2ALEA

Crystal structure of yeast rna splicing factor snu13p
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
132
structure length
132
Chain Sequence
MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLILEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NHP2/L7aE family protein YEL026W
publication title Analysis of pre-mRNA and pre-rRNA processing factor Snu13p structure and mutants.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 45
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2005-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2aleA00
1S72F 4BW0B 1ZWZA 3LWOC 3OBYA 3CD6F 3CPQA 1E7KA 3PLAC 3JAMM 1M1KH 3J7AR 3CC7F 3CCEF 1VQKF 2VGNA 3CCUF 1NMUB 3CCQF 3J81M 1YJNF 1W42A 2AIFA 1PXWA 3J80M 1KD1H 3N4ZA 1K73H 1YJ9F 4X3LA 1KC8H 3ON1A 2QI2A 2CZWA 2VGMA 4X3MA 3PAFA 1VQOF 1CK2A 3G6EF 1SDSA 1VQLF 3OBWA 2KG4A 3CCMF 3WXMB 3AGKA 3E20B 3CCSF 2BO1A 3CCRF 1QVGF 3VI6A 3NMUC 4C4WC 3LFOA 2HVYD 1VQPF 1Q82H 3NVIB 1JJ2F 3HAXD 1CN7A 2LBXA 3CCLF 1Q7YH 5G4VC 2LBWA 3HJWC 3CC2F 1K9MH 3GYQA 3I56F 2WALA 1XBIA 3V7QA 1X52A 1W41A 3RA5A 3NK6A 3CCVF 5GIPC 2QEXF 1VQMF 3IR9A 1Q81H 3LWPC 5DCVA 1H7MA 3CXCF 1VQ7F 5GANK 3CMAF 3G71F 5GAPK 3CG6A 1VQ8F 1RLGA 3V7EA 3CPWF 1X7OA 2KTUA 1W40A 3OW2F 1W2BF 2QA4F 5GINC 3G4SF 1YITF 5A2QM 1X7PA 5EWRA 2OTLF 3RA6A 3CCJF 3NVKE 1M90H 3SIVA 4TZZA 5GIOC 1VQ5F 3SIUA 4BY9D 1NJIH 2JNBA 1RA4A 1Q86H 1K8AH 1DT9A 1VQNF 1GO0A 1YHQF 2I6DA 5G4UC 1W3EX 1KQSF 2OHWA 2KTVA 3O85A 3FFMA 3JCMM 3E1YA 4NUTA 3LWVC 5IT9M 3LWRC 2OZBA 2OTJF 1VQ6F 1QVFF 1VQ4F 1IPAA 5EO3A 1GZ0A 3VMFB 3CMEF 3NK7A 1T0KB 5FLXM 5FJ4C 3MCAB 3LWQC 3N4YA 2ALEA 1N8RH 2FC3A 1YJWF 1YI2F 1VQ9F 3I55F 4LCKA 3CC4F 1GO1A 1YIJF
chains in the Genus database with same CATH superfamily
3MCQA 1S72F 1ZWZA 4O2BB 3F0DA 4ZI7B 5EB1B 5LYJA 2RB9A 4EB6B 3D00A 3CPQA 1UFYA 1E7KA 4ZHVA 2RHLA 2YXZA 4BVSA 1KNJA 5B8FA 3CC7F 4F6RB 3IKFA 4U39A 5BMVA 5HWEA 1PXWA 1OAPA 1NQ3A 3ESJA 4X3LA 3JATB 4I4TB 2GLZA 2CZWA 3F6MA 4O2AB 5IJ0B 3JASA 4O2BA 1VQLF 3OBWA 3C9SA 2KG4A 4EB6A 3CCMF 1QD9A 3AGKA 5EAZA 2CW4A 4B46A 4O4HA 4DXDA 3OONA 1U3LA 1JN1A 3NMUC 4FFBB 2CHSA 1VQPF 4I50B 3CCLF 1IV1A 3C8LA 4X20B 4NWOB 3GYQA 3N2KB 1XBIA 3V7QA 1X52A 5LXTB 3LDTA 3RA5A 3NK6A 3JALA 3RYFA 3K0TA 3QHDA 2BTQB 3S03A 5MN6A 4IIJB 3V3TA 2OTMA 4YJ2A 1Q81H 4WBNB 3P0ZA 5JQGB 2Q1YA 3CG6A 5CA0A 4X1IA 2OTLF 2QTPA 5GINC 2UYJA 2IAFA 1JFFB 3IEQA 3GHZA 4HNAA 5JCOC 2HP0A 1VK3A 1Z5WA 2CHTA 1CLIA 2CSLA 4IIJA 3SIUA 2AMTA 4BY9D 5C8YB 1Q86H 1K8AH 1VQNF 1RLUA 2VAWA 3C9RA 3IMPA 4ERHA 4TV8A 3O85A 2UZHA 5HY1A 4NUTA 4X1KB 2RHJA 2ZVYA 2ZODA 1IPAA 4ZOLB 2CWJA 3FPIA 3P4EA 3F0GA 1W5BA 1IV2A 3ERNA 2Z1TA 5JH7A 1YJWF 5LOVA 2HQSC 3VO8A 4BVRA 5KMGA 5ITZB 1IV4A 2HX0A 3CD6F 3VYUC 3RYIA 4BVQA 3LYBA 5GONB 2I6RA 5HXUA 2VGNA 4EI9A 1YJNF 3HKEB 1W5FA 3ZOPA 2P6YA 1KD1H 1K73H 1YJ9F 3L7QA 3ON1A 5JVDB 5CA1B 5KX5A 4G88A 3G6EF 1SDSA 3K12A 3RYCB 4B62A 3E20B 3CCSF 5HP8A 1QVGF 3VI6A 4X1YB 5J2UA 3S02A 5LP6C 2HVYD 1JJ2F 3UT5A 3RYHA 1W55A 3HJWC 2LBWA 1Q8RA 3B6NA 4IHJA 1TVKB 3I56F 3JAWA 3KHNA 1H47A 4TUYA 4TV9B 3CYQA 4C8EA 2QEXF 4B5CA 3IR9A 4BT5A 3E22B 4LNUB 4ZI7A 4ZHYB 2H8CA 5DCVA 1H7MA 3P10A 1VQ7F 5GANK 1SZQA 1QU9A 2H8EA 1FNJA 1COMA 4X1YA 3WJQA 2DT4A 3C9UA 1VQ8F 3V7EA 3CPWF 3F0EA 4KWEA 1W40A 4C8IA 4F6RA 2VXYA 3OW2F 1W2BF 1ONIA 3HAXD 1X7PA 2UYPA 5EYPB 3RA6A 3SIVA 4ZHQB 1M90H 1J7HA 3FBAA 3HKBB 3JATA 4I4TA 2BTOA 4TZZA 4BT2A 3M4SA 4O2AA 5IJ0A 5CB4B 3ZP7A 4U3JB 5FNVB 1W57A 1RA4A 1XRGA 4I55B 5MN5A 2I6DA 2HS0A 3CB2A 3LMEA 1KQSF 3JARB 5HP7A 2UYNB 3WGKA 3JAKB 3HWUA 4FFBA 5EZYB 4I50A 3LWRC 4DRXB 2IG8A 5LA6B 4X20A 3N2KA 1QVFF 1VQ4F 3VYSC 5CB4A 5LXTA 3VMFB 5FNVA 3CMEF 1T0KB 5FJ4C 1RQ2A 2DYYA 4I55A 1N8RH 5MN4A 3F0FA 2FGYA 1VQ9F 2UYNA 4WBNA 3N2GB 2VAMA 1YIJF 5JQGA 4M8IA 5EZYA 3OBYA 5LP6B 5LA6A 4O4IB 3VOAA 4B45A 3PLAC 1JFFA 1ODEA 5IJ9B 3WGLA 1M1KH 1SA0B 1VQKF 3VIUA 1XV2A 1QAHA 1NMUB 1U43A 1VHAA 3TD4A 3S06A 5C8YA 4BVTA 5IYZB 4C81A 4BT3A 3N2GA 2UYKA 1FFXB 2VGMA 1FSZA 1PF5A 3D01A 3PAFA 1CK2A 3QUWA 3WPXA 1VQOF 5J2TB 4O4IA 2G9IA 4X1KA 3WXMB 2HRUA 5AVMA 3RE3A 3CCRF 1JY8A 4G4YA 3DC2A 3KIZA 4R40B 1H48A 5EIBC 1R1MA 3WJPA 2HS4A 2HRYA 3LFOA 4G4VA 4ZOLA 1Q82H 3NVIB 3JVHA 3M1XA 5IYZA 2LBXA 5G4VC 3WGNA 1DBFA 4O4LB 3KE1A 3FD5A 4C8GA 2R751 1YQNA 4O4JB 3S0HA 1VQMF 4ZHWA 1KNKA 5ITZA 1T0AA 3LWPC 2GZLA 3G71F 3FD6A 2AIZP 3HKCB 3I3FA 1OFUA 1RLGA 2PMPA 3ZO8A 2KTUA 5GONA 3WJRA 3S0WA 1VH8A 1W5EA 5LYJB 3HKEA 3VTIC 1RQ7A 2QA4F 3G4SF 4RQOA 3TD3A 5BMVB 4YJ3B 3S0YA 5CA1A 5HY2A 5JVDA 1VQ5F 3TD5A 1XHOA 3IKEA 3VCZA 1NJIH 3RYCA 2Z01A 3HKCA 1YHQF 3JASB 2F9ZC 2KTVA 4G4WA 2LCAA 2W8BC 3IEWA 3FFMA 5JCOA 4RHAA 2ZVZA 3LWVC 5IT9M 4O4HB 2OTJF 4YJ3A 1TVKA 1FNKA 4C82A 1GZ0A 1X25A 3T80A 3GTZA 4TV9A 2MQEA 2YYEA 3MDOA 3N4YA 3LWQC 2R6R1 2FC3A 1VQVA 3HKDB 3E22A 1YI2F 4LNUA 3JALB 3CYPB 1GO1A 3RYFB 4EI7A 3CC4F 2N48A 4BW0B 4YJ2B 3LWOC 3ZP4A 1Z5VA 1JD1A 3JAMM 5HY0A 5CA0B 5EYPA 2Z1UA 3J7AR 4ZHQA 4X1IB 3CCEF 3CCUF 3HKBA 3CCQF 3J81M 1W42A 2AIFA 3C9TA 5EB0A 2K1SA 3HKDA 3HTNA 1W581 4U3JA 3J80M 3N4ZA 2B33A 2VAPA 4HNAB 2HP0B 1KC8H 2QI2A 3I7TA 4X3MA 3ELCA 3JARA 4PWTA 3JAKA 4BT4A 3DDNA 2ZAUA 2BO1A 4DRXA 2GVIA 1YGYA 4TV8B 2Z1FA 2Z1EA 3R0PA 3VYTC 4C4WC 2V9YA 3M84A 2RHHA 5HY4A 1U3PA 2Q1XA 1Q7YH 1CN7A 3CC2F 2RHOA 1K9MH 2PHNA 4EI8A 3BYQA 2L26A 2H6LA 2WALA 1W41A 1U40A 1TUBB 5GIPC 3CCVF 2BTUA 3WGJA 5JH7B 3MBMA 5LOVB 5LP6A 3CXCF 3CMAF 4BT7A 5GAPK 1W59A 4E6EA 5KMGB 5IJ9A 1X7OA 3VOBA 1SA0A 3MQWA 2LBTA 3Q8HA 2KGWA 4ZK7A 3RYIB 2CVLA 4BT6A 3U0OA 1YITF 3NVKE 5A2QM 5EWRA 3KJJA 3CCJF 3K14A 2IQQA 1TUBA 1FFXA 3WGMA 3V4DA 5GIOC 1IV3A 2JNBA 5J2TA 1W5AA 2HS3A 3K2XA 4G4XA 1DT9A 1GO0A 5G4UC 5KX5B 1W3EX 2OHWA 2HP3A 1UI9A 3WPWA 4NQ3A 3JCMM 3E1YA 3QTYA 2NMUA 2OZBA 4O4LA 4XCQA 3D54A 5J2UB 1VQ6F 5EO3A 2ZOVA 3NK7A 3UT5B 3RYHB 5FLXM 3EORA 3KJKA 3MCAB 4O4JA 2EWCA 2ALEA 5HXZA 2ZF8A 4IHJB 3JAWB 5EIBD 1GX1A 4G4ZA 4TUYB 3I55F 4LCKA
chains in the Genus database with same CATH topology
1S72F 4BW0B 1ZWZA 3LWOC 3OBYA 3CD6F 3D00A 3CPQA 1E7KA 3PLAC 3JAMM 5HY0A 4BVQA 4BVSA 1M1KH 3J7AR 3CC7F 3CCEF 1VQKF 5HXUA 2VGNA 4EI9A 3CCUF 1NMUB 3CCQF 3J81M 1YJNF 5HWEA 1W42A 2AIFA 1PXWA 3J80M 4BVTA 1KD1H 3N4ZA 1K73H 1YJ9F 4X3LA 1KC8H 3ON1A 2QI2A 2GLZA 2CZWA 2VGMA 4X3MA 3PAFA 1VQOF 1CK2A 3G6EF 1SDSA 1VQLF 3OBWA 4BVRA 2KG4A 3CCMF 3WXMB 3AGKA 3E20B 3CCSF 2BO1A 3CCRF 1QVGF 3VI6A 3NMUC 4C4WC 3LFOA 2HVYD 1VQPF 1Q82H 3NVIB 1JJ2F 3HAXD 5HY4A 1CN7A 2LBXA 3CCLF 1Q7YH 5G4VC 2LBWA 3HJWC 3CC2F 1K9MH 3GYQA 4EI8A 3I56F 2WALA 1XBIA 3V7QA 1X52A 1W41A 3RA5A 3NK6A 3CCVF 5GIPC 2QEXF 1VQMF 3IR9A 3V3TA 1Q81H 3LWPC 5DCVA 1H7MA 3CXCF 1VQ7F 5GANK 3CMAF 3G71F 5GAPK 3CG6A 1VQ8F 1RLGA 3V7EA 3CPWF 1X7OA 2KTUA 1W40A 3OW2F 1W2BF 2QA4F 5GINC 3G4SF 1YITF 5A2QM 1X7PA 5EWRA 2OTLF 3RA6A 3CCJF 3NVKE 1M90H 3SIVA 4TZZA 5HY2A 5GIOC 1VQ5F 3SIUA 4BY9D 1NJIH 2JNBA 1RA4A 1Q86H 1K8AH 1DT9A 1VQNF 1GO0A 1YHQF 2I6DA 5G4UC 1W3EX 1KQSF 2OHWA 2F9ZC 2KTVA 4NQ3A 3O85A 3FFMA 3JCMM 3E1YA 5HY1A 4NUTA 3LWVC 5IT9M 3LWRC 2OZBA 2OTJF 4XCQA 1VQ6F 1QVFF 1VQ4F 1IPAA 5EO3A 1GZ0A 3VMFB 3CMEF 3NK7A 1T0KB 5FLXM 5FJ4C 3MCAB 3LWQC 3N4YA 2ALEA 5HXZA 1N8RH 2FC3A 2FGYA 1YJWF 1YI2F 1VQ9F 3I55F 4LCKA 3CC4F 1GO1A 4EI7A 1YIJF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 F;  4BW0 B;  1ZWZ A;  3LWO C;  3OBY A;  3CD6 F;  3CPQ A;  1E7K A;  3PLA C;  3JAM M;  1M1K H;  3J7A R;  3CC7 F;  3CCE F;  1VQK F;  2VGN A;  3CCU F;  1NMU B;  3CCQ F;  3J81 M;  1YJN F;  1W42 A;  2AIF A;  1PXW A;  3J80 M;  1KD1 H;  3N4Z A;  1K73 H;  1YJ9 F;  4X3L A;  1KC8 H;  3ON1 A;  2QI2 A;  2CZW A;  2VGM A;  4X3M A;  3PAF A;  1VQO F;  1CK2 A;  3G6E F;  1SDS A;  1VQL F;  3OBW A;  2KG4 A;  3CCM F;  3WXM B;  3AGK A;  3E20 B;  3CCS F;  2BO1 A;  3CCR F;  1QVG F;  3VI6 A;  3NMU C;  4C4W C;  3LFO A;  2HVY D;  1VQP F;  1Q82 H;  3NVI B;  1JJ2 F;  3HAX D;  1CN7 A;  2LBX A;  3CCL F;  1Q7Y H;  5G4V C;  2LBW A;  3HJW C;  3CC2 F;  1K9M H;  3GYQ A;  3I56 F;  2WAL A;  1XBI A;  3V7Q A;  1X52 A;  1W41 A;  3RA5 A;  3NK6 A;  3CCV F;  5GIP C;  2QEX F;  1VQM F;  3IR9 A;  1Q81 H;  3LWP C;  5DCV A;  1H7M A;  3CXC F;  1VQ7 F;  5GAN K;  3CMA F;  3G71 F;  5GAP K;  3CG6 A;  1VQ8 F;  1RLG A;  3V7E A;  3CPW F;  1X7O A;  2KTU A;  1W40 A;  3OW2 F;  1W2B F;  2QA4 F;  5GIN C;  3G4S F;  1YIT F;  5A2Q M;  1X7P A;  5EWR A;  2OTL F;  3RA6 A;  3CCJ F;  3NVK E;  1M90 H;  3SIV A;  4TZZ A;  5GIO C;  1VQ5 F;  3SIU A;  4BY9 D;  1NJI H;  2JNB A;  1RA4 A;  1Q86 H;  1K8A H;  1DT9 A;  1VQN F;  1GO0 A;  1YHQ F;  2I6D A;  5G4U C;  1W3E X;  1KQS F;  2OHW A;  2KTV A;  3O85 A;  3FFM A;  3JCM M;  3E1Y A;  4NUT A;  3LWV C;  5IT9 M;  3LWR C;  2OZB A;  2OTJ F;  1VQ6 F;  1QVF F;  1VQ4 F;  1IPA A;  5EO3 A;  1GZ0 A;  3VMF B;  3CME F;  3NK7 A;  1T0K B;  5FLX M;  5FJ4 C;  3MCA B;  3LWQ C;  3N4Y A;  2ALE A;  1N8R H;  2FC3 A;  1YJW F;  1YI2 F;  1VQ9 F;  3I55 F;  4LCK A;  3CC4 F;  1GO1 A;  1YIJ F; 
#chains in the Genus database with same CATH topology
 3MCQ A;  1S72 F;  1ZWZ A;  4O2B B;  3F0D A;  4ZI7 B;  5EB1 B;  5LYJ A;  2RB9 A;  4EB6 B;  3D00 A;  3CPQ A;  1UFY A;  1E7K A;  4ZHV A;  2RHL A;  2YXZ A;  4BVS A;  1KNJ A;  5B8F A;  3CC7 F;  4F6R B;  3IKF A;  4U39 A;  5BMV A;  5HWE A;  1PXW A;  1OAP A;  1NQ3 A;  3ESJ A;  4X3L A;  3JAT B;  4I4T B;  2GLZ A;  2CZW A;  3F6M A;  4O2A B;  5IJ0 B;  3JAS A;  4O2B A;  1VQL F;  3OBW A;  3C9S A;  2KG4 A;  4EB6 A;  3CCM F;  1QD9 A;  3AGK A;  5EAZ A;  2CW4 A;  4B46 A;  4O4H A;  4DXD A;  3OON A;  1U3L A;  1JN1 A;  3NMU C;  4FFB B;  2CHS A;  1VQP F;  4I50 B;  3CCL F;  1IV1 A;  3C8L A;  4X20 B;  4NWO B;  3GYQ A;  3N2K B;  1XBI A;  3V7Q A;  1X52 A;  5LXT B;  3LDT A;  3RA5 A;  3NK6 A;  3JAL A;  3RYF A;  3K0T A;  3QHD A;  2BTQ B;  3S03 A;  5MN6 A;  4IIJ B;  3V3T A;  2OTM A;  4YJ2 A;  1Q81 H;  4WBN B;  3P0Z A;  5JQG B;  2Q1Y A;  3CG6 A;  5CA0 A;  4X1I A;  2OTL F;  2QTP A;  5GIN C;  2UYJ A;  2IAF A;  1JFF B;  3IEQ A;  3GHZ A;  4HNA A;  5JCO C;  2HP0 A;  1VK3 A;  1Z5W A;  2CHT A;  1CLI A;  2CSL A;  4IIJ A;  3SIU A;  2AMT A;  4BY9 D;  5C8Y B;  1Q86 H;  1K8A H;  1VQN F;  1RLU A;  2VAW A;  3C9R A;  3IMP A;  4ERH A;  4TV8 A;  3O85 A;  2UZH A;  5HY1 A;  4NUT A;  4X1K B;  2RHJ A;  2ZVY A;  2ZOD A;  1IPA A;  4ZOL B;  2CWJ A;  3FPI A;  3P4E A;  3F0G A;  1W5B A;  1IV2 A;  3ERN A;  2Z1T A;  5JH7 A;  1YJW F;  5LOV A;  2HQS C;  3VO8 A;  4BVR A;  5KMG A;  5ITZ B;  1IV4 A;  2HX0 A;  3CD6 F;  3VYU C;  3RYI A;  4BVQ A;  3LYB A;  5GON B;  2I6R A;  5HXU A;  2VGN A;  4EI9 A;  1YJN F;  3HKE B;  1W5F A;  3ZOP A;  2P6Y A;  1KD1 H;  1K73 H;  1YJ9 F;  3L7Q A;  3ON1 A;  5JVD B;  5CA1 B;  5KX5 A;  4G88 A;  3G6E F;  1SDS A;  3K12 A;  3RYC B;  4B62 A;  3E20 B;  3CCS F;  5HP8 A;  1QVG F;  3VI6 A;  4X1Y B;  5J2U A;  3S02 A;  5LP6 C;  2HVY D;  1JJ2 F;  3UT5 A;  3RYH A;  1W55 A;  3HJW C;  2LBW A;  1Q8R A;  3B6N A;  4IHJ A;  1TVK B;  3I56 F;  3JAW A;  3KHN A;  1H47 A;  4TUY A;  4TV9 B;  3CYQ A;  4C8E A;  2QEX F;  4B5C A;  3IR9 A;  4BT5 A;  3E22 B;  4LNU B;  4ZI7 A;  4ZHY B;  2H8C A;  5DCV A;  1H7M A;  3P10 A;  1VQ7 F;  5GAN K;  1SZQ A;  1QU9 A;  2H8E A;  1FNJ A;  1COM A;  4X1Y A;  3WJQ A;  2DT4 A;  3C9U A;  1VQ8 F;  3V7E A;  3CPW F;  3F0E A;  4KWE A;  1W40 A;  4C8I A;  4F6R A;  2VXY A;  3OW2 F;  1W2B F;  1ONI A;  3HAX D;  1X7P A;  2UYP A;  5EYP B;  3RA6 A;  3SIV A;  4ZHQ B;  1M90 H;  1J7H A;  3FBA A;  3HKB B;  3JAT A;  4I4T A;  2BTO A;  4TZZ A;  4BT2 A;  3M4S A;  4O2A A;  5IJ0 A;  5CB4 B;  3ZP7 A;  4U3J B;  5FNV B;  1W57 A;  1RA4 A;  1XRG A;  4I55 B;  5MN5 A;  2I6D A;  2HS0 A;  3CB2 A;  3LME A;  1KQS F;  3JAR B;  5HP7 A;  2UYN B;  3WGK A;  3JAK B;  3HWU A;  4FFB A;  5EZY B;  4I50 A;  3LWR C;  4DRX B;  2IG8 A;  5LA6 B;  4X20 A;  3N2K A;  1QVF F;  1VQ4 F;  3VYS C;  5CB4 A;  5LXT A;  3VMF B;  5FNV A;  3CME F;  1T0K B;  5FJ4 C;  1RQ2 A;  2DYY A;  4I55 A;  1N8R H;  5MN4 A;  3F0F A;  2FGY A;  1VQ9 F;  2UYN A;  4WBN A;  3N2G B;  2VAM A;  1YIJ F;  5JQG A;  4M8I A;  5EZY A;  3OBY A;  5LP6 B;  5LA6 A;  4O4I B;  3VOA A;  4B45 A;  3PLA C;  1JFF A;  1ODE A;  5IJ9 B;  3WGL A;  1M1K H;  1SA0 B;  1VQK F;  3VIU A;  1XV2 A;  1QAH A;  1NMU B;  1U43 A;  1VHA A;  3TD4 A;  3S06 A;  5C8Y A;  4BVT A;  5IYZ B;  4C81 A;  4BT3 A;  3N2G A;  2UYK A;  1FFX B;  2VGM A;  1FSZ A;  1PF5 A;  3D01 A;  3PAF A;  1CK2 A;  3QUW A;  3WPX A;  1VQO F;  5J2T B;  4O4I A;  2G9I A;  4X1K A;  3WXM B;  2HRU A;  5AVM A;  3RE3 A;  3CCR F;  1JY8 A;  4G4Y A;  3DC2 A;  3KIZ A;  4R40 B;  1H48 A;  5EIB C;  1R1M A;  3WJP A;  2HS4 A;  2HRY A;  3LFO A;  4G4V A;  4ZOL A;  1Q82 H;  3NVI B;  3JVH A;  3M1X A;  5IYZ A;  2LBX A;  5G4V C;  3WGN A;  1DBF A;  4O4L B;  3KE1 A;  3FD5 A;  4C8G A;  2R75 1;  1YQN A;  4O4J B;  3S0H A;  1VQM F;  4ZHW A;  1KNK A;  5ITZ A;  1T0A A;  3LWP C;  2GZL A;  3G71 F;  3FD6 A;  2AIZ P;  3HKC B;  3I3F A;  1OFU A;  1RLG A;  2PMP A;  3ZO8 A;  2KTU A;  5GON A;  3WJR A;  3S0W A;  1VH8 A;  1W5E A;  5LYJ B;  3HKE A;  3VTI C;  1RQ7 A;  2QA4 F;  3G4S F;  4RQO A;  3TD3 A;  5BMV B;  4YJ3 B;  3S0Y A;  5CA1 A;  5HY2 A;  5JVD A;  1VQ5 F;  3TD5 A;  1XHO A;  3IKE A;  3VCZ A;  1NJI H;  3RYC A;  2Z01 A;  3HKC A;  1YHQ F;  3JAS B;  2F9Z C;  2KTV A;  4G4W A;  2LCA A;  2W8B C;  3IEW A;  3FFM A;  5JCO A;  4RHA A;  2ZVZ A;  3LWV C;  5IT9 M;  4O4H B;  2OTJ F;  4YJ3 A;  1TVK A;  1FNK A;  4C82 A;  1GZ0 A;  1X25 A;  3T80 A;  3GTZ A;  4TV9 A;  2MQE A;  2YYE A;  3MDO A;  3N4Y A;  3LWQ C;  2R6R 1;  2FC3 A;  1VQV A;  3HKD B;  3E22 A;  1YI2 F;  4LNU A;  3JAL B;  3CYP B;  1GO1 A;  3RYF B;  4EI7 A;  3CC4 F;  2N48 A;  4BW0 B;  4YJ2 B;  3LWO C;  3ZP4 A;  1Z5V A;  1JD1 A;  3JAM M;  5HY0 A;  5CA0 B;  5EYP A;  2Z1U A;  3J7A R;  4ZHQ A;  4X1I B;  3CCE F;  3CCU F;  3HKB A;  3CCQ F;  3J81 M;  1W42 A;  2AIF A;  3C9T A;  5EB0 A;  2K1S A;  3HKD A;  3HTN A;  1W58 1;  4U3J A;  3J80 M;  3N4Z A;  2B33 A;  2VAP A;  4HNA B;  2HP0 B;  1KC8 H;  2QI2 A;  3I7T A;  4X3M A;  3ELC A;  3JAR A;  4PWT A;  3JAK A;  4BT4 A;  3DDN A;  2ZAU A;  2BO1 A;  4DRX A;  2GVI A;  1YGY A;  4TV8 B;  2Z1F A;  2Z1E A;  3R0P A;  3VYT C;  4C4W C;  2V9Y A;  3M84 A;  2RHH A;  5HY4 A;  1U3P A;  2Q1X A;  1Q7Y H;  1CN7 A;  3CC2 F;  2RHO A;  1K9M H;  2PHN A;  4EI8 A;  3BYQ A;  2L26 A;  2H6L A;  2WAL A;  1W41 A;  1U40 A;  1TUB B;  5GIP C;  3CCV F;  2BTU A;  3WGJ A;  5JH7 B;  3MBM A;  5LOV B;  5LP6 A;  3CXC F;  3CMA F;  4BT7 A;  5GAP K;  1W59 A;  4E6E A;  5KMG B;  5IJ9 A;  1X7O A;  3VOB A;  1SA0 A;  3MQW A;  2LBT A;  3Q8H A;  2KGW A;  4ZK7 A;  3RYI B;  2CVL A;  4BT6 A;  3U0O A;  1YIT F;  3NVK E;  5A2Q M;  5EWR A;  3KJJ A;  3CCJ F;  3K14 A;  2IQQ A;  1TUB A;  1FFX A;  3WGM A;  3V4D A;  5GIO C;  1IV3 A;  2JNB A;  5J2T A;  1W5A A;  2HS3 A;  3K2X A;  4G4X A;  1DT9 A;  1GO0 A;  5G4U C;  5KX5 B;  1W3E X;  2OHW A;  2HP3 A;  1UI9 A;  3WPW A;  4NQ3 A;  3JCM M;  3E1Y A;  3QTY A;  2NMU A;  2OZB A;  4O4L A;  4XCQ A;  3D54 A;  5J2U B;  1VQ6 F;  5EO3 A;  2ZOV A;  3NK7 A;  3UT5 B;  3RYH B;  5FLX M;  3EOR A;  3KJK A;  3MCA B;  4O4J A;  2EWC A;  2ALE A;  5HXZ A;  2ZF8 A;  4IHJ B;  3JAW B;  5EIB D;  1GX1 A;  4G4Z A;  4TUY B;  3I55 F;  4LCK A; 
#chains in the Genus database with same CATH homology
 1S72 F;  4BW0 B;  1ZWZ A;  3LWO C;  3OBY A;  3CD6 F;  3D00 A;  3CPQ A;  1E7K A;  3PLA C;  3JAM M;  5HY0 A;  4BVQ A;  4BVS A;  1M1K H;  3J7A R;  3CC7 F;  3CCE F;  1VQK F;  5HXU A;  2VGN A;  4EI9 A;  3CCU F;  1NMU B;  3CCQ F;  3J81 M;  1YJN F;  5HWE A;  1W42 A;  2AIF A;  1PXW A;  3J80 M;  4BVT A;  1KD1 H;  3N4Z A;  1K73 H;  1YJ9 F;  4X3L A;  1KC8 H;  3ON1 A;  2QI2 A;  2GLZ A;  2CZW A;  2VGM A;  4X3M A;  3PAF A;  1VQO F;  1CK2 A;  3G6E F;  1SDS A;  1VQL F;  3OBW A;  4BVR A;  2KG4 A;  3CCM F;  3WXM B;  3AGK A;  3E20 B;  3CCS F;  2BO1 A;  3CCR F;  1QVG F;  3VI6 A;  3NMU C;  4C4W C;  3LFO A;  2HVY D;  1VQP F;  1Q82 H;  3NVI B;  1JJ2 F;  3HAX D;  5HY4 A;  1CN7 A;  2LBX A;  3CCL F;  1Q7Y H;  5G4V C;  2LBW A;  3HJW C;  3CC2 F;  1K9M H;  3GYQ A;  4EI8 A;  3I56 F;  2WAL A;  1XBI A;  3V7Q A;  1X52 A;  1W41 A;  3RA5 A;  3NK6 A;  3CCV F;  5GIP C;  2QEX F;  1VQM F;  3IR9 A;  3V3T A;  1Q81 H;  3LWP C;  5DCV A;  1H7M A;  3CXC F;  1VQ7 F;  5GAN K;  3CMA F;  3G71 F;  5GAP K;  3CG6 A;  1VQ8 F;  1RLG A;  3V7E A;  3CPW F;  1X7O A;  2KTU A;  1W40 A;  3OW2 F;  1W2B F;  2QA4 F;  5GIN C;  3G4S F;  1YIT F;  5A2Q M;  1X7P A;  5EWR A;  2OTL F;  3RA6 A;  3CCJ F;  3NVK E;  1M90 H;  3SIV A;  4TZZ A;  5HY2 A;  5GIO C;  1VQ5 F;  3SIU A;  4BY9 D;  1NJI H;  2JNB A;  1RA4 A;  1Q86 H;  1K8A H;  1DT9 A;  1VQN F;  1GO0 A;  1YHQ F;  2I6D A;  5G4U C;  1W3E X;  1KQS F;  2OHW A;  2F9Z C;  2KTV A;  4NQ3 A;  3O85 A;  3FFM A;  3JCM M;  3E1Y A;  5HY1 A;  4NUT A;  3LWV C;  5IT9 M;  3LWR C;  2OZB A;  2OTJ F;  4XCQ A;  1VQ6 F;  1QVF F;  1VQ4 F;  1IPA A;  5EO3 A;  1GZ0 A;  3VMF B;  3CME F;  3NK7 A;  1T0K B;  5FLX M;  5FJ4 C;  3MCA B;  3LWQ C;  3N4Y A;  2ALE A;  5HXZ A;  1N8R H;  2FC3 A;  2FGY A;  1YJW F;  1YI2 F;  1VQ9 F;  3I55 F;  4LCK A;  3CC4 F;  1GO1 A;  4EI7 A;  1YIJ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...