2ALEA

Crystal structure of yeast rna splicing factor snu13p
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
132
structure length
132
Chain Sequence
b'MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLILEHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NHP2/L7aE family protein YEL026W
molecule tags Rna binding protein
source organism Saccharomyces cerevisiae
publication title Analysis of pre-mRNA and pre-rRNA processing factor Snu13p structure and mutants.
pubmed doi rcsb
total genus 45
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2005-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2aleA00
3J80M 1VQPF 2I6DA 2KG4A 2QEXF 2QI2A 2WALA 3CCVF 3CPQA 1JJ2F 1S72F 3RA6A 3NK6A 3LWRC 2KTUA 5GIOC 1E7KA 1Q81H 5EWRA 1VQ5F 1VQKF 1SDSA 1XBIA 1W2BF 3LWVC 1VQ7F 1VQ8F 2QA4F 1NMUB 3CCLF 1YJNF 5G4UC 1CK2A 5GIPC 3V7EA 3I55F 3N4YA 3PAFA 3I56F 3WXMB 1YJ9F 3JCMM 3SIVA 3CC4F 3G6EF 1GO1A 1VQMF 3NVIB 2CZWA 2AIFA 1KC8H 1ZWZA 3CCQF 1RA4A 2KTVA 3ON1A 3JAMM 1M1KH 3CXCF 2HVYD 1VQOF 1CN7A 2LBWA 4C4WC 2LBXA 3OBWA 1H7MA 3CCUF 4X3MA 1W3EX 1W41A 2VGNA 1QVGF 3CCSF 3CC7F 4BW0B 3LWPC 1YITF 3NMUC 2OTLF 3G4SF 3FFMA 2BO1A 2FC3A 1K8AH 1Q86H 1GZ0A 3AGKA 1RLGA 1PXWA 1DT9A 3VMFB 3OW2F 2OZBA 2ALEA 3SIUA 3LWQC 2OHWA 1VQLF 3HJWC 1K73H 3MCAB 1VQ6F 1T0KB 4LCKA 3NVKE 3CCMF 1M90H 4NUTA 5GANK 1YI2F 1VQNF 3RA5A 1W40A 3J81M 5G4VC 2JNBA 5GAPK 3CMEF 3CPWF 1K9MH 3LFOA 1KQSF 3OBYA 1IPAA 3CCRF 1KD1H 1QVFF 1VQ9F 3E20B 1GO0A 3V7QA 1X52A 3PLAC 3CC2F 1YIJF 4TZZA 3GYQA 1N8RH 1Q82H 5EO3A 3LWOC 1X7PA 5DCVA 1YHQF 1Q7YH 3E1YA 3CMAF 3CD6F 3CG6A 1VQ4F 3VI6A 5A2QM 3N4ZA 1X7OA 1NJIH 3HAXD 5GINC 3CCJF 3IR9A 3G71F 3CCEF 3NK7A 2OTJF 5IT9M 5FLXM 1YJWF 5FJ4C 4BY9D 3O85A 2VGMA 4X3LA 3J7AR 1W42A
chains in the Genus database with same CATH superfamily
5HY2A 1FNJA 1UI9A 5KMGA 2KG4A 1ODEA 4C81A 4I50B 1W5AA 5LP6A 3LWRC 3JASA 1JN1A 5LOVA 3JARB 2Z1EA 1VQ5F 5B8FA 5LP6C 1VHAA 2RHOA 4ZOLA 1OFUA 2PHNA 2QA4F 3HKDB 2IG8A 5G4UC 1W581 1CK2A 2Z1UA 5EZYB 3N4YA 3I56F 4O4LB 2GLZA 1YJ9F 2VXYA 1W57A 3JVHA 4EB6B 4KWEA 1FSZA 2YYEA 1GO1A 1VQMF 4DXDA 3HKCB 3IKEA 2HX0A 1KNKA 1RLUA 2HVYD 4XCQA 4WBNA 3VIUA 3JATA 4O4JA 5C8YB 3CYQA 4O2AB 3CCUF 1W3EX 1W41A 2VGNA 3CCSF 5MN4A 1GX1A 3VYUC 2F9ZC 3G4SF 3RYFB 5MN5A 5IYZA 3VCZA 3T80A 3K14A 3VMFB 5HY1A 3LMEA 4YJ3B 5JVDA 3HJWC 3ERNA 1T0KB 3KE1A 4IIJA 3S03A 3NVKE 5IJ0A 4FFBB 4LNUB 1IV4A 1U40A 1QAHA 1W40A 2H6LA 2RHHA 3CMEF 1Z5WA 3FBAA 2HP3A 3RYCB 3LFOA 4B5CA 3HKEB 1W5BA 4G4ZA 1QVFF 3C9RA 1U43A 3V7QA 5EB1B 3PLAC 1PF5A 4HNAA 3WGLA 4TZZA 2GVIA 3S0WA 1Q82H 1UFYA 3HKCA 3LWOC 1IV2A 3CYPB 1YHQF 3CD6F 2R751 3CG6A 2W8BC 4TUYA 3OONA 4ZI7B 3ZO8A 3N4ZA 1X25A 3WPXA 3JAKA 1NJIH 5JQGA 5FNVB 4O4HA 5KX5A 2OTJF 5HY0A 2UYNA 3F0GA 3O85A 5CB4A 1W42A 4YJ3A 4BT7A 1KNJA 2Z1FA 3S0HA 5LXTA 3GTZA 4X1KA 1XV2A 1CLIA 4O4IA 3HKBB 2QI2A 3QTYA 2LBTA 2WALA 3CPQA 3WGKA 2DT4A 1S72F 3DDNA 5J2TB 3NK6A 2HS4A 5ITZB 1Q81H 1RQ2A 2DYYA 1W2BF 3K2XA 3LWVC 1VQ7F 5JCOC 4G4YA 3C9SA 1H48A 4B62A 1NMUB 1YJNF 5LP6B 4G4XA 5BMVA 5IJ9A 3JCMM 3CC4F 2L26A 2HP0B 3UT5A 5J2TA 1KC8H 2AIFA 3ZP7A 1RA4A 3ON1A 1M1KH 4R40B 4U3JB 5EZYA 1TVKB 5J2UB 3WGJA 2LBWA 3RYIB 3CC7F 4ZHVA 5CA1A 3HTNA 3LWPC 2OTLF 3F0FA 3FFMA 2BO1A 5EYPB 2OTMA 4ZHQA 1GZ0A 1VH8A 1RLGA 2LCAA 3VTIC 3ELCA 3WPWA 1VQVA 1JD1A 2OHWA 4I4TB 3M1XA 4X1KB 2GZLA 4LCKA 1JY8A 3IEWA 5IYZB 2CWJA 3QUWA 1M90H 3M84A 5MN6A 4NUTA 3RA5A 4O2BA 5JCOA 4C8GA 4EI7A 2JNBA 3CPWF 1DBFA 3WGNA 1KQSF 4BVSA 2ZOVA 2NMUA 4ERHA 3TD5A 1VQ9F 4NQ3A 3E20B 3P4EA 4EI8A 1GO0A 3IMPA 2CSLA 5CA0B 1JFFA 3N2KB 3GYQA 1Q8RA 2HP0A 4X1YA 3DC2A 4TV8A 2HQSC 3JALA 4E6EA 4U3JA 4RHAA 3RYFA 5A2QM 1TUBB 2FGYA 2HRYA 3FD5A 3RYHB 3G71F 1U3LA 1W5EA 4F6RB 4IHJA 2VGMA 4X3LA 4LNUA 5JQGB 4G88A 3IKFA 4I4TA 3J80M 4O4HB 1VQPF 5KMGB 3N2GA 1YQNA 2I6DA 3RYCA 5HP7A 2QEXF 2UZHA 3CCVF 4BT4A 2ZAUA 4O2BB 4X1IB 5LYJA 4C8IA 3KHNA 1IV3A 1SZQA 5LXTB 2P6YA 3JASB 2UYKA 5LA6A 1E7KA 3CB2A 1XBIA 3U0OA 1U3PA 4G4WA 3VYTC 3GHZA 3HKDA 3CCLF 2VAPA 4YJ2A 5GONA 3V7EA 3I55F 1ONIA 2H8EA 3WXMB 5CA0A 2PMPA 3SIVA 3WJQA 2BTQB 4RQOA 4C8EA 4TV8B 3TD3A 2CZWA 1ZWZA 2KTVA 4WBNB 3CXCF 1J7HA 3JAWB 3WGMA 3JATB 5HWEA 2UYNB 2LBXA 3OBWA 1H7MA 1VK3A 3UT5B 2QTPA 2K1SA 4F6RA 1YITF 2HS0A 4B46A 2FC3A 4X20A 4O4IB 1K8AH 1Q86H 4BVRA 2UYJA 3MCQA 3Q8HA 1PXWA 3MDOA 3QHDA 3RYIA 3C8LA 2OZBA 3D54A 5CA1B 4BT5A 3LWQC 1VQLF 3S02A 1K73H 3F0DA 1VQ6F 5ITZA 4ZK7A 1QU9A 5JH7B 4IIJB 4B45A 4FFBA 1OAPA 5EB0A 5IJ0B 4TV9A 1YI2F 3ESJA 5LYJB 1W55A 3J81M 3I3FA 2IQQA 5LA6B 2CW4A 2B33A 4BT6A 5AVMA 3C9TA 2G9IA 3VOBA 2AIZP 2VAWA 3FD6A 2BTOA 3JARA 3VOAA 3P0ZA 3CC2F 1COMA 1FFXA 4HNAB 4ZOLB 3BYQA 5EO3A 3P10A 1X7PA 1Q7YH 3E1YA 3D01A 3R0PA 1VQ4F 3C9UA 3VI6A 5EYPA 4ZHQB 1YGYA 1X7OA 3LYBA 5HY4A 3N2KA 1JFFB 3E22B 4EB6A 3JAKB 3K12A 5GINC 5FNVA 3CCEF 2V9YA 3NK7A 4DRXA 5IT9M 2Z1TA 5KX5B 5C8YA 2EWCA 1SA0A 4O2AA 1NQ3A 4BY9D 3J7AR 3ZOPA 3RYHA 4M8IA 4EI9A 5LOVB 2HS3A 4NWOB 3HKBA 5HP8A 3VYSC 5HXZA 3WJPA 2VAMA 3V3TA 1JJ2F 3RA6A 3HWUA 2Q1YA 3M4SA 4G4VA 2KTUA 4ZHYB 1IV1A 3EORA 3N2GB 5GIOC 2CHSA 5EWRA 2MQEA 3S0YA 1VQKF 1SDSA 3D00A 1VQ8F 2CHTA 3TD4A 3L7QA 4X1IA 3JALB 3I7TA 3VO8A 5BMVB 2H8CA 5GIPC 4O4JB 1FNKA 3PAFA 1H47A 5HXUA 5IJ9B 1TUBA 1W5FA 3HKEA 3B6NA 2ZVZA 3G6EF 3NVIB 2ZODA 3CCQF 3JAMM 4YJ2B 1XRGA 1VQOF 1XHOA 1CN7A 4C82A 4C4WC 4BT2A 4IHJB 3E22A 5EAZA 4I55A 4X3MA 1QVGF 3F0EA 5JVDB 4DRXB 4BW0B 3NMUC 3KJKA 1SA0B 2BTUA 2I6RA 4ZI7A 3AGKA 4BVQA 2Z01A 1DT9A 3OW2F 2ALEA 3SIUA 4BVTA 4ZHWA 2Q1XA 3ZP4A 3MCAB 3KJJA 2UYPA 2ZVYA 3MQWA 3CCMF 2N48A 4PWTA 1VQNF 5GANK 1Z5VA 4I50A 5GONB 4BT3A 5EIBD 5G4VC 5GAPK 1K9MH 2KGWA 3V4DA 2RHJA 4TV9B 2IAFA 3OBYA 1IPAA 1R1MA 3IEQA 3CCRF 1KD1H 2HRUA 3S06A 4TUYB 3JAWA 5EIBC 1X52A 4O4LA 1YIJF 1N8RH 4X1YB 3F6MA 2R6R1 3FPIA 2RHLA 5DCVA 3RE3A 3CMAF 1QD9A 2RB9A 4X20B 1W59A 3WJRA 3KIZA 1RQ7A 3K0TA 4I55B 1FFXB 5CB4B 3HAXD 2YXZA 3CCJF 3IR9A 1T0AA 3MBMA 3LDTA 5FLXM 1TVKA 5JH7A 5J2UA 4U39A 1YJWF 5FJ4C 2AMTA 2CVLA 2ZF8A
chains in the Genus database with same CATH topology
5HY2A 3J80M 4EI9A 1VQPF 2I6DA 2KG4A 2QEXF 5HXZA 2QI2A 3V3TA 2WALA 3CCVF 3CPQA 1JJ2F 1S72F 3RA6A 3NK6A 3LWRC 2KTUA 5GIOC 1E7KA 1Q81H 5EWRA 1VQ5F 1VQKF 1SDSA 1XBIA 3D00A 3LWVC 1W2BF 1VQ7F 1VQ8F 2QA4F 1NMUB 3CCLF 1YJNF 5G4UC 1CK2A 5GIPC 3V7EA 3I55F 3N4YA 3PAFA 3I56F 3WXMB 5HXUA 2GLZA 1YJ9F 3JCMM 3SIVA 3CC4F 3G6EF 1GO1A 1VQMF 3NVIB 2CZWA 2AIFA 1KC8H 1ZWZA 3CCQF 1RA4A 2KTVA 3ON1A 3JAMM 1M1KH 3CXCF 4XCQA 2HVYD 1VQOF 1CN7A 2LBWA 5HWEA 4C4WC 2LBXA 3OBWA 1H7MA 3CCUF 4X3MA 1W3EX 1W41A 2VGNA 1QVGF 3CCSF 3CC7F 2F9ZC 4BW0B 3LWPC 1YITF 3NMUC 2OTLF 3G4SF 3FFMA 2BO1A 2FC3A 1K8AH 1Q86H 1GZ0A 3AGKA 4BVRA 4BVQA 1RLGA 1PXWA 1DT9A 3VMFB 3OW2F 2OZBA 2ALEA 5HY1A 3SIUA 3LWQC 2OHWA 4BVTA 1VQLF 3HJWC 1K73H 3MCAB 1VQ6F 1T0KB 4LCKA 3NVKE 3CCMF 1M90H 4NUTA 5GANK 1YI2F 1VQNF 3RA5A 1W40A 3J81M 5G4VC 4EI7A 2JNBA 5GAPK 3CMEF 3CPWF 1K9MH 3LFOA 1KQSF 4BVSA 3OBYA 1IPAA 3CCRF 1KD1H 1QVFF 1VQ9F 4NQ3A 3E20B 4EI8A 3V7QA 1X52A 1GO0A 3PLAC 3CC2F 1YIJF 4TZZA 3GYQA 1N8RH 1Q82H 5EO3A 3LWOC 1X7PA 5DCVA 1YHQF 1Q7YH 3E1YA 3CMAF 3CD6F 3CG6A 1VQ4F 3VI6A 5A2QM 3N4ZA 1X7OA 5HY4A 2FGYA 1NJIH 3HAXD 5GINC 3CCJF 3IR9A 3G71F 3CCEF 3NK7A 2OTJF 5IT9M 5FLXM 1YJWF 5HY0A 5FJ4C 4BY9D 3O85A 2VGMA 4X3LA 3J7AR 1W42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 M;  1VQP F;  2I6D A;  2KG4 A;  2QEX F;  2QI2 A;  2WAL A;  3CCV F;  3CPQ A;  1JJ2 F;  1S72 F;  3RA6 A;  3NK6 A;  3LWR C;  2KTU A;  5GIO C;  1E7K A;  1Q81 H;  5EWR A;  1VQ5 F;  1VQK F;  1SDS A;  1XBI A;  1W2B F;  3LWV C;  1VQ7 F;  1VQ8 F;  2QA4 F;  1NMU B;  3CCL F;  1YJN F;  5G4U C;  1CK2 A;  5GIP C;  3V7E A;  3I55 F;  3N4Y A;  3PAF A;  3I56 F;  3WXM B;  1YJ9 F;  3JCM M;  3SIV A;  3CC4 F;  3G6E F;  1GO1 A;  1VQM F;  3NVI B;  2CZW A;  2AIF A;  1KC8 H;  1ZWZ A;  3CCQ F;  1RA4 A;  2KTV A;  3ON1 A;  3JAM M;  1M1K H;  3CXC F;  2HVY D;  1VQO F;  1CN7 A;  2LBW A;  4C4W C;  2LBX A;  3OBW A;  1H7M A;  3CCU F;  4X3M A;  1W3E X;  1W41 A;  2VGN A;  1QVG F;  3CCS F;  3CC7 F;  4BW0 B;  3LWP C;  1YIT F;  3NMU C;  2OTL F;  3G4S F;  3FFM A;  2BO1 A;  2FC3 A;  1K8A H;  1Q86 H;  1GZ0 A;  3AGK A;  1RLG A;  1PXW A;  1DT9 A;  3VMF B;  3OW2 F;  2OZB A;  2ALE A;  3SIU A;  3LWQ C;  2OHW A;  1VQL F;  3HJW C;  1K73 H;  3MCA B;  1VQ6 F;  1T0K B;  4LCK A;  3NVK E;  3CCM F;  1M90 H;  4NUT A;  5GAN K;  1YI2 F;  1VQN F;  3RA5 A;  1W40 A;  3J81 M;  5G4V C;  2JNB A;  5GAP K;  3CME F;  3CPW F;  1K9M H;  3LFO A;  1KQS F;  3OBY A;  1IPA A;  3CCR F;  1KD1 H;  1QVF F;  1VQ9 F;  3E20 B;  1GO0 A;  3V7Q A;  1X52 A;  3PLA C;  3CC2 F;  1YIJ F;  4TZZ A;  3GYQ A;  1N8R H;  1Q82 H;  5EO3 A;  3LWO C;  1X7P A;  5DCV A;  1YHQ F;  1Q7Y H;  3E1Y A;  3CMA F;  3CD6 F;  3CG6 A;  1VQ4 F;  3VI6 A;  5A2Q M;  3N4Z A;  1X7O A;  1NJI H;  3HAX D;  5GIN C;  3CCJ F;  3IR9 A;  3G71 F;  3CCE F;  3NK7 A;  2OTJ F;  5IT9 M;  5FLX M;  1YJW F;  5FJ4 C;  4BY9 D;  3O85 A;  2VGM A;  4X3L A;  3J7A R;  1W42 A; 
#chains in the Genus database with same CATH topology
 5HY2 A;  1FNJ A;  1UI9 A;  5KMG A;  2KG4 A;  1ODE A;  4C81 A;  4I50 B;  1W5A A;  5LP6 A;  3LWR C;  3JAS A;  1JN1 A;  5LOV A;  3JAR B;  2Z1E A;  1VQ5 F;  5B8F A;  5LP6 C;  1VHA A;  2RHO A;  4ZOL A;  1OFU A;  2PHN A;  2QA4 F;  3HKD B;  2IG8 A;  5G4U C;  1W58 1;  1CK2 A;  2Z1U A;  5EZY B;  3N4Y A;  3I56 F;  4O4L B;  2GLZ A;  1YJ9 F;  2VXY A;  1W57 A;  3JVH A;  4EB6 B;  4KWE A;  1FSZ A;  2YYE A;  1GO1 A;  1VQM F;  4DXD A;  3HKC B;  3IKE A;  2HX0 A;  1KNK A;  1RLU A;  2HVY D;  4XCQ A;  4WBN A;  3VIU A;  3JAT A;  4O4J A;  5C8Y B;  3CYQ A;  4O2A B;  3CCU F;  1W3E X;  1W41 A;  2VGN A;  3CCS F;  5MN4 A;  1GX1 A;  3VYU C;  2F9Z C;  3G4S F;  3RYF B;  5MN5 A;  5IYZ A;  3VCZ A;  3T80 A;  3K14 A;  3VMF B;  5HY1 A;  3LME A;  4YJ3 B;  5JVD A;  3HJW C;  3ERN A;  1T0K B;  3KE1 A;  4IIJ A;  3S03 A;  3NVK E;  5IJ0 A;  4FFB B;  4LNU B;  1IV4 A;  1U40 A;  1QAH A;  1W40 A;  2H6L A;  2RHH A;  3CME F;  1Z5W A;  3FBA A;  2HP3 A;  3RYC B;  3LFO A;  4B5C A;  3HKE B;  1W5B A;  4G4Z A;  1QVF F;  3C9R A;  1U43 A;  3V7Q A;  5EB1 B;  3PLA C;  1PF5 A;  4HNA A;  3WGL A;  4TZZ A;  2GVI A;  3S0W A;  1Q82 H;  1UFY A;  3HKC A;  3LWO C;  1IV2 A;  3CYP B;  1YHQ F;  3CD6 F;  2R75 1;  3CG6 A;  2W8B C;  4TUY A;  3OON A;  4ZI7 B;  3ZO8 A;  3N4Z A;  1X25 A;  3WPX A;  3JAK A;  1NJI H;  5JQG A;  5FNV B;  4O4H A;  5KX5 A;  2OTJ F;  5HY0 A;  2UYN A;  3F0G A;  3O85 A;  5CB4 A;  1W42 A;  4YJ3 A;  4BT7 A;  1KNJ A;  2Z1F A;  3S0H A;  5LXT A;  3GTZ A;  4X1K A;  1XV2 A;  1CLI A;  4O4I A;  3HKB B;  2QI2 A;  3QTY A;  2LBT A;  2WAL A;  3CPQ A;  3WGK A;  2DT4 A;  1S72 F;  3DDN A;  5J2T B;  3NK6 A;  2HS4 A;  5ITZ B;  1Q81 H;  1RQ2 A;  2DYY A;  1W2B F;  3K2X A;  3LWV C;  1VQ7 F;  5JCO C;  4G4Y A;  3C9S A;  1H48 A;  4B62 A;  1NMU B;  1YJN F;  5LP6 B;  4G4X A;  5BMV A;  5IJ9 A;  3JCM M;  3CC4 F;  2L26 A;  2HP0 B;  3UT5 A;  5J2T A;  1KC8 H;  2AIF A;  3ZP7 A;  1RA4 A;  3ON1 A;  1M1K H;  4R40 B;  4U3J B;  5EZY A;  1TVK B;  5J2U B;  3WGJ A;  2LBW A;  3RYI B;  3CC7 F;  4ZHV A;  5CA1 A;  3HTN A;  3LWP C;  2OTL F;  3F0F A;  3FFM A;  2BO1 A;  5EYP B;  2OTM A;  4ZHQ A;  1GZ0 A;  1VH8 A;  1RLG A;  2LCA A;  3VTI C;  3ELC A;  3WPW A;  1VQV A;  1JD1 A;  2OHW A;  4I4T B;  3M1X A;  4X1K B;  2GZL A;  4LCK A;  1JY8 A;  3IEW A;  5IYZ B;  2CWJ A;  3QUW A;  1M90 H;  3M84 A;  5MN6 A;  4NUT A;  3RA5 A;  4O2B A;  5JCO A;  4C8G A;  4EI7 A;  2JNB A;  3CPW F;  1DBF A;  3WGN A;  1KQS F;  4BVS A;  2ZOV A;  2NMU A;  4ERH A;  3TD5 A;  1VQ9 F;  4NQ3 A;  3E20 B;  3P4E A;  4EI8 A;  1GO0 A;  3IMP A;  2CSL A;  5CA0 B;  1JFF A;  3N2K B;  3GYQ A;  1Q8R A;  2HP0 A;  4X1Y A;  3DC2 A;  4TV8 A;  2HQS C;  3JAL A;  4E6E A;  4U3J A;  4RHA A;  3RYF A;  5A2Q M;  1TUB B;  2FGY A;  2HRY A;  3FD5 A;  3RYH B;  3G71 F;  1U3L A;  1W5E A;  4F6R B;  4IHJ A;  2VGM A;  4X3L A;  4LNU A;  5JQG B;  4G88 A;  3IKF A;  4I4T A;  3J80 M;  4O4H B;  1VQP F;  5KMG B;  3N2G A;  1YQN A;  2I6D A;  3RYC A;  5HP7 A;  2QEX F;  2UZH A;  3CCV F;  4BT4 A;  2ZAU A;  4O2B B;  4X1I B;  5LYJ A;  4C8I A;  3KHN A;  1IV3 A;  1SZQ A;  5LXT B;  2P6Y A;  3JAS B;  2UYK A;  5LA6 A;  1E7K A;  3CB2 A;  1XBI A;  3U0O A;  1U3P A;  4G4W A;  3VYT C;  3GHZ A;  3HKD A;  3CCL F;  2VAP A;  4YJ2 A;  5GON A;  3V7E A;  3I55 F;  1ONI A;  2H8E A;  3WXM B;  5CA0 A;  2PMP A;  3SIV A;  3WJQ A;  2BTQ B;  4RQO A;  4C8E A;  4TV8 B;  3TD3 A;  2CZW A;  1ZWZ A;  2KTV A;  4WBN B;  3CXC F;  1J7H A;  3JAW B;  3WGM A;  3JAT B;  5HWE A;  2UYN B;  2LBX A;  3OBW A;  1H7M A;  1VK3 A;  3UT5 B;  2QTP A;  2K1S A;  4F6R A;  1YIT F;  2HS0 A;  4B46 A;  2FC3 A;  4X20 A;  4O4I B;  1K8A H;  1Q86 H;  4BVR A;  2UYJ A;  3MCQ A;  3Q8H A;  1PXW A;  3MDO A;  3QHD A;  3RYI A;  3C8L A;  2OZB A;  3D54 A;  5CA1 B;  4BT5 A;  3LWQ C;  1VQL F;  3S02 A;  1K73 H;  3F0D A;  1VQ6 F;  5ITZ A;  4ZK7 A;  1QU9 A;  5JH7 B;  4IIJ B;  4B45 A;  4FFB A;  1OAP A;  5EB0 A;  5IJ0 B;  4TV9 A;  1YI2 F;  3ESJ A;  5LYJ B;  1W55 A;  3J81 M;  3I3F A;  2IQQ A;  5LA6 B;  2CW4 A;  2B33 A;  4BT6 A;  5AVM A;  3C9T A;  2G9I A;  3VOB A;  2AIZ P;  2VAW A;  3FD6 A;  2BTO A;  3JAR A;  3VOA A;  3P0Z A;  3CC2 F;  1COM A;  1FFX A;  4HNA B;  4ZOL B;  3BYQ A;  5EO3 A;  3P10 A;  1X7P A;  1Q7Y H;  3E1Y A;  3D01 A;  3R0P A;  1VQ4 F;  3C9U A;  3VI6 A;  5EYP A;  4ZHQ B;  1YGY A;  1X7O A;  3LYB A;  5HY4 A;  3N2K A;  1JFF B;  3E22 B;  4EB6 A;  3JAK B;  3K12 A;  5GIN C;  5FNV A;  3CCE F;  2V9Y A;  3NK7 A;  4DRX A;  5IT9 M;  2Z1T A;  5KX5 B;  5C8Y A;  2EWC A;  1SA0 A;  4O2A A;  1NQ3 A;  4BY9 D;  3J7A R;  3ZOP A;  3RYH A;  4M8I A;  4EI9 A;  5LOV B;  2HS3 A;  4NWO B;  3HKB A;  5HP8 A;  3VYS C;  5HXZ A;  3WJP A;  2VAM A;  3V3T A;  1JJ2 F;  3RA6 A;  3HWU A;  2Q1Y A;  3M4S A;  4G4V A;  2KTU A;  4ZHY B;  1IV1 A;  3EOR A;  3N2G B;  5GIO C;  2CHS A;  5EWR A;  2MQE A;  3S0Y A;  1VQK F;  1SDS A;  3D00 A;  1VQ8 F;  2CHT A;  3TD4 A;  3L7Q A;  4X1I A;  3JAL B;  3I7T A;  3VO8 A;  5BMV B;  2H8C A;  5GIP C;  4O4J B;  1FNK A;  3PAF A;  1H47 A;  5HXU A;  5IJ9 B;  1TUB A;  1W5F A;  3HKE A;  3B6N A;  2ZVZ A;  3G6E F;  3NVI B;  2ZOD A;  3CCQ F;  3JAM M;  4YJ2 B;  1XRG A;  1VQO F;  1XHO A;  1CN7 A;  4C82 A;  4C4W C;  4BT2 A;  4IHJ B;  3E22 A;  5EAZ A;  4I55 A;  4X3M A;  1QVG F;  3F0E A;  5JVD B;  4DRX B;  4BW0 B;  3NMU C;  3KJK A;  1SA0 B;  2BTU A;  2I6R A;  4ZI7 A;  3AGK A;  4BVQ A;  2Z01 A;  1DT9 A;  3OW2 F;  2ALE A;  3SIU A;  4BVT A;  4ZHW A;  2Q1X A;  3ZP4 A;  3MCA B;  3KJJ A;  2UYP A;  2ZVY A;  3MQW A;  3CCM F;  2N48 A;  4PWT A;  1VQN F;  5GAN K;  1Z5V A;  4I50 A;  5GON B;  4BT3 A;  5EIB D;  5G4V C;  5GAP K;  1K9M H;  2KGW A;  3V4D A;  2RHJ A;  4TV9 B;  2IAF A;  3OBY A;  1IPA A;  1R1M A;  3IEQ A;  3CCR F;  1KD1 H;  2HRU A;  3S06 A;  4TUY B;  3JAW A;  5EIB C;  1X52 A;  4O4L A;  1YIJ F;  1N8R H;  4X1Y B;  3F6M A;  2R6R 1;  3FPI A;  2RHL A;  5DCV A;  3RE3 A;  3CMA F;  1QD9 A;  2RB9 A;  4X20 B;  1W59 A;  3WJR A;  3KIZ A;  1RQ7 A;  3K0T A;  4I55 B;  1FFX B;  5CB4 B;  3HAX D;  2YXZ A;  3CCJ F;  3IR9 A;  1T0A A;  3MBM A;  3LDT A;  5FLX M;  1TVK A;  5JH7 A;  5J2U A;  4U39 A;  1YJW F;  5FJ4 C;  2AMT A;  2CVL A;  2ZF8 A; 
#chains in the Genus database with same CATH homology
 5HY2 A;  3J80 M;  4EI9 A;  1VQP F;  2I6D A;  2KG4 A;  2QEX F;  5HXZ A;  2QI2 A;  3V3T A;  2WAL A;  3CCV F;  3CPQ A;  1JJ2 F;  1S72 F;  3RA6 A;  3NK6 A;  3LWR C;  2KTU A;  5GIO C;  1E7K A;  1Q81 H;  5EWR A;  1VQ5 F;  1VQK F;  1SDS A;  1XBI A;  3D00 A;  3LWV C;  1W2B F;  1VQ7 F;  1VQ8 F;  2QA4 F;  1NMU B;  3CCL F;  1YJN F;  5G4U C;  1CK2 A;  5GIP C;  3V7E A;  3I55 F;  3N4Y A;  3PAF A;  3I56 F;  3WXM B;  5HXU A;  2GLZ A;  1YJ9 F;  3JCM M;  3SIV A;  3CC4 F;  3G6E F;  1GO1 A;  1VQM F;  3NVI B;  2CZW A;  2AIF A;  1KC8 H;  1ZWZ A;  3CCQ F;  1RA4 A;  2KTV A;  3ON1 A;  3JAM M;  1M1K H;  3CXC F;  4XCQ A;  2HVY D;  1VQO F;  1CN7 A;  2LBW A;  5HWE A;  4C4W C;  2LBX A;  3OBW A;  1H7M A;  3CCU F;  4X3M A;  1W3E X;  1W41 A;  2VGN A;  1QVG F;  3CCS F;  3CC7 F;  2F9Z C;  4BW0 B;  3LWP C;  1YIT F;  3NMU C;  2OTL F;  3G4S F;  3FFM A;  2BO1 A;  2FC3 A;  1K8A H;  1Q86 H;  1GZ0 A;  3AGK A;  4BVR A;  4BVQ A;  1RLG A;  1PXW A;  1DT9 A;  3VMF B;  3OW2 F;  2OZB A;  2ALE A;  5HY1 A;  3SIU A;  3LWQ C;  2OHW A;  4BVT A;  1VQL F;  3HJW C;  1K73 H;  3MCA B;  1VQ6 F;  1T0K B;  4LCK A;  3NVK E;  3CCM F;  1M90 H;  4NUT A;  5GAN K;  1YI2 F;  1VQN F;  3RA5 A;  1W40 A;  3J81 M;  5G4V C;  4EI7 A;  2JNB A;  5GAP K;  3CME F;  3CPW F;  1K9M H;  3LFO A;  1KQS F;  4BVS A;  3OBY A;  1IPA A;  3CCR F;  1KD1 H;  1QVF F;  1VQ9 F;  4NQ3 A;  3E20 B;  4EI8 A;  3V7Q A;  1X52 A;  1GO0 A;  3PLA C;  3CC2 F;  1YIJ F;  4TZZ A;  3GYQ A;  1N8R H;  1Q82 H;  5EO3 A;  3LWO C;  1X7P A;  5DCV A;  1YHQ F;  1Q7Y H;  3E1Y A;  3CMA F;  3CD6 F;  3CG6 A;  1VQ4 F;  3VI6 A;  5A2Q M;  3N4Z A;  1X7O A;  5HY4 A;  2FGY A;  1NJI H;  3HAX D;  5GIN C;  3CCJ F;  3IR9 A;  3G71 F;  3CCE F;  3NK7 A;  2OTJ F;  5IT9 M;  5FLX M;  1YJW F;  5HY0 A;  5FJ4 C;  4BY9 D;  3O85 A;  2VGM A;  4X3L A;  3J7A R;  1W42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...