHRA 3PE3A 3VYVA 4D92A 3DLHA 3AR5A 3S0JA 1DZ3A 2ZYIA 1EZZA 3UYKA 4RTPA 3CGGA 3EVDA 4JUAA 1GKUB 2HU7A 5AKZA 2P2NA 2PH3A 3II6X 4GI5A 4J2HA 3KU1A 2FKNA 4LHYA 3UA3A 1RLUA 1WTAA 4BNYA 2ZSUA 3GEHA 4RE5A 2GAJA 1ZDMA 3CZCA 5DHSA 4EHAA 4K6GA 1NUAA 3MLEA 1C3JA 5HF5A 4EARA 2BEJA 3G6KA 2PRJA 3NG1A 4RV4A 3T1NA 1AV7A 3PJFA 3VHLB 1NN0A 3SE0A 3ZE1B 4BO6A 4C6HA 5I01A 4U7TB 4XWTA 2H0AA 1G41A 5JPCA 5EHZA 5CTAA 3CLUD 2CXXA 1WXXA 2JGMA 1X86B 1XZKA 2EDAA 4UEQA 3WHKA 4ANFA 2V54A 3E5HA 3CX3A 2O0MA 2XR1A 4S3MA 3W8FA 3C3CA 5KUTA 3B3FA 1KTIA 4CIXA 3HDGA 2HU5A 2XF8A 1PP4A 3A2NA 2R2AA 1HETA 1SKYB 3KL2A 3TW0A 4E2YA 1DPGA 5CG2A 3UGQA 3AY7A 2X1HA 4MR7B 3O7MA 2MHCA 4RYLA 4FD2A 4TTTS 1WDTA 1JRLA 4ZAVA 4IOLA 4AWAA 4Z9BA 1SN7A 4GD3Q 2X7XA 2H63A 4NICA 4RJIA 2ATCA 3VR4D 4B17A 4TOIA 1CV2A 1L6IA 4BU1A 4D80A 5BYAA 2W11A 1N32B 2XLCA 3LK6A 1HYQA 3N0XA 4IO0A 3CCFA 2E2WA 3FLBA 2FGJA 4M60A 1VDZA 1IIBA 1HDIA 5FWYB 3UXHA 3I6QA 4MW7A 1FFWA 1KZGB 2BFBB 4BQNA 4RC9A 5J2TF 3B5IA 4ESVA 1Z8FA 2R25B 1BXKA 2AFHA 3ID6C 3UJ3X 1N0UA 2Q3LA 2CVPA 4RO0A 2AOUA 3X1JA 4CQMA 2FW7A 4WA8A 4Z54A 4GPIB 4L73A 3ZWPA 4GBED 1EZ1A 3VJRA 1FX1A 3A0RB 2A4MA 1LPOA 5LMUB 3ZVKA 2CJFA 1M8PA 3NM5A 3UCXA 4P4UA 2J7PD 3FSGD 4PX9A 5CK4A 2PIAA 3EISA 3QMPA 3NOOA 4UFOA 4ZAYA 4NR0A 5M7EA 4BV3A 2UXBB 2XIQA 4P0QB 1RXIA 5AKYA 3MA0A 4POAA 1I2AA 5LR6A 1QIHA 4WK4B 4HEA6 3UB4A 3L1HA 3O8QB 3NVKI 1R0ZA 2AXEA 1S8OA 2QSZA 2DT5A 3AT1A 4KSBA 5I9LA 3T4XA 1QH8B 1C9DB 1D4OA 5AW9A 3X2EA 5HOEA 5JAZA 5BRAA 2H29A 3EIOA 1EFRA 3RTCA 3H6GA 1TVEA 2O7NA 3QFFA 3V2GA 1XQYA 1CJSA 1Q5PA 1U1GA 2H57A 2CEKA 4QXPA 2PX2A 3L2OB 4L5JA 4OLJA 3QVSA 4HGZA 1DDGA 5ALOA 1RADA 1T15A 1O4WA 2C5BA 2R96A 5K8JB 2D5CA 1YIAA 4CV0A 2O7VA 2D5IA 5I7VA 4S05A 2OGTA 3WYBA 1JQ5A 2FUEA 2IEYA 2W6MA 4HQNA 1NUUA 2WM9B 3R3ZA 2H1FA 4HL6A 4S35A 5JD4A 2HIAA 1G21A 3OZAA 5EE1A 4BVBA 2HMAA 3WYDA 4F71A 1M2HA 2FTKE 2G6TA 4H3SA 2PS3A 3KOYA 4MS1A 2PUFA 3H5AA 3AV0B 3ICWA 3RS4A 2PS9A 1FSZA 1QTQA 5JD3A 4RD2A 2VJBA 4MHOA 4W1PA 3I9KA 2LWIA 1ZWKA 3NATA 3QPBA 5G3YA 1GRQA 4JC5A 4GW3A 4YY3B 2QP3A 4G5SA 1NQUA 1Y81A 1ZN7A 5C5CA 4QX6A 4PNHA 2C2OA 4Z2AA 2ZBUA 4MMXB 4YCAA 4AG6A 4J9VA 3EWAA 2ZB2A 3ZH2A 1WMAA 2NVWA 1U7WA 3AM4A 3NCHA 4R8LA 4UQPA 2VSNA 2AC7A 3B6MA 4V2IA 4Z4CA 4X20A 2ZG6A 4DCMA 1GXSA 1P4JA 2AMVA 5KYYB 4CIAA 5F9FA 3QWIA 5BV1A 4MWEA 2AN4A 2OPHA 2IPMA 4AWBA 4BP1A 2XUQA 1QRDA 2B83A 2RHRA 5C18A 4HFJA 5CIYA 3TXYA 3QE2A 4NX2A 1ZGHA 2X86A 5TGTA 3D2CA 3X44A 4J91A 4C9BA 9LDTA 2W8BA 4LJKA 4FJ1A 5E7MA 4XLTA 4I6JA 5KTPA 1ZJ6A 2YOGA 1UODA 2XNJA 3NJ8A 1FFXB 2BFEB 1B1AA 1GU7A 5AICA 2QSJA 2O14A 3FPEA 1HRKA 3CSSA 2Y76A 5JANA 1B6RA 1QWOA 5UKDA 3DTYA 1ECBA 3E9NA 3TZQA 3WBJA 4ZRNA 2R6CA 4WE3A 3T7KA 3LOPA 2OB2A 1W96A 4JKOA 1T3HA 3C1OA 3GEDA 4OGWA 4RF5A 5E4TA 1N7GA 1YRWA 1GG5A 2RAUA 3PENA 3TKAA 2AX4A 3IAFA 3TGLA 3CUTA 3FTEA 2IU3A 3QX8A 2ERXA 4LN1A 1KZ6A 3FFXA 5FFNA 2F4VB 1SD5A 1XL0A 3GDGA 4C30A 1YQUA 2FSFA 3UYLA 4A2WA 4AKIA 2DULA 3QP9A 3ESXA 3NM6B 3SXUB 1PRYA 4TTVA 4X65B 1MJGM 5K3SA 3ZV3A 1SR8A 2B3TA 2G3YA 1AKQA 2ZXEA 3NANA 2EFYA 3F5DA 3KU4A 1XZFA 4WY5A 4WZBB 4YCBA 4M1TA 1N0IA 3L46A 1Q2XA 3M2PA 4C4OA 3ROPA 4OU4A 4R1TA 4D56A 3BJEA 5FLXA 2APJA 1JIQA 2D7JA 2VEDA 1NXSA 1K63A 1RWPA 3QKSB 3I5MA 3RVDA 2AC2A 2B8NA 3EZ2A 1Q6ZA 4YRLA 3K9WA 4OM7A 4R05A 4ES6A 3QKTA 4BUZA 4KXMA 4HQ6A 2WAYA 1E92A 2DHEA 3FWKA 3WDSA 2HTEA 4LYJA 4M9XA 2OGUA 5LWQA 1VMIA 4YTEA 4J4TA 4BZWA 1M6EX 1M7GA 4KFRA 3CMMA 1I7NA 3ILSA 3JQ8A 3LT4A 3PQCA 4GR9A 3IIJA 1IHOA 1UDCA 2AZ4A 1AKYA 2WTNA 3NUQA 4KDCA 4MV4A 4PZLA 3M83A 1TEHA 5FWDA 5G4KA 4ZEXA 5C0OE 3JQBA 2FPXA 3A4TA 5TMBA 5HKBA 2ZRPA 1TKCA 1FQKA 4BGIA 2HX1A 4Q4JA 1M0WA 3OZDA 1VM6A 1GFZA 1Z0KA 4BO5A 2VBIA 2YRXA 3CR8A 4KXUA 4PFKA 5A6SA 1MRSA 5EP1A 3ON5A 1YQWA 5AP9A 4YUVA 2QXUA 2WAOA 5J40A 2ZJBA 1UOEA 3EG5A 4MS4B 4Q7MB 5KVQA 5ESXA 2JLUA 4NCBA 1GNVA 3WA6A 1E2HA 5F7OA 2H1SA 2IW3A 3ZDZB 1AHHA 3O9ZA 1HT3A 2FEKA 2P4SA 4PYQA 4W8OA 3FYTA 4E6PA 2O8CB 4CV1A 1Z8HA 2RKWA 3K5WA 3S5JA 2OD7A 2R9VA 1S89A 3I0ZA 3NV9A 1KH3A 2FEMA 3GD5A 3W3AA 4PYRA 3DBIA 4JBIA 3OEWA 2ZE8A 4MRSA 4RWEA 4CIDA 4ZK2A 1JDUA 4K9OA 3FZQA 2GWRA 2JAHA 3E3AA 3PCTA 4ZPJA 5AW7A 1RYNA 5AQEA 3WQSB 1C1XB 5AFSA 1U2QA 5C80A 2E37A 4EGJA 1OHHA 2Y77A 3CH6A 1XEFA 4URWR 2O8FB 1NAIA 4D02A 2C97A 2ZRHA 3CO5A 1W47A 2A1UA 2UAGA 1FZTA 2FSSA 1G8AA 1YMUA 2QQGA 3C1TA 3D9QX 1LJUA 3VPFA 2O1XA 3K2QA 5AOAA 3SZ3A 4F9EA 1ULTA 2R1TB 1E79D 5ESDA 4R0MA 3BGDA 4M54A 1VJTA 3E2MA 3EZNA 2WPNA 3BWBA 3ZHQA 1PS8A 1RQLA 2IHNA 5SY4A 3DDUA 4D4JA 1YVDA 3ENVA 2WPDA 3JVIA 2PWZA 4AMYA 1E18A 3ZXXA 3D59A 3B1WA 4AD8A 5JAPA 2IV3A 1W85A 3RS2A 2BE7A 4MSUA 4EKYA 3CNQS 1J07A 3HNRA 4DNPA 1SCAA 2D5AA 1CYDA 3EDOA 1M1NB 3UAZA 4PC1A 2GYYA 3MJSA 4UNRA 1SQ0A 1W93A 2YW2A 3BJMA 3W1EA 2W98A 4D4HA 3IAS1 3OAAD 4N01A 1O94A 4IVPA 3VSEA 4IJKA 2ZUTA 2ZAOA 1JVBA 2AW3A 3VZCA 1EXMA 2H52A 3GH1A 6ABPA 2R6GA 2Z2XA 3AJDA 3AFIA 5KU7A 4DXHA 2BI4A 2CVHA 2XNCA 1ODLA 3ROGA 2ORED 1T3ZA 4G8JA 1F20A 1IB0A 1U9JA 3QPCA 4JXKA 3D4NA 5CIQA 3L0PA 3ZK9A 1WHTA 3QPAA 1CQPA 1ZOPA 4OO3A 1G3IA 3OIDA 1LPNA 3QBVA 1LU9A 1FBNA 2EBFX 3SDBA 4BGEA 2H48A 1UT8A 1FRVA 5ICMA 4HB4A 2Z4RA 1AQIA 3KO8A 5EXSA 2V5VA 3BJRA 5IJ9B 3N2YA 4QUGA 4E5SA 2H85A 1U1CA 1NNSA 3Q0TA 3C43A 1QHGA 1WCYA 2HKIA 3ODPA 2YUIA 4OHZA 2M1XA 4TWZA 5D7BA 1RYDA 3Q0IA 4J29A 1W4CA 2JHGA 2J5XA 4R98A 5GV7A 5LIRA 1EP3B 4RD0A 1B0PA 4FDVA 4WDRA 1NI3A 4M8IA 1CJUC 2FDCA 3LVRE 4RF2A 5IZ4A 3KAQA 3HJAA 5IDWA 1V5EA 4W9MC 5AKHA 3HVRA 3ZLJA 2QW1A 2QBYA 3IR5A 4NMLA 3U7HB 1XCLA 2P5TB 1S3SA 3DZGA 3DOEA 4O0MA 3IDAA 5JHHB 4C5CA 3L6EA 2L2QA 2OP1A 5LMZA 5DM2A 2ZS8A 2WDPA 1X1DA 2QV7A 3CY6A 5EE5B 4DRXA 3K53A 3IX7A 4LZLA 4RVCA 3NT2A 3RF6A 2P2DA 3REOA 1NJSA 3OTGA 1PKXA 3LLSA 3OQNA 2I99A 4KL8S 4ZQCB 2JIPA