2ALEA

Crystal structure of yeast rna splicing factor snu13p
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
132
structure length
132
Chain Sequence
MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLILEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NHP2/L7aE family protein YEL026W
publication title Analysis of pre-mRNA and pre-rRNA processing factor Snu13p structure and mutants.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 45
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2005-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2aleA00
1S72F 3CG6A 2OZBA 4X3MA 1VQ9F 2OTJF 3NK6A 2BO1A 4X3LA 3VI6A 3CXCF 2ALEA 3NVIB 5GIOC 3NMUC 3I56F 1Q86H 1YI2F 2KTUA 1IPAA 3WXMB 3MCAB 3CCEF 1M1KH 3CMAF 5IT9M 3VMFB 1E7KA 3G71F 1X52A 3J81M 1VQ5F 1DT9A 3NK7A 4BY9D 1K8AH 1H7MA 1YIJF 3LWVC 2VGMA 2LBWA 3CCMF 1JJ2F 2QA4F 1Q7YH 2I6DA 1W42A 1VQOF 1RA4A 3CCRF 3G4SF 3V7EA 1W40A 3CCVF 4BW0B 1Q81H 1KC8H 1M90H 1W2BF 2OTLF 5GIPC 1GO1A 3E20B 5EO3A 3AGKA 3OBYA 1K9MH 3CPWF 3ON1A 3G6EF 1K73H 3LWPC 3LWRC 3HJWC 3SIUA 3N4YA 3RA6A 5EWRA 3OW2F 2LBXA 3LWQC 1VQMF 1X7PA 3IR9A 3PAFA 1X7OA 1RLGA 3J80M 1VQPF 1VQLF 1XBIA 1W41A 5GANK 1KD1H 2KG4A 2HVYD 5A2QM 5FLXM 3I55F 2VGNA 1T0KB 3CC7F 3HAXD 5G4VC 4TZZA 3CCJF 3RA5A 3CCUF 2JNBA 1YJWF 1SDSA 1GO0A 1VQ6F 3JAMM 1YHQF 3CD6F 1KQSF 3O85A 1VQ4F 1VQKF 1PXWA 3CCQF 3CMEF 1YITF 3SIVA 1ZWZA 5DCVA 5GAPK 1N8RH 1YJNF 1NJIH 2WALA 1QVGF 1VQ7F 3FFMA 3GYQA 1CK2A 2CZWA 3NVKE 3OBWA 1YJ9F 3J7AR 4LCKA 4NUTA 3E1YA 3LWOC 1VQ8F 3CCSF 5GINC 1QVFF 3V7QA 1Q82H 5FJ4C 2KTVA 3CC4F 1CN7A 3CPQA 2AIFA 2QI2A 3CCLF 5G4UC 3LFOA 1VQNF 1NMUB 3PLAC 3CC2F 1GZ0A 2QEXF 4C4WC 3N4ZA 3JCMM 2FC3A 1W3EX 2OHWA
chains in the Genus database with same CATH superfamily
1JN1A 3HKDA 4ZHWA 2OZBA 3N2GA 1COMA 1FSZA 2UYNB 3CXCF 1PF5A 4ZHQA 2ALEA 1DBFA 5CB4B 2PHNA 5IYZB 1FFXB 1W581 1IPAA 5LYJA 3MCAB 2BTUA 3CCEF 2CSLA 2UZHA 3G71F 2Z1EA 3WGNA 4U3JB 2CW4A 2RHJA 2H8EA 3J81M 5FNVB 4BY9D 3T80A 4BT3A 1XHOA 1YIJF 2VXYA 2HQSC 2VAWA 1JFFA 4X1YB 3S0HA 3CCMF 1JJ2F 1CLIA 1VQOF 3S0WA 3ZOPA 4C8IA 4X20A 3RYCA 3DC2A 4X1IB 3WPWA 1W40A 2Z1FA 1RQ7A 3ELCA 4EI8A 1VH8A 4C8EA 2F9ZC 1GO1A 1QD9A 3E20B 5EO3A 2ZF8A 2HS0A 3RYFA 2ZVZA 4FFBB 4DXDA 5JVDA 4O4HB 3N4YA 5J2UB 3MCQA 2B33A 3KIZA 2LBXA 2W8BC 5EAZA 4DRXB 3C8LA 3VIUA 3PAFA 1GX1A 3F0EA 3LMEA 5C8YB 2HVYD 5A2QM 3E22A 3I55F 3CYQA 2IQQA 3UT5B 3HAXD 5G4VC 3I3FA 4G4YA 1VQ6F 3VCZA 3C9RA 3ZO8A 4C82A 4C8GA 3HKCA 3IEWA 1KQSF 1ODEA 4TV9B 1VQ4F 1UI9A 1VQKF 1PXWA 5DCVA 2HRYA 3M1XA 5LOVA 4XCQA 3Q8HA 1VK3A 5CA1A 3GYQA 2BTQB 2QTPA 1CK2A 3MBMA 4O2AB 4EB6B 3NVKE 1IV2A 1YJ9F 3WGJA 1YQNA 3E1YA 3TD3A 3JAKB 3LWOC 3C9TA 1VQ8F 5GINC 1QVFF 3KE1A 1CN7A 1RQ2A 2HX0A 2Z01A 3CPQA 4C81A 2QI2A 3RYIB 4WBNA 5CA0A 2HRUA 3JARA 5MN6A 2HS3A 3CC2F 3S03A 3IMPA 3K0TA 3N4ZA 2FC3A 4O4JB 4O4LB 4IHJB 4M8IA 3V3TA 3CG6A 4X3MA 4YJ2B 2PMPA 3VI6A 4YJ3A 5EIBD 4ERHA 4G88A 5HY0A 5LXTA 5GIOC 3I56F 2UYJA 4X1KA 3OONA 1ONIA 3N2KA 4NQ3A 3FD6A 4IIJB 5EZYA 4F6RA 3K12A 1M1KH 1E7KA 1XV2A 5LA6B 1NQ3A 1DT9A 3NK7A 3VOAA 5KX5A 2LCAA 1FFXA 5IYZA 2VAPA 3FBAA 2LBWA 1YGYA 2I6DA 1RLUA 3F0FA 2HP0B 3S0YA 2DT4A 2Q1XA 1SZQA 4O2BA 3JATA 5FNVA 2FGYA 3WGKA 5LP6C 4I4TB 5J2TB 2OTLF 4X1YA 4ZHVA 4TUYA 4ZI7B 3AGKA 1K9MH 3JASB 3U0OA 3CPWF 1SA0B 1K73H 5HY4A 4TV8A 3FPIA 4B46A 2YYEA 1TVKB 4X1IA 1UFYA 5JCOA 3MQWA 2IG8A 3HKBB 5EWRA 3IEQA 3RA6A 5BMVA 3V4DA 4RQOA 5JH7A 3OW2F 1VQMF 2GVIA 5EB1B 1W5BA 1XRGA 3KJJA 1RLGA 5IJ0B 4KWEA 5GANK 4BVQA 2KG4A 4BVSA 3I7TA 5FLXM 2ZAUA 3VTIC 5HY2A 4O4HA 4G4VA 3N2GB 5J2UA 3CCUF 3M84A 2CVLA 2JNBA 3QTYA 3ZP7A 1SDSA 3JAMM 2MQEA 1YHQF 3ESJA 1QU9A 3F6MA 3F0DA 1YJNF 2NMUA 4ZOLA 3WPXA 2WALA 1QVGF 1T0AA 4HNAA 3KHNA 2CZWA 2VAMA 3TD4A 1FNKA 4LCKA 1JFFB 3GTZA 3CCSF 1Q82H 5FJ4C 4EI9A 2Q1YA 3CC4F 2H8CA 3RYCB 2AIFA 3QUWA 5ITZB 1JY8A 2N48A 4B5CA 3CCLF 5G4UC 5IJ9A 1VQNF 3PLAC 5LP6A 1VQVA 4LNUA 1OAPA 3CB2A 3F0GA 2ZODA 1W3EX 3CMAF 2CWJA 1S72F 4BT2A 1VQ9F 2OTJF 2KGWA 2BO1A 5EYPB 3QHDA 3TD5A 3NMUC 4BVRA 1FNJA 2KTUA 4R40B 3D01A 1W5FA 3RYHB 5HY1A 2LBTA 3RE3A 5IT9M 4YJ2A 1X52A 2GLZA 4I50A 4B45A 1VQ5F 3CYPB 1U3LA 4O4IB 3JAWA 3WJPA 2VGMA 4EI7A 4IIJA 1Q7YH 1W42A 3JALB 3P0ZA 3G4SF 5KMGA 5LOVB 2CHSA 3CCVF 3EORA 5CA1B 2HS4A 2I6RA 2YXZA 3B6NA 5B8FA 1W2BF 5GIPC 3OBYA 5MN5A 3CD6F 2RB9A 2EWCA 2HP0A 3G6EF 2UYNA 3LWRC 3HJWC 1TUBB 2IAFA 5AVMA 3WJQA 2L26A 5CB4A 5GONB 3D00A 4I55B 4B62A 4ZHYB 4I4TA 4WBNB 5CA0B 1OFUA 1X7OA 3ERNA 3J80M 3JARB 1XBIA 2DYYA 1Q8RA 1W41A 4ZI7A 3GHZA 3M4SA 1KD1H 1IV4A 3JASA 2R6R1 1SA0A 5HP8A 3R0PA 2ZOVA 4U3JA 3VYSC 3P4EA 1Z5VA 1W57A 3CC7F 2HP3A 3HKBA 4YJ3B 4ZK7A 1YJWF 3C9UA 4X1KB 2BTOA 5EB0A 1U43A 3N2KB 5HXZA 5EZYB 3KJKA 1ZWZA 5JQGB 5HP7A 3L7QA 1H47A 3WGLA 1VQ7F 3FFMA 3HKEB 3OBWA 2ZVYA 5KX5B 2G9IA 3J7AR 3IKFA 3VYUC 4NUTA 4FFBA 3HKDB 4U39A 3BYQA 4ZHQB 4DRXA 2V9YA 3C9SA 5HWEA 4O2BB 3JATB 5C8YA 1IV3A 2CHTA 3LFOA 1NMUB 2AIZP 5LYJB 2QEXF 4C4WC 2R751 1H48A 1U40A 2OHWA 4TUYB 4BT6A 3UT5A 3NK6A 4X3LA 3HTNA 5ITZA 4TV8B 3NVIB 1Z5WA 1KNKA 2GZLA 5JH7B 3LDTA 5BMVB 4TV9A 1Q86H 1YI2F 3WXMB 2P6YA 4G4ZA 4BT5A 2AMTA 2Z1TA 4X20B 3HWUA 3VMFB 1W59A 5EIBC 5EYPA 4O2AA 3VO8A 3VOBA 4EB6A 3DDNA 3D54A 3WJRA 1K8AH 1H7MA 3LWVC 1R1MA 3JAKA 2QA4F 3RYHA 1QAHA 2H6LA 3RYFB 3LYBA 1RA4A 4G4WA 3P10A 3CCRF 1X25A 3VYTC 3V7EA 3RYIA 2RHLA 5JVDB 3S06A 4ZOLB 2RHOA 2RHHA 4O4IA 1U3PA 4HNAB 4BW0B 1Q81H 1KC8H 1M90H 3FD5A 1J7HA 4BVTA 4O4LA 4O4JA 4IHJA 3E22B 4E6EA 3ON1A 3JALA 3K14A 3LWPC 3SIUA 1W5AA 3LWQC 1X7PA 3IR9A 2OTMA 3HKCB 5HXUA 5IJ9B 1VQPF 1VQLF 5LP6B 3MDOA 3S02A 4LNUB 1JD1A 2VGNA 5LA6A 1T0KB 1TUBA 5JCOC 4TZZA 3CCJF 2UYKA 3RA5A 4BT4A 1IV1A 5GONA 1GO0A 4I55A 3JVHA 1KNJA 1VHAA 3O85A 3CCQF 3CMEF 1YITF 3SIVA 5GAPK 1N8RH 4BT7A 1NJIH 3ZP4A 5MN4A 2UYPA 3K2XA 4I50B 5J2TA 1W5EA 1W55A 3WGMA 3JAWB 3IKEA 4RHAA 3V7QA 1TVKA 4G4XA 2KTVA 5JQGA 5KMGB 2Z1UA 3HKEA 5LXTB 2K1SA 4NWOB 5IJ0A 4PWTA 1GZ0A 3JCMM 4F6RB
chains in the Genus database with same CATH topology
3V3TA 1S72F 3CG6A 2OZBA 4X3MA 1VQ9F 2OTJF 3NK6A 2BO1A 4X3LA 3VI6A 3CXCF 2ALEA 5HY0A 3NVIB 5GIOC 3NMUC 3I56F 4BVRA 1Q86H 4NQ3A 1YI2F 2KTUA 1IPAA 3WXMB 5HY1A 3MCAB 3CCEF 1M1KH 3CMAF 5IT9M 3VMFB 1E7KA 3G71F 1X52A 2GLZA 3J81M 1VQ5F 1DT9A 3NK7A 4BY9D 1K8AH 1H7MA 1YIJF 3LWVC 2VGMA 4EI7A 2LBWA 3CCMF 1JJ2F 2QA4F 1Q7YH 2I6DA 1W42A 1VQOF 1RA4A 3CCRF 3G4SF 3V7EA 1W40A 4EI8A 3CCVF 2FGYA 4BW0B 1Q81H 1KC8H 1M90H 2F9ZC 4BVTA 1W2BF 5GIPC 2OTLF 1GO1A 3E20B 5EO3A 3AGKA 3OBYA 1K9MH 3CPWF 3ON1A 3G6EF 1K73H 3LWPC 3LWRC 3HJWC 3SIUA 5HY4A 3N4YA 3RA6A 5EWRA 3OW2F 2LBXA 3D00A 3LWQC 1VQMF 1X7PA 3IR9A 3PAFA 1X7OA 1RLGA 3J80M 5HXUA 1VQPF 1XBIA 1VQLF 1W41A 5GANK 4BVQA 2KG4A 1KD1H 4BVSA 2HVYD 5A2QM 5FLXM 5HY2A 3I55F 2VGNA 1T0KB 3CC7F 3HAXD 5G4VC 4TZZA 3CCJF 3RA5A 3CCUF 2JNBA 1YJWF 1SDSA 1GO0A 1VQ6F 3JAMM 1YHQF 3CD6F 1KQSF 3O85A 1VQ4F 1VQKF 1PXWA 3CCQF 5HXZA 3CMEF 1YITF 3SIVA 1ZWZA 5DCVA 5GAPK 1N8RH 1YJNF 1NJIH 4XCQA 2WALA 1QVGF 1VQ7F 3FFMA 3GYQA 1CK2A 2CZWA 3NVKE 3OBWA 1YJ9F 3J7AR 4LCKA 4NUTA 3E1YA 3LWOC 1VQ8F 3CCSF 5GINC 1QVFF 3V7QA 1Q82H 5FJ4C 4EI9A 2KTVA 3CC4F 1CN7A 3CPQA 2AIFA 2QI2A 5HWEA 3CCLF 5G4UC 3LFOA 1VQNF 1NMUB 3PLAC 3CC2F 1GZ0A 2QEXF 4C4WC 3N4ZA 3JCMM 2FC3A 1W3EX 2OHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 F;  3CG6 A;  2OZB A;  4X3M A;  1VQ9 F;  2OTJ F;  3NK6 A;  2BO1 A;  4X3L A;  3VI6 A;  3CXC F;  2ALE A;  3NVI B;  5GIO C;  3NMU C;  3I56 F;  1Q86 H;  1YI2 F;  2KTU A;  1IPA A;  3WXM B;  3MCA B;  3CCE F;  1M1K H;  3CMA F;  5IT9 M;  3VMF B;  1E7K A;  3G71 F;  1X52 A;  3J81 M;  1VQ5 F;  1DT9 A;  3NK7 A;  4BY9 D;  1K8A H;  1H7M A;  1YIJ F;  3LWV C;  2VGM A;  2LBW A;  3CCM F;  1JJ2 F;  2QA4 F;  1Q7Y H;  2I6D A;  1W42 A;  1VQO F;  1RA4 A;  3CCR F;  3G4S F;  3V7E A;  1W40 A;  3CCV F;  4BW0 B;  1Q81 H;  1KC8 H;  1M90 H;  1W2B F;  2OTL F;  5GIP C;  1GO1 A;  3E20 B;  5EO3 A;  3AGK A;  3OBY A;  1K9M H;  3CPW F;  3ON1 A;  3G6E F;  1K73 H;  3LWP C;  3LWR C;  3HJW C;  3SIU A;  3N4Y A;  3RA6 A;  5EWR A;  3OW2 F;  2LBX A;  3LWQ C;  1VQM F;  1X7P A;  3IR9 A;  3PAF A;  1X7O A;  1RLG A;  3J80 M;  1VQP F;  1VQL F;  1XBI A;  1W41 A;  5GAN K;  1KD1 H;  2KG4 A;  2HVY D;  5A2Q M;  5FLX M;  3I55 F;  2VGN A;  1T0K B;  3CC7 F;  3HAX D;  5G4V C;  4TZZ A;  3CCJ F;  3RA5 A;  3CCU F;  2JNB A;  1YJW F;  1SDS A;  1GO0 A;  1VQ6 F;  3JAM M;  1YHQ F;  3CD6 F;  1KQS F;  3O85 A;  1VQ4 F;  1VQK F;  1PXW A;  3CCQ F;  3CME F;  1YIT F;  3SIV A;  1ZWZ A;  5DCV A;  5GAP K;  1N8R H;  1YJN F;  1NJI H;  2WAL A;  1QVG F;  1VQ7 F;  3FFM A;  3GYQ A;  1CK2 A;  2CZW A;  3NVK E;  3OBW A;  1YJ9 F;  3J7A R;  4LCK A;  4NUT A;  3E1Y A;  3LWO C;  1VQ8 F;  3CCS F;  5GIN C;  1QVF F;  3V7Q A;  1Q82 H;  5FJ4 C;  2KTV A;  3CC4 F;  1CN7 A;  3CPQ A;  2AIF A;  2QI2 A;  3CCL F;  5G4U C;  3LFO A;  1VQN F;  1NMU B;  3PLA C;  3CC2 F;  1GZ0 A;  2QEX F;  4C4W C;  3N4Z A;  3JCM M;  2FC3 A;  1W3E X;  2OHW A; 
#chains in the Genus database with same CATH topology
 1JN1 A;  3HKD A;  4ZHW A;  2OZB A;  3N2G A;  1COM A;  1FSZ A;  2UYN B;  3CXC F;  1PF5 A;  4ZHQ A;  2ALE A;  1DBF A;  5CB4 B;  2PHN A;  5IYZ B;  1FFX B;  1W58 1;  1IPA A;  5LYJ A;  3MCA B;  2BTU A;  3CCE F;  2CSL A;  2UZH A;  3G71 F;  2Z1E A;  3WGN A;  4U3J B;  2CW4 A;  2RHJ A;  2H8E A;  3J81 M;  5FNV B;  4BY9 D;  3T80 A;  4BT3 A;  1XHO A;  1YIJ F;  2VXY A;  2HQS C;  2VAW A;  1JFF A;  4X1Y B;  3S0H A;  3CCM F;  1JJ2 F;  1CLI A;  1VQO F;  3S0W A;  3ZOP A;  4C8I A;  4X20 A;  3RYC A;  3DC2 A;  4X1I B;  3WPW A;  1W40 A;  2Z1F A;  1RQ7 A;  3ELC A;  4EI8 A;  1VH8 A;  4C8E A;  2F9Z C;  1GO1 A;  1QD9 A;  3E20 B;  5EO3 A;  2ZF8 A;  2HS0 A;  3RYF A;  2ZVZ A;  4FFB B;  4DXD A;  5JVD A;  4O4H B;  3N4Y A;  5J2U B;  3MCQ A;  2B33 A;  3KIZ A;  2LBX A;  2W8B C;  5EAZ A;  4DRX B;  3C8L A;  3VIU A;  3PAF A;  1GX1 A;  3F0E A;  3LME A;  5C8Y B;  2HVY D;  5A2Q M;  3E22 A;  3I55 F;  3CYQ A;  2IQQ A;  3UT5 B;  3HAX D;  5G4V C;  3I3F A;  4G4Y A;  1VQ6 F;  3VCZ A;  3C9R A;  3ZO8 A;  4C82 A;  4C8G A;  3HKC A;  3IEW A;  1KQS F;  1ODE A;  4TV9 B;  1VQ4 F;  1UI9 A;  1VQK F;  1PXW A;  5DCV A;  2HRY A;  3M1X A;  5LOV A;  4XCQ A;  3Q8H A;  1VK3 A;  5CA1 A;  3GYQ A;  2BTQ B;  2QTP A;  1CK2 A;  3MBM A;  4O2A B;  4EB6 B;  3NVK E;  1IV2 A;  1YJ9 F;  3WGJ A;  1YQN A;  3E1Y A;  3TD3 A;  3JAK B;  3LWO C;  3C9T A;  1VQ8 F;  5GIN C;  1QVF F;  3KE1 A;  1CN7 A;  1RQ2 A;  2HX0 A;  2Z01 A;  3CPQ A;  4C81 A;  2QI2 A;  3RYI B;  4WBN A;  5CA0 A;  2HRU A;  3JAR A;  5MN6 A;  2HS3 A;  3CC2 F;  3S03 A;  3IMP A;  3K0T A;  3N4Z A;  2FC3 A;  4O4J B;  4O4L B;  4IHJ B;  4M8I A;  3V3T A;  3CG6 A;  4X3M A;  4YJ2 B;  2PMP A;  3VI6 A;  4YJ3 A;  5EIB D;  4ERH A;  4G88 A;  5HY0 A;  5LXT A;  5GIO C;  3I56 F;  2UYJ A;  4X1K A;  3OON A;  1ONI A;  3N2K A;  4NQ3 A;  3FD6 A;  4IIJ B;  5EZY A;  4F6R A;  3K12 A;  1M1K H;  1E7K A;  1XV2 A;  5LA6 B;  1NQ3 A;  1DT9 A;  3NK7 A;  3VOA A;  5KX5 A;  2LCA A;  1FFX A;  5IYZ A;  2VAP A;  3FBA A;  2LBW A;  1YGY A;  2I6D A;  1RLU A;  3F0F A;  2HP0 B;  3S0Y A;  2DT4 A;  2Q1X A;  1SZQ A;  4O2B A;  3JAT A;  5FNV A;  2FGY A;  3WGK A;  5LP6 C;  4I4T B;  5J2T B;  2OTL F;  4X1Y A;  4ZHV A;  4TUY A;  4ZI7 B;  3AGK A;  1K9M H;  3JAS B;  3U0O A;  3CPW F;  1SA0 B;  1K73 H;  5HY4 A;  4TV8 A;  3FPI A;  4B46 A;  2YYE A;  1TVK B;  4X1I A;  1UFY A;  5JCO A;  3MQW A;  2IG8 A;  3HKB B;  5EWR A;  3IEQ A;  3RA6 A;  5BMV A;  3V4D A;  4RQO A;  5JH7 A;  3OW2 F;  1VQM F;  2GVI A;  5EB1 B;  1W5B A;  1XRG A;  3KJJ A;  1RLG A;  5IJ0 B;  4KWE A;  5GAN K;  4BVQ A;  2KG4 A;  4BVS A;  3I7T A;  5FLX M;  2ZAU A;  3VTI C;  5HY2 A;  4O4H A;  4G4V A;  3N2G B;  5J2U A;  3CCU F;  3M84 A;  2CVL A;  2JNB A;  3QTY A;  3ZP7 A;  1SDS A;  3JAM M;  2MQE A;  1YHQ F;  3ESJ A;  1QU9 A;  3F6M A;  3F0D A;  1YJN F;  2NMU A;  4ZOL A;  3WPX A;  2WAL A;  1QVG F;  1T0A A;  4HNA A;  3KHN A;  2CZW A;  2VAM A;  3TD4 A;  1FNK A;  4LCK A;  1JFF B;  3GTZ A;  3CCS F;  1Q82 H;  5FJ4 C;  4EI9 A;  2Q1Y A;  3CC4 F;  2H8C A;  3RYC B;  2AIF A;  3QUW A;  5ITZ B;  1JY8 A;  2N48 A;  4B5C A;  3CCL F;  5G4U C;  5IJ9 A;  1VQN F;  3PLA C;  5LP6 A;  1VQV A;  4LNU A;  1OAP A;  3CB2 A;  3F0G A;  2ZOD A;  1W3E X;  3CMA F;  2CWJ A;  1S72 F;  4BT2 A;  1VQ9 F;  2OTJ F;  2KGW A;  2BO1 A;  5EYP B;  3QHD A;  3TD5 A;  3NMU C;  4BVR A;  1FNJ A;  2KTU A;  4R40 B;  3D01 A;  1W5F A;  3RYH B;  5HY1 A;  2LBT A;  3RE3 A;  5IT9 M;  4YJ2 A;  1X52 A;  2GLZ A;  4I50 A;  4B45 A;  1VQ5 F;  3CYP B;  1U3L A;  4O4I B;  3JAW A;  3WJP A;  2VGM A;  4EI7 A;  4IIJ A;  1Q7Y H;  1W42 A;  3JAL B;  3P0Z A;  3G4S F;  5KMG A;  5LOV B;  2CHS A;  3CCV F;  3EOR A;  5CA1 B;  2HS4 A;  2I6R A;  2YXZ A;  3B6N A;  5B8F A;  1W2B F;  5GIP C;  3OBY A;  5MN5 A;  3CD6 F;  2RB9 A;  2EWC A;  2HP0 A;  3G6E F;  2UYN A;  3LWR C;  3HJW C;  1TUB B;  2IAF A;  5AVM A;  3WJQ A;  2L26 A;  5CB4 A;  5GON B;  3D00 A;  4I55 B;  4B62 A;  4ZHY B;  4I4T A;  4WBN B;  5CA0 B;  1OFU A;  1X7O A;  3ERN A;  3J80 M;  3JAR B;  1XBI A;  2DYY A;  1Q8R A;  1W41 A;  4ZI7 A;  3GHZ A;  3M4S A;  1KD1 H;  1IV4 A;  3JAS A;  2R6R 1;  1SA0 A;  5HP8 A;  3R0P A;  2ZOV A;  4U3J A;  3VYS C;  3P4E A;  1Z5V A;  1W57 A;  3CC7 F;  2HP3 A;  3HKB A;  4YJ3 B;  4ZK7 A;  1YJW F;  3C9U A;  4X1K B;  2BTO A;  5EB0 A;  1U43 A;  3N2K B;  5HXZ A;  5EZY B;  3KJK A;  1ZWZ A;  5JQG B;  5HP7 A;  3L7Q A;  1H47 A;  3WGL A;  1VQ7 F;  3FFM A;  3HKE B;  3OBW A;  2ZVY A;  5KX5 B;  2G9I A;  3J7A R;  3IKF A;  3VYU C;  4NUT A;  4FFB A;  3HKD B;  4U39 A;  3BYQ A;  4ZHQ B;  4DRX A;  2V9Y A;  3C9S A;  5HWE A;  4O2B B;  3JAT B;  5C8Y A;  1IV3 A;  2CHT A;  3LFO A;  1NMU B;  2AIZ P;  5LYJ B;  2QEX F;  4C4W C;  2R75 1;  1H48 A;  1U40 A;  2OHW A;  4TUY B;  4BT6 A;  3UT5 A;  3NK6 A;  4X3L A;  3HTN A;  5ITZ A;  4TV8 B;  3NVI B;  1Z5W A;  1KNK A;  2GZL A;  5JH7 B;  3LDT A;  5BMV B;  4TV9 A;  1Q86 H;  1YI2 F;  3WXM B;  2P6Y A;  4G4Z A;  4BT5 A;  2AMT A;  2Z1T A;  4X20 B;  3HWU A;  3VMF B;  1W59 A;  5EIB C;  5EYP A;  4O2A A;  3VO8 A;  3VOB A;  4EB6 A;  3DDN A;  3D54 A;  3WJR A;  1K8A H;  1H7M A;  3LWV C;  1R1M A;  3JAK A;  2QA4 F;  3RYH A;  1QAH A;  2H6L A;  3RYF B;  3LYB A;  1RA4 A;  4G4W A;  3P10 A;  3CCR F;  1X25 A;  3VYT C;  3V7E A;  3RYI A;  2RHL A;  5JVD B;  3S06 A;  4ZOL B;  2RHO A;  2RHH A;  4O4I A;  1U3P A;  4HNA B;  4BW0 B;  1Q81 H;  1KC8 H;  1M90 H;  3FD5 A;  1J7H A;  4BVT A;  4O4L A;  4O4J A;  4IHJ A;  3E22 B;  4E6E A;  3ON1 A;  3JAL A;  3K14 A;  3LWP C;  3SIU A;  1W5A A;  3LWQ C;  1X7P A;  3IR9 A;  2OTM A;  3HKC B;  5HXU A;  5IJ9 B;  1VQP F;  1VQL F;  5LP6 B;  3MDO A;  3S02 A;  4LNU B;  1JD1 A;  2VGN A;  5LA6 A;  1T0K B;  1TUB A;  5JCO C;  4TZZ A;  3CCJ F;  2UYK A;  3RA5 A;  4BT4 A;  1IV1 A;  5GON A;  1GO0 A;  4I55 A;  3JVH A;  1KNJ A;  1VHA A;  3O85 A;  3CCQ F;  3CME F;  1YIT F;  3SIV A;  5GAP K;  1N8R H;  4BT7 A;  1NJI H;  3ZP4 A;  5MN4 A;  2UYP A;  3K2X A;  4I50 B;  5J2T A;  1W5E A;  1W55 A;  3WGM A;  3JAW B;  3IKE A;  4RHA A;  3V7Q A;  1TVK A;  4G4X A;  2KTV A;  5JQG A;  5KMG B;  2Z1U A;  3HKE A;  5LXT B;  2K1S A;  4NWO B;  5IJ0 A;  4PWT A;  1GZ0 A;  3JCM M;  4F6R B; 
#chains in the Genus database with same CATH homology
 3V3T A;  1S72 F;  3CG6 A;  2OZB A;  4X3M A;  1VQ9 F;  2OTJ F;  3NK6 A;  2BO1 A;  4X3L A;  3VI6 A;  3CXC F;  2ALE A;  5HY0 A;  3NVI B;  5GIO C;  3NMU C;  3I56 F;  4BVR A;  1Q86 H;  4NQ3 A;  1YI2 F;  2KTU A;  1IPA A;  3WXM B;  5HY1 A;  3MCA B;  3CCE F;  1M1K H;  3CMA F;  5IT9 M;  3VMF B;  1E7K A;  3G71 F;  1X52 A;  2GLZ A;  3J81 M;  1VQ5 F;  1DT9 A;  3NK7 A;  4BY9 D;  1K8A H;  1H7M A;  1YIJ F;  3LWV C;  2VGM A;  4EI7 A;  2LBW A;  3CCM F;  1JJ2 F;  2QA4 F;  1Q7Y H;  2I6D A;  1W42 A;  1VQO F;  1RA4 A;  3CCR F;  3G4S F;  3V7E A;  1W40 A;  4EI8 A;  3CCV F;  2FGY A;  4BW0 B;  1Q81 H;  1KC8 H;  1M90 H;  2F9Z C;  4BVT A;  1W2B F;  5GIP C;  2OTL F;  1GO1 A;  3E20 B;  5EO3 A;  3AGK A;  3OBY A;  1K9M H;  3CPW F;  3ON1 A;  3G6E F;  1K73 H;  3LWP C;  3LWR C;  3HJW C;  3SIU A;  5HY4 A;  3N4Y A;  3RA6 A;  5EWR A;  3OW2 F;  2LBX A;  3D00 A;  3LWQ C;  1VQM F;  1X7P A;  3IR9 A;  3PAF A;  1X7O A;  1RLG A;  3J80 M;  5HXU A;  1VQP F;  1XBI A;  1VQL F;  1W41 A;  5GAN K;  4BVQ A;  2KG4 A;  1KD1 H;  4BVS A;  2HVY D;  5A2Q M;  5FLX M;  5HY2 A;  3I55 F;  2VGN A;  1T0K B;  3CC7 F;  3HAX D;  5G4V C;  4TZZ A;  3CCJ F;  3RA5 A;  3CCU F;  2JNB A;  1YJW F;  1SDS A;  1GO0 A;  1VQ6 F;  3JAM M;  1YHQ F;  3CD6 F;  1KQS F;  3O85 A;  1VQ4 F;  1VQK F;  1PXW A;  3CCQ F;  5HXZ A;  3CME F;  1YIT F;  3SIV A;  1ZWZ A;  5DCV A;  5GAP K;  1N8R H;  1YJN F;  1NJI H;  4XCQ A;  2WAL A;  1QVG F;  1VQ7 F;  3FFM A;  3GYQ A;  1CK2 A;  2CZW A;  3NVK E;  3OBW A;  1YJ9 F;  3J7A R;  4LCK A;  4NUT A;  3E1Y A;  3LWO C;  1VQ8 F;  3CCS F;  5GIN C;  1QVF F;  3V7Q A;  1Q82 H;  5FJ4 C;  4EI9 A;  2KTV A;  3CC4 F;  1CN7 A;  3CPQ A;  2AIF A;  2QI2 A;  5HWE A;  3CCL F;  5G4U C;  3LFO A;  1VQN F;  1NMU B;  3PLA C;  3CC2 F;  1GZ0 A;  2QEX F;  4C4W C;  3N4Z A;  3JCM M;  2FC3 A;  1W3E X;  2OHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...