2ALEA

Crystal structure of yeast rna splicing factor snu13p
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
132
structure length
132
Chain Sequence
MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLILEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of pre-mRNA and pre-rRNA processing factor Snu13p structure and mutants.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords NHP2/L7aE family protein YEL026W
total genus 45
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2005-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2aleA00
3HAXD 1K73H 5A2QM 1S72F 2OZBA 3CCEF 3E1YA 1YIJF 2JNBA 1K9MH 1M1KH 3MCAB 1VQ5F 1PXWA 2LBXA 2AIFA 3WXMB 1VQ9F 4LCKA 1Q7YH 5IT9M 1VQMF 2VGNA 1W3EX 1X7OA 3G4SF 4X3MA 1DT9A 3CG6A 3CCJF 1XBIA 2BO1A 3I55F 3N4YA 4X3LA 1X7PA 3I56F 2LBWA 2FC3A 3CPWF 3GYQA 1W41A 1M90H 3JCMM 1Q81H 3LWPC 3J81M 1Q82H 3V7QA 2KG4A 2OHWA 1GZ0A 2QI2A 2HVYD 1QVFF 3G6EF 3PLAC 2OTLF 5EWRA 1YITF 1KC8H 3CPQA 2QA4F 1CK2A 5G4UC 3CMAF 1VQ8F 1NMUB 3CCLF 1N8RH 3OW2F 3RA5A 1YJNF 1IPAA 3OBWA 1NJIH 1RA4A 3LWOC 3HJWC 1VQ6F 3VI6A 3CCRF 3AGKA 5GINC 1YHQF 2I6DA 1T0KB 1YJ9F 3NK6A 3OBYA 3CCSF 3CCUF 3LWQC 1YJWF 3J7AR 3VMFB 3NK7A 2OTJF 1W2BF 4TZZA 1YI2F 1QVGF 4C4WC 1CN7A 3CC2F 3SIVA 5GIOC 3V7EA 4NUTA 4BY9D 3LWVC 3CC4F 1VQLF 3N4ZA 1W40A 1GO1A 1JJ2F 2VGMA 3G71F 1Q86H 3CC7F 1SDSA 3IR9A 1VQKF 1VQ4F 5DCVA 2QEXF 3NMUC 2KTVA 2KTUA 3LWRC 3NVIB 1W42A 5G4VC 3CCQF 3O85A 3PAFA 5GANK 1H7MA 1KD1H 3JAMM 1ZWZA 3CMEF 5GIPC 1K8AH 1E7KA 1KQSF 3LFOA 1VQ7F 3CXCF 3NVKE 3FFMA 3E20B 5EO3A 1VQNF 5FJ4C 3CD6F 1VQPF 3CCVF 2ALEA 1GO0A 2CZWA 5FLXM 1VQOF 5GAPK 1RLGA 3SIUA 3J80M 2WALA 3RA6A 4BW0B 3ON1A 1X52A 3CCMF
chains in the Genus database with same CATH superfamily
4EB6B 4O4JA 1K73H 1S72F 1FFXB 5CA0A 3E1YA 3K0TA 1M1KH 1VQ5F 1VHAA 3E22A 3WXMB 3JASA 2Z1UA 5J2UB 1Q7YH 3WGLA 1VQMF 1U40A 3S06A 1VH8A 1J7HA 5LA6A 5KMGA 5CB4A 3IMPA 2DYYA 3FBAA 4C82A 3CCJF 1XBIA 2BO1A 3RYFA 3P10A 4TUYA 4X1KA 4O2BA 5LOVA 5EIBC 4G4ZA 3JCMM 3HKDA 3KJKA 5EAZA 2QI2A 3B6NA 2HVYD 1QVFF 3S02A 4I50A 1JN1A 2OTLF 3S0YA 2V9YA 3IEQA 4PWTA 4KWEA 3CPQA 3HKEA 1KC8H 2H6LA 1CK2A 3N2KA 4G4WA 4I4TB 1VQ8F 1R1MA 3RA5A 1YJNF 4ZHWA 4C8EA 5JVDA 1RA4A 4C8IA 4TV9B 3M4SA 3MQWA 3WJQA 2HS0A 4X20A 1W59A 4ZOLA 2IAFA 4ZHQA 3VTIC 5BMVB 1SZQA 1TUBB 3AGKA 1W55A 5HXUA 3P4EA 3WGKA 5HP7A 3CCSF 3LWQC 3NK7A 4YJ2A 4TZZA 1QVGF 4C4WC 2QTPA 3GTZA 2RHJA 3SIVA 1Z5VA 2HRYA 2GLZA 1QD9A 3DDNA 5AVMA 1VQLF 3CYQA 4LNUB 4B45A 1KNKA 4BT4A 4ERHA 1GO1A 5IJ9A 1JJ2F 3CC7F 3IR9A 1VQKF 3C9TA 3IKEA 5FNVB 3KJJA 1H47A 1PF5A 4WBNB 5G4VC 4IHJB 4BT7A 3PAFA 4G4VA 1U3PA 5GIPC 3JATB 1RQ2A 3JAKA 5C8YB 3ZP7A 2Q1YA 3RYHB 4EI7A 1VQ7F 1RLUA 3NVKE 3FFMA 5EO3A 3HKBA 4TV8A 4F6RB 1VQPF 1GO0A 3ESJA 5FLXM 1VQOF 1JFFB 3D01A 2W8BC 4X1IA 2WALA 3M84A 3RYCB 4BW0B 5JQGA 1X52A 3D54A 1Q82H 5HXZA 3RYCA 3FD6A 4BT3A 2Z1FA 4BT5A 2Z1EA 5KX5A 1UFYA 3CCEF 2JNBA 2OTMA 1JD1A 2AIFA 4U3JB 3TD5A 2KGWA 1VQ9F 4LCKA 4TV8B 4F6RA 2CVLA 2K1SA 3MBMA 3HKCB 3RYHA 3JAKB 3MCQA 3BYQA 3G4SF 2CSLA 1W5EA 5JH7A 3F0DA 4X3LA 1XRGA 2UYKA 5EZYB 4B62A 1Z5WA 2FC3A 4BVTA 3I3FA 1W41A 3RYIB 3P0ZA 3LWPC 2HQSC 5FNVA 4U39A 3ZP4A 3V3TA 3C9SA 5GONA 2MQEA 1IV3A 4FFBA 2UYJA 5CA1A 2RB9A 2LBTA 1DBFA 3RYIA 2N48A 5G4UC 5ITZB 2VAMA 1T0AA 1VK3A 4FFBB 2CWJA 4G4YA 3OBWA 3T80A 3TD4A 5GONB 2CHSA 4BVSA 2H8CA 1U43A 2HP3A 1YQNA 4ZOLB 3VOAA 3KHNA 2H8EA 5HY4A 4BT6A 4HNAB 2I6DA 3NK6A 1YJWF 3VMFB 2OTJF 4C8GA 1YI2F 1FNJA 3VOBA 3CC2F 4X1IB 4ZK7A 1JFFA 3LMEA 3LWVC 3CC4F 2CHTA 2ZODA 5KX5B 2BTQB 1VQ4F 2RHHA 5DCVA 2IG8A 3ELCA 1OAPA 5LOVB 3LWRC 1XV2A 3CCQF 1QU9A 2UZHA 2ZVYA 3O85A 4HNAA 4BVQA 3VYTC 1H7MA 1KD1H 1NQ3A 3CMEF 1KQSF 3QUWA 3E20B 1W581 1W57A 3CD6F 3ERNA 2VXYA 3CCVF 3E22B 5EB1B 4IHJA 1KNJA 5JCOA 5ITZA 1ONIA 3CCMF 2AMTA 3HAXD 2R751 5CA1B 1K9MH 5HP8A 3MCAB 1IV1A 1PXWA 2LBXA 3TD3A 4BT2A 2AIZP 2ZVZA 1SA0A 5IT9M 4X20B 5IJ0A 1X7OA 2ZOVA 4X3MA 4YJ2B 1DT9A 1RQ7A 5EZYA 3FD5A 3S0HA 1CLIA 3MDOA 3N4YA 5JH7B 3I56F 4I4TA 1TUBA 2PMPA 3GYQA 3CPWF 5LXTA 5BMVA 1M90H 3HKCA 3R0PA 2VAPA 5B8FA 2OHWA 1GZ0A 4TV9A 3PLAC 4U3JA 3ZO8A 3WPXA 5EWRA 3IEWA 4I55B 4I50B 5MN6A 5EB0A 3K12A 3HWUA 5JQGB 2B33A 3F0EA 3D00A 4RQOA 2RHLA 4YJ3B 2F9ZC 3WJPA 3CMAF 4O2BB 1W5AA 1QAHA 3HKEB 1COMA 1N8RH 1Q8RA 3HKBB 5JCOC 3LWOC 1FNKA 5KMGB 3HJWC 3JATA 2HS4A 5C8YA 2G9IA 1FSZA 3WPWA 3VI6A 3CCRF 3I7TA 2VAWA 5J2UA 3VYSC 3JASB 1YHQF 3S03A 3CB2A 3L7QA 4NQ3A 1YJ9F 2UYPA 5J2TA 4WBNA 1T0KB 5CA0B 3C9UA 3KIZA 1ODEA 4O4JB 5CB4B 1CN7A 2CW4A 3UT5A 5GIOC 3JARA 3V7EA 4NUTA 3VYUC 4BY9D 1W5BA 5IJ9B 3N4ZA 4LNUA 1W40A 2I6RA 2VGMA 1SDSA 1H48A 1FFXA 4DXDA 4EB6A 2QEXF 2BTOA 3K14A 3WGMA 4NWOB 2PHNA 4O4IB 1IV2A 1W42A 3C8LA 3JALA 4E6EA 5MN5A 2YXZA 3JAMM 4XCQA 1K8AH 2HRUA 4ZHQB 1E7KA 3S0WA 3LFOA 3WGJA 5FJ4C 5JVDB 1TVKA 2UYNB 2ALEA 2CZWA 5GAPK 2YYEA 3Q8HA 2L26A 3IKFA 2GVIA 3HTNA 3J80M 3SIUA 3RA6A 4BVRA 3ON1A 5LYJA 4RHAA 3N2KB 4IIJB 3VCZA 4DRXB 5A2QM 3DC2A 2OZBA 4ZI7B 3C9RA 2LCAA 1YIJF 3N2GA 4ZHVA 4O4LA 4X1YA 4C81A 3GHZA 5EYPB 5HY2A 4M8IA 3HKDB 2VGNA 1W3EX 3QHDA 4TUYB 4X1KB 3VO8A 1UI9A 3CG6A 3JAWB 3RYFB 3I55F 4B5CA 1X7PA 2LBWA 4B46A 3QTYA 5LA6B 5LP6A 1Q81H 3J81M 3V7QA 3WJRA 4O2AA 3F6MA 2KG4A 3U0OA 1OFUA 3G6EF 3K2XA 1YGYA 2ZAUA 1GX1A 3JVHA 1U3LA 4G4XA 1YITF 3V4DA 4ZHYB 3KE1A 2RHOA 2QA4F 2HS3A 3JARB 3UT5B 5EIBD 2FGYA 1NMUB 3CCLF 3OW2F 1IPAA 3JAWA 5J2TB 1NJIH 2BTUA 3RE3A 2HP0B 1VQ6F 4O2AB 5LP6B 2P6YA 2Q1XA 3ZOPA 2DT4A 5IYZA 5GINC 2ZF8A 5EYPA 4R40B 5HY0A 4X1YB 1JY8A 3OBYA 3CCUF 1W5FA 3J7AR 3EORA 2IQQA 1W2BF 2R6R1 2GZLA 4YJ3A 5LP6C 3F0GA 3F0FA 5HY1A 4O4HB 4O4HA 4I55A 1X25A 2UYNA 4O4LB 3N2GB 4EI9A 3G71F 1Q86H 1IV4A 5HWEA 4ZI7A 3VIUA 4EI8A 4IIJA 4DRXA 4G88A 5LYJB 3OONA 5LXTB 1VQVA 3NMUC 2KTVA 2KTUA 3JALB 3NVIB 5MN4A 1XHOA 1TVKB 5IYZB 5GANK 1ZWZA 3CYPB 3LYBA 5IJ0B 3FPIA 2HP0A 2NMUA 3LDTA 3CXCF 1VQNF 1SA0B 2Z01A 3M1XA 3WGNA 2HX0A 1RLGA 4O4IA 2Z1TA 2EWCA
chains in the Genus database with same CATH topology
3HAXD 5HXZA 1K73H 5A2QM 1S72F 2OZBA 3CCEF 3E1YA 1YIJF 2JNBA 1K9MH 1M1KH 3MCAB 1VQ5F 1PXWA 2LBXA 2AIFA 3WXMB 1VQ9F 4LCKA 1Q7YH 5IT9M 5HY2A 1VQMF 2VGNA 1W3EX 1X7OA 3G4SF 4X3MA 1DT9A 3CG6A 3CCJF 1XBIA 2BO1A 3N4YA 3I55F 4X3LA 1X7PA 3I56F 2LBWA 2FC3A 3CPWF 4BVTA 3GYQA 1W41A 1M90H 3JCMM 1Q81H 3LWPC 3J81M 1Q82H 3V7QA 2KG4A 2OHWA 1GZ0A 2QI2A 2HVYD 1QVFF 3G6EF 3PLAC 2OTLF 3V3TA 5EWRA 1YITF 1KC8H 3CPQA 2QA4F 1CK2A 5G4UC 3D00A 3CMAF 2F9ZC 2FGYA 1VQ8F 1NMUB 3CCLF 1N8RH 3OW2F 3RA5A 1YJNF 1IPAA 3OBWA 1NJIH 1RA4A 3LWOC 4BVSA 3HJWC 1VQ6F 3VI6A 3CCRF 3AGKA 5GINC 1YHQF 5HY4A 5HY0A 5HXUA 2I6DA 4NQ3A 1YJ9F 1T0KB 3NK6A 3OBYA 3CCSF 3CCUF 3LWQC 1YJWF 3J7AR 3VMFB 3NK7A 2OTJF 1W2BF 4TZZA 1YI2F 1QVGF 4C4WC 1CN7A 3CC2F 3SIVA 5GIOC 3V7EA 2GLZA 4NUTA 4BY9D 3LWVC 3CC4F 5HY1A 1VQLF 3N4ZA 1W40A 4EI9A 1GO1A 1JJ2F 2VGMA 3G71F 1Q86H 3CC7F 5HWEA 3IR9A 1VQKF 1SDSA 4EI8A 1VQ4F 5DCVA 2QEXF 3NMUC 2KTVA 2KTUA 3LWRC 3NVIB 1W42A 5G4VC 3CCQF 3O85A 3PAFA 4BVQA 5GANK 1H7MA 1KD1H 3JAMM 1ZWZA 4XCQA 5GIPC 3CMEF 1K8AH 1E7KA 1KQSF 3LFOA 4EI7A 1VQ7F 3CXCF 3NVKE 3FFMA 3E20B 5EO3A 1VQNF 5FJ4C 3CD6F 1VQPF 3CCVF 2ALEA 1GO0A 2CZWA 5FLXM 1VQOF 5GAPK 1RLGA 3SIUA 3J80M 2WALA 3RA6A 4BW0B 4BVRA 3ON1A 1X52A 3CCMF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HAX D;  1K73 H;  5A2Q M;  1S72 F;  2OZB A;  3CCE F;  3E1Y A;  1YIJ F;  2JNB A;  1K9M H;  1M1K H;  3MCA B;  1VQ5 F;  1PXW A;  2LBX A;  2AIF A;  3WXM B;  1VQ9 F;  4LCK A;  1Q7Y H;  5IT9 M;  1VQM F;  2VGN A;  1W3E X;  1X7O A;  3G4S F;  4X3M A;  1DT9 A;  3CG6 A;  3CCJ F;  1XBI A;  2BO1 A;  3I55 F;  3N4Y A;  4X3L A;  1X7P A;  3I56 F;  2LBW A;  2FC3 A;  3CPW F;  3GYQ A;  1W41 A;  1M90 H;  3JCM M;  1Q81 H;  3LWP C;  3J81 M;  1Q82 H;  3V7Q A;  2KG4 A;  2OHW A;  1GZ0 A;  2QI2 A;  2HVY D;  1QVF F;  3G6E F;  3PLA C;  2OTL F;  5EWR A;  1YIT F;  1KC8 H;  3CPQ A;  2QA4 F;  1CK2 A;  5G4U C;  3CMA F;  1VQ8 F;  1NMU B;  3CCL F;  1N8R H;  3OW2 F;  3RA5 A;  1YJN F;  1IPA A;  3OBW A;  1NJI H;  1RA4 A;  3LWO C;  3HJW C;  1VQ6 F;  3VI6 A;  3CCR F;  3AGK A;  5GIN C;  1YHQ F;  2I6D A;  1T0K B;  1YJ9 F;  3NK6 A;  3OBY A;  3CCS F;  3CCU F;  3LWQ C;  1YJW F;  3J7A R;  3VMF B;  3NK7 A;  2OTJ F;  1W2B F;  4TZZ A;  1YI2 F;  1QVG F;  4C4W C;  1CN7 A;  3CC2 F;  3SIV A;  5GIO C;  3V7E A;  4NUT A;  4BY9 D;  3LWV C;  3CC4 F;  1VQL F;  3N4Z A;  1W40 A;  1GO1 A;  1JJ2 F;  2VGM A;  3G71 F;  1Q86 H;  3CC7 F;  1SDS A;  3IR9 A;  1VQK F;  1VQ4 F;  5DCV A;  2QEX F;  3NMU C;  2KTV A;  2KTU A;  3LWR C;  3NVI B;  1W42 A;  5G4V C;  3CCQ F;  3O85 A;  3PAF A;  5GAN K;  1H7M A;  1KD1 H;  3JAM M;  1ZWZ A;  3CME F;  5GIP C;  1K8A H;  1E7K A;  1KQS F;  3LFO A;  1VQ7 F;  3CXC F;  3NVK E;  3FFM A;  3E20 B;  5EO3 A;  1VQN F;  5FJ4 C;  3CD6 F;  1VQP F;  3CCV F;  2ALE A;  1GO0 A;  2CZW A;  5FLX M;  1VQO F;  5GAP K;  1RLG A;  3SIU A;  3J80 M;  2WAL A;  3RA6 A;  4BW0 B;  3ON1 A;  1X52 A;  3CCM F; 
#chains in the Genus database with same CATH topology
 4EB6 B;  4O4J A;  1K73 H;  1S72 F;  1FFX B;  5CA0 A;  3E1Y A;  3K0T A;  1M1K H;  1VQ5 F;  1VHA A;  3E22 A;  3WXM B;  3JAS A;  2Z1U A;  5J2U B;  1Q7Y H;  3WGL A;  1VQM F;  1U40 A;  3S06 A;  1VH8 A;  1J7H A;  5LA6 A;  5KMG A;  5CB4 A;  3IMP A;  2DYY A;  3FBA A;  4C82 A;  3CCJ F;  1XBI A;  2BO1 A;  3RYF A;  3P10 A;  4TUY A;  4X1K A;  4O2B A;  5LOV A;  5EIB C;  4G4Z A;  3JCM M;  3HKD A;  3KJK A;  5EAZ A;  2QI2 A;  3B6N A;  2HVY D;  1QVF F;  3S02 A;  4I50 A;  1JN1 A;  2OTL F;  3S0Y A;  2V9Y A;  3IEQ A;  4PWT A;  4KWE A;  3CPQ A;  3HKE A;  1KC8 H;  2H6L A;  1CK2 A;  3N2K A;  4G4W A;  4I4T B;  1VQ8 F;  1R1M A;  3RA5 A;  1YJN F;  4ZHW A;  4C8E A;  5JVD A;  1RA4 A;  4C8I A;  4TV9 B;  3M4S A;  3MQW A;  3WJQ A;  2HS0 A;  4X20 A;  1W59 A;  4ZOL A;  2IAF A;  4ZHQ A;  3VTI C;  5BMV B;  1SZQ A;  1TUB B;  3AGK A;  1W55 A;  5HXU A;  3P4E A;  3WGK A;  5HP7 A;  3CCS F;  3LWQ C;  3NK7 A;  4YJ2 A;  4TZZ A;  1QVG F;  4C4W C;  2QTP A;  3GTZ A;  2RHJ A;  3SIV A;  1Z5V A;  2HRY A;  2GLZ A;  1QD9 A;  3DDN A;  5AVM A;  1VQL F;  3CYQ A;  4LNU B;  4B45 A;  1KNK A;  4BT4 A;  4ERH A;  1GO1 A;  5IJ9 A;  1JJ2 F;  3CC7 F;  3IR9 A;  1VQK F;  3C9T A;  3IKE A;  5FNV B;  3KJJ A;  1H47 A;  1PF5 A;  4WBN B;  5G4V C;  4IHJ B;  4BT7 A;  3PAF A;  4G4V A;  1U3P A;  5GIP C;  3JAT B;  1RQ2 A;  3JAK A;  5C8Y B;  3ZP7 A;  2Q1Y A;  3RYH B;  4EI7 A;  1VQ7 F;  1RLU A;  3NVK E;  3FFM A;  5EO3 A;  3HKB A;  4TV8 A;  4F6R B;  1VQP F;  1GO0 A;  3ESJ A;  5FLX M;  1VQO F;  1JFF B;  3D01 A;  2W8B C;  4X1I A;  2WAL A;  3M84 A;  3RYC B;  4BW0 B;  5JQG A;  1X52 A;  3D54 A;  1Q82 H;  5HXZ A;  3RYC A;  3FD6 A;  4BT3 A;  2Z1F A;  4BT5 A;  2Z1E A;  5KX5 A;  1UFY A;  3CCE F;  2JNB A;  2OTM A;  1JD1 A;  2AIF A;  4U3J B;  3TD5 A;  2KGW A;  1VQ9 F;  4LCK A;  4TV8 B;  4F6R A;  2CVL A;  2K1S A;  3MBM A;  3HKC B;  3RYH A;  3JAK B;  3MCQ A;  3BYQ A;  3G4S F;  2CSL A;  1W5E A;  5JH7 A;  3F0D A;  4X3L A;  1XRG A;  2UYK A;  5EZY B;  4B62 A;  1Z5W A;  2FC3 A;  4BVT A;  3I3F A;  1W41 A;  3RYI B;  3P0Z A;  3LWP C;  2HQS C;  5FNV A;  4U39 A;  3ZP4 A;  3V3T A;  3C9S A;  5GON A;  2MQE A;  1IV3 A;  4FFB A;  2UYJ A;  5CA1 A;  2RB9 A;  2LBT A;  1DBF A;  3RYI A;  2N48 A;  5G4U C;  5ITZ B;  2VAM A;  1T0A A;  1VK3 A;  4FFB B;  2CWJ A;  4G4Y A;  3OBW A;  3T80 A;  3TD4 A;  5GON B;  2CHS A;  4BVS A;  2H8C A;  1U43 A;  2HP3 A;  1YQN A;  4ZOL B;  3VOA A;  3KHN A;  2H8E A;  5HY4 A;  4BT6 A;  4HNA B;  2I6D A;  3NK6 A;  1YJW F;  3VMF B;  2OTJ F;  4C8G A;  1YI2 F;  1FNJ A;  3VOB A;  3CC2 F;  4X1I B;  4ZK7 A;  1JFF A;  3LME A;  3LWV C;  3CC4 F;  2CHT A;  2ZOD A;  5KX5 B;  2BTQ B;  1VQ4 F;  2RHH A;  5DCV A;  2IG8 A;  3ELC A;  1OAP A;  5LOV B;  3LWR C;  1XV2 A;  3CCQ F;  1QU9 A;  2UZH A;  2ZVY A;  3O85 A;  4HNA A;  4BVQ A;  3VYT C;  1H7M A;  1KD1 H;  1NQ3 A;  3CME F;  1KQS F;  3QUW A;  3E20 B;  1W58 1;  1W57 A;  3CD6 F;  3ERN A;  2VXY A;  3CCV F;  3E22 B;  5EB1 B;  4IHJ A;  1KNJ A;  5JCO A;  5ITZ A;  1ONI A;  3CCM F;  2AMT A;  3HAX D;  2R75 1;  5CA1 B;  1K9M H;  5HP8 A;  3MCA B;  1IV1 A;  1PXW A;  2LBX A;  3TD3 A;  4BT2 A;  2AIZ P;  2ZVZ A;  1SA0 A;  5IT9 M;  4X20 B;  5IJ0 A;  1X7O A;  2ZOV A;  4X3M A;  4YJ2 B;  1DT9 A;  1RQ7 A;  5EZY A;  3FD5 A;  3S0H A;  1CLI A;  3MDO A;  3N4Y A;  5JH7 B;  3I56 F;  4I4T A;  1TUB A;  2PMP A;  3GYQ A;  3CPW F;  5LXT A;  5BMV A;  1M90 H;  3HKC A;  3R0P A;  2VAP A;  5B8F A;  2OHW A;  1GZ0 A;  4TV9 A;  3PLA C;  4U3J A;  3ZO8 A;  3WPX A;  5EWR A;  3IEW A;  4I55 B;  4I50 B;  5MN6 A;  5EB0 A;  3K12 A;  3HWU A;  5JQG B;  2B33 A;  3F0E A;  3D00 A;  4RQO A;  2RHL A;  4YJ3 B;  2F9Z C;  3WJP A;  3CMA F;  4O2B B;  1W5A A;  1QAH A;  3HKE B;  1COM A;  1N8R H;  1Q8R A;  3HKB B;  5JCO C;  3LWO C;  1FNK A;  5KMG B;  3HJW C;  3JAT A;  2HS4 A;  5C8Y A;  2G9I A;  1FSZ A;  3WPW A;  3VI6 A;  3CCR F;  3I7T A;  2VAW A;  5J2U A;  3VYS C;  3JAS B;  1YHQ F;  3S03 A;  3CB2 A;  3L7Q A;  4NQ3 A;  1YJ9 F;  2UYP A;  5J2T A;  4WBN A;  1T0K B;  5CA0 B;  3C9U A;  3KIZ A;  1ODE A;  4O4J B;  5CB4 B;  1CN7 A;  2CW4 A;  3UT5 A;  5GIO C;  3JAR A;  3V7E A;  4NUT A;  3VYU C;  4BY9 D;  1W5B A;  5IJ9 B;  3N4Z A;  4LNU A;  1W40 A;  2I6R A;  2VGM A;  1SDS A;  1H48 A;  1FFX A;  4DXD A;  4EB6 A;  2QEX F;  2BTO A;  3K14 A;  3WGM A;  4NWO B;  2PHN A;  4O4I B;  1IV2 A;  1W42 A;  3C8L A;  3JAL A;  4E6E A;  5MN5 A;  2YXZ A;  3JAM M;  4XCQ A;  1K8A H;  2HRU A;  4ZHQ B;  1E7K A;  3S0W A;  3LFO A;  3WGJ A;  5FJ4 C;  5JVD B;  1TVK A;  2UYN B;  2ALE A;  2CZW A;  5GAP K;  2YYE A;  3Q8H A;  2L26 A;  3IKF A;  2GVI A;  3HTN A;  3J80 M;  3SIU A;  3RA6 A;  4BVR A;  3ON1 A;  5LYJ A;  4RHA A;  3N2K B;  4IIJ B;  3VCZ A;  4DRX B;  5A2Q M;  3DC2 A;  2OZB A;  4ZI7 B;  3C9R A;  2LCA A;  1YIJ F;  3N2G A;  4ZHV A;  4O4L A;  4X1Y A;  4C81 A;  3GHZ A;  5EYP B;  5HY2 A;  4M8I A;  3HKD B;  2VGN A;  1W3E X;  3QHD A;  4TUY B;  4X1K B;  3VO8 A;  1UI9 A;  3CG6 A;  3JAW B;  3RYF B;  3I55 F;  4B5C A;  1X7P A;  2LBW A;  4B46 A;  3QTY A;  5LA6 B;  5LP6 A;  1Q81 H;  3J81 M;  3V7Q A;  3WJR A;  4O2A A;  3F6M A;  2KG4 A;  3U0O A;  1OFU A;  3G6E F;  3K2X A;  1YGY A;  2ZAU A;  1GX1 A;  3JVH A;  1U3L A;  4G4X A;  1YIT F;  3V4D A;  4ZHY B;  3KE1 A;  2RHO A;  2QA4 F;  2HS3 A;  3JAR B;  3UT5 B;  5EIB D;  2FGY A;  1NMU B;  3CCL F;  3OW2 F;  1IPA A;  3JAW A;  5J2T B;  1NJI H;  2BTU A;  3RE3 A;  2HP0 B;  1VQ6 F;  4O2A B;  5LP6 B;  2P6Y A;  2Q1X A;  3ZOP A;  2DT4 A;  5IYZ A;  5GIN C;  2ZF8 A;  5EYP A;  4R40 B;  5HY0 A;  4X1Y B;  1JY8 A;  3OBY A;  3CCU F;  1W5F A;  3J7A R;  3EOR A;  2IQQ A;  1W2B F;  2R6R 1;  2GZL A;  4YJ3 A;  5LP6 C;  3F0G A;  3F0F A;  5HY1 A;  4O4H B;  4O4H A;  4I55 A;  1X25 A;  2UYN A;  4O4L B;  3N2G B;  4EI9 A;  3G71 F;  1Q86 H;  1IV4 A;  5HWE A;  4ZI7 A;  3VIU A;  4EI8 A;  4IIJ A;  4DRX A;  4G88 A;  5LYJ B;  3OON A;  5LXT B;  1VQV A;  3NMU C;  2KTV A;  2KTU A;  3JAL B;  3NVI B;  5MN4 A;  1XHO A;  1TVK B;  5IYZ B;  5GAN K;  1ZWZ A;  3CYP B;  3LYB A;  5IJ0 B;  3FPI A;  2HP0 A;  2NMU A;  3LDT A;  3CXC F;  1VQN F;  1SA0 B;  2Z01 A;  3M1X A;  3WGN A;  2HX0 A;  1RLG A;  4O4I A;  2Z1T A;  2EWC A; 
#chains in the Genus database with same CATH homology
 3HAX D;  5HXZ A;  1K73 H;  5A2Q M;  1S72 F;  2OZB A;  3CCE F;  3E1Y A;  1YIJ F;  2JNB A;  1K9M H;  1M1K H;  3MCA B;  1VQ5 F;  1PXW A;  2LBX A;  2AIF A;  3WXM B;  1VQ9 F;  4LCK A;  1Q7Y H;  5IT9 M;  5HY2 A;  1VQM F;  2VGN A;  1W3E X;  1X7O A;  3G4S F;  4X3M A;  1DT9 A;  3CG6 A;  3CCJ F;  1XBI A;  2BO1 A;  3N4Y A;  3I55 F;  4X3L A;  1X7P A;  3I56 F;  2LBW A;  2FC3 A;  3CPW F;  4BVT A;  3GYQ A;  1W41 A;  1M90 H;  3JCM M;  1Q81 H;  3LWP C;  3J81 M;  1Q82 H;  3V7Q A;  2KG4 A;  2OHW A;  1GZ0 A;  2QI2 A;  2HVY D;  1QVF F;  3G6E F;  3PLA C;  2OTL F;  3V3T A;  5EWR A;  1YIT F;  1KC8 H;  3CPQ A;  2QA4 F;  1CK2 A;  5G4U C;  3D00 A;  3CMA F;  2F9Z C;  2FGY A;  1VQ8 F;  1NMU B;  3CCL F;  1N8R H;  3OW2 F;  3RA5 A;  1YJN F;  1IPA A;  3OBW A;  1NJI H;  1RA4 A;  3LWO C;  4BVS A;  3HJW C;  1VQ6 F;  3VI6 A;  3CCR F;  3AGK A;  5GIN C;  1YHQ F;  5HY4 A;  5HY0 A;  5HXU A;  2I6D A;  4NQ3 A;  1YJ9 F;  1T0K B;  3NK6 A;  3OBY A;  3CCS F;  3CCU F;  3LWQ C;  1YJW F;  3J7A R;  3VMF B;  3NK7 A;  2OTJ F;  1W2B F;  4TZZ A;  1YI2 F;  1QVG F;  4C4W C;  1CN7 A;  3CC2 F;  3SIV A;  5GIO C;  3V7E A;  2GLZ A;  4NUT A;  4BY9 D;  3LWV C;  3CC4 F;  5HY1 A;  1VQL F;  3N4Z A;  1W40 A;  4EI9 A;  1GO1 A;  1JJ2 F;  2VGM A;  3G71 F;  1Q86 H;  3CC7 F;  5HWE A;  3IR9 A;  1VQK F;  1SDS A;  4EI8 A;  1VQ4 F;  5DCV A;  2QEX F;  3NMU C;  2KTV A;  2KTU A;  3LWR C;  3NVI B;  1W42 A;  5G4V C;  3CCQ F;  3O85 A;  3PAF A;  4BVQ A;  5GAN K;  1H7M A;  1KD1 H;  3JAM M;  1ZWZ A;  4XCQ A;  5GIP C;  3CME F;  1K8A H;  1E7K A;  1KQS F;  3LFO A;  4EI7 A;  1VQ7 F;  3CXC F;  3NVK E;  3FFM A;  3E20 B;  5EO3 A;  1VQN F;  5FJ4 C;  3CD6 F;  1VQP F;  3CCV F;  2ALE A;  1GO0 A;  2CZW A;  5FLX M;  1VQO F;  5GAP K;  1RLG A;  3SIU A;  3J80 M;  2WAL A;  3RA6 A;  4BW0 B;  4BVR A;  3ON1 A;  1X52 A;  3CCM F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...