2ALVA

X-ray structural analysis of sars coronavirus 3cl proteinase in complex with designed anti-viral inhibitors
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
302
structure length
302
Chain Sequence
GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab
publication title Design and synthesis of peptidomimetic severe acute respiratory syndrome chymotrypsin-like protease inhibitors.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 86
structure length 302
sequence length 302
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2alvA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2alvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2alvA02
4CHAB 3LDXH 1PYTC 1C1PA 1AO5A 4DOQA 3D23A 4OGYA 1UTNA 1DSTA 3LH3A 4Q7XA 1ELVA 1BTZA 3KCGH 2SNVA 1ETRH 3TGKE 3T27A 3FZZA 1PQ5A 1PPFE 1BRBE 1AGJA 5F03A 4KTSA 1UTLM 1GBBA 3ZZBA 1VGCB 1B5GH 4BAQB 1TALA 1W2KH 2TGAA 1ZYOA 1O2UA 3FZDA 4F4OC 3UR9A 1N1LA 1IQKA 1QB9A 2IPHA 1GBDA 1O2PA 2FZZA 1NRRH 5GWZA 1VITF 3RXFA 4X2XA 1XUKA 3BG8A 1BRCE 2G55A 2FOGA 1T8MA 2R0LA 1FIZA 2ZTZA 1LVBA 5HXFA 4HGCA 2QV1A 1YLCA 5DP3A 1Y3XA 1F0UA 2G00A 1ELAA 1GMDF 5LGOA 1MTNC 4K1SA 1GCTC 1K1LA 1ZSKA 1QQ4A 1FY8E 2YNBA 3P8NA 3QLPH 4YOGA 2ZQ1A 1C2HA 3R0FA 1O0DH 1Q31A 2GZ8A 2Y82A 2ILNA 1G9IE 3D62A 1VCPA 1Y3UA 5JBBS 1O2MA 1WBGB 1D9IA 1GVKB 1L4ZA 3K9XB 4SGBE 1O2VA 1SGRE 4NA7A 1FY4A 1HIAB 1GJ7B 1RTKA 1U6QA 3TNSA 4O3UA 1ELEE 2TGPZ 4IS5A 1P03A 4HTCH 2Z3EA 4AB9A 3RXDA 1O2IA 4K5ZA 1PPGE 1AWHB 3M37A 2OBQA 2R2WU 3UUZA 1EJAA 3AW1A 1C5QA 1C1SA 1D3TB 4BTIB 1BUIA 3SQEE 1QA7A 1GHYH 2VJ1A 1E38B 1EXFA 1T8NA 1O5CB 4INLA 3STIA 1GI3A 1SLVB 1AVWA 1QHRB 4A1XA 1Y3VA 2FOCA 3RP2A 2NU2E 1GWAA 1T4UH 1HB0B 4AFSA 5JBTA 4WXVA 1G2MA 3BN9A 1JOUB 4D8NA 1G30B 2OC1A 2A2QH 5FAHA 1SLXB 3VEQB 1T4VH 2AMPA 1AWFH 2TGDA 1LPKB 5I25A 1TYNA 4Q7ZA 1YPGH 3F9FA 1BTHH 2FI3E 2YNAA 1V2JT 1CHOF 2GVFA 2Y80A 4BAOB 4CBOA 1YPEH 2NU3E 3LKWA 3OY6U 1V2NT 4BANB 3DHKH 1BTWA 2BQ7B 2XTTB 2TBSA 1P8VC 1EAUA 3NZIA 1BHXF 2A4GA 3GCNA 5F6MA 3U9AH 4J1YA 1EX3A 1ELFA 3A7XA 1O5AB 1TRNA 1O32A 1V2OT 2CF8H 1CE5A 2STBE 4Y7BA 3LJOA 3PWCA 3SV8A 2OC8A 4JZ1A 4IMQA 3I78A 3TGIE 3KF2A 1O2NA 4TY7A 1GG6B 4BTTB 1QGFA 3SU5A 1GI0A 1P3CA 1V3XA 3IWMA 1JRTA 1H1BA 2ZHEH 1C2EA 1TRMA 5T6GA 1O5FH 1EAXA 1SR5C 3BTTE 2BY8X 4VGCB 5K7RA 1MTWA 3V13A 1GMHG 4X1PU 1NC6A 3A82A 3Q00A 3TH4H 5LH8A 2GX4A 1ZTLA 2SGAA 1H9IE 1Z1JA 1FQ3A 1TABE 5C3NA 3TH2H 4LZ1H 2QF0A 1MBMA 1AUJA 3SU2A 2FEQH 1A2CH 2BDAA 3BEFB 1C5NH 3VPKA 1E37B 3I77A 1D3PB 2NU0E 1C2LA 1DE7H 4D7GA 2CN0H 2A45B 1JIMA 2J94A 4PROA 3GY8A 5EQRA 3VXEH 4I7YH 3U98H 5AFYH 3F68H 2ZGXH 1CHOG 1C4V2 1NS3A 5EXMA 1FPCH 3TITA 3GY2A 1O2HA 7GCHF 2K1QA 3P92A 3SNAA 1OSSA 1MU8B 1Y3WA 1ZMNA 1CBWB 2VINA 3RMNH 8ESTE 4CH2B 4HZHA 4H42U 8LPRA 4BAHB 1UMAH 4A7IB 5HYOA 1GPZA 3SORA 4YOJA 3PMAB 2R3UA 3BTEE 1BRUP 1KXFA 3TK6A 1S5SA 1VCWA 4ISOA 1A0JA 4FUDA 1XMNB 1ZPZA 4CHAC 2PKAA 3SW2B 4INKA 1T7CA 3KQDA 3EA8A 3RXUA 2VU8E 1MBQA 4JMYA 3L6PA 1P01A 3ENSB 1DX5M 2GZ7A 3EA7A 2GCHG 3TK9A 5FCRA 2P3UB 4ZKOU 4AG2A 3TK5A 1BMAA 4KKDA 1GI7B 1O38A 3W94A 4NIVA 1T31A 4YOIA 1VGCC 1AN1E 4CRGA 2JH6D 2P93A 5DKMA 3SUDA 2W3IA 1FZZA 3F6UH 2TGTA 1NROH 1EUFA 1LQEA 4FUCA 1SQOA 1SGNE 1EZQA 5EQSA 3A7YA 5C1UA 2PR3A 1GVLA 2HVXA 2W3KA 1SQTA 4TPIZ 2A4RA 3A85A 2CXVA 4Y6DA 1EP5A 3RXVA 4MQAA 1FLEE 4B2CA 1OP0A 3SNDA 3BV9B 1VZQH 3LPRA 4SGAE 4ZMAH 1ABIH 2W5EA 4KP0A 4AFQA 1ZMLA 2THFB 1O2WA 4NFEA 4ABJA 3RXSA 1C5MD 3MNXA 4FUBA 1G3EA 1V2TT 1AVGH 8GCHG 1AKSB 1QURH 1TWXB 1AVXA 4ABEA 4TYDA 2AGGX 3S7HB 1DUEA 1PQ7A 1QB1A 3SV2H 4BNRA 3A83A 3M3SA 1B7XB 1BJVA 1HGTH 1WTGH 4XDEA 3TJOA 2QC2A 3URCA 3ZVEA 3L3TA 3SN8A 1TONA 2UWOA 2ZQ2A 1LHCH 5HGGA 3UY9A 2K7XA 3LT3A 3VFEA 1ZZZA 1D6WA 1F7ZA 2OCVB 2A31A 3RDZA 3SU4A 1HYLA 2BD3A 2HGTH 4WWYA 4AG1A 1ZRBA 1MTVA 1Z7KA 2HPQH 3RC6A 4UEHH 1ANCA 5DGJA 3VXFH 3HPTB 2ZG0H 1BOQA 3HATH 2AERH 2RG3A 3GISB 1IQIA 4AB8A 2VIDA 1K9OE 3SGAE 1HAGE 1Y5AT 5EPNA 2FDAA 5EG4A 1GI6A 4HFPB 1W7GH 2ODYB 5C2ZA 2JH0D 1QNJA 3G01A 3P70B 4NSYA 3MU1A 3GOVB 2G4TA 9LPRA 4I31A 5DP9A 4IBLH 2PSXA 3EA9A 1G32B 1TA6A 5A2MH 2ZNKH 4JYUH 3ATMA 3RXQA 3BG4B 1O2LA 3GY7A 2H9EH 4Y8YA 1CHGA 2C8XB 2ZFRH 5ETXA 3SOSA 4RSPA 1P9SA 2ZDKA 1W14U 2LIZA 1F5RA 1FMGA 4CR5A 1SOZA 3VGCB 4AOQA 2QIQA 3E90B 3RUOA 1HJ9A 3PLBA 2FO9A 1ZSJA 1UTPA 1CA8B 2J2UA 1THRH 3TH3H 4MPUA 4CBNA 3U69H 1SOTA 4UD9H 1GHAF 3FFGA 1UCYH 1G3DA 2OP9A 2JKHA 1AMHA 2PKSB 4K3JA 1O2TA 4K60A 4E7RG 4ZHAA 1C1RA 2ZZUH 1GGDB 3GY6A 4D7FA 1CVWH 2B8OH 1MMJN 2ZU5A 2STAE 3MNSA 3SV7A 4RKOB 2XBVA 2VB0A 2BVRH 1RIWB 2EI6A 2ZDNA 5JB9S 2FIRH 1GG6C 1MTUA 2QCYA 2JETB 1KXEA 3T25A 2SGPE 3A87A 4RN6A 3GDUA 1KLIH 1HIAA 4Y11E 3RXPA 1YPJH 1BA8B 3ZYEA 2GGVB 1NY22 4VGCC 2J92A 4IGDA 3SHAH 4FVDA 5TCCA 1O2RA 4B76A 3M7TA 1V2MT 1GJ8B 4JZDH 4KGAA 2BOKA 2Y5FA 1TIOA 1SGFA 1DT2A 4X1RU 2ALPA 5CMXH 1O3PB 3EBNA 3RXAA 2A1DB 1QA0A 1IQLA 3MOCA 1L1JA 1ANDA 3AAVA 1XUFA 2RA3A 6ESTA 2C90B 2QXJA 1P10A 2ZHFH 3NKKA 5F8XA 3EE0B 2B9LA 2FWWA 1EZUC 1PPEE 5GJ4B 1FY5A 1KLJH 3UOPA 2CV3A 1TA2A 2UWPA 3ZVCA 1H4WA 4KTUA 2RDLA 1LCYA 1J9CH 2G8TA 1T8OA 2J4IA 3BTQE 2DE8A 3LGTA 1O35A 2FLBH 2QF3A 1TQ7B 3A86A 2BLWA 5EODA 4DIHH 4D76A 1CBWC 1GI4A 2G81E 1BZXE 1EQ9A 1UCYE 1TQ0B 1TPAE 4ZKSU 1SLWB 1HAYB 1XUJA 2ZCKP 2OUAA 3HKIB 3KQEA 4WF8A 4O3TA 4YLUA 1ZPCA 3MH5A 3QZQA 4CREA 4CRCA 2OTVA 4X0WU 3RC4A 1K21H 1WCZA 1GVZA 2ZPQA 3MMGA 1P06A 1D4PB 4Z0KA 1C4Y2 4GUXA 1WQVH 2XNIA 5EXLA 4X8VH 3SJ9A 3JZ2B 1MKWH 3KL6A 2A7JA 3QTOH 1EZSC 5IDKA 2BD9A 1NT1A 3RM0H 2D2DA 1UVTH 1NPMA 1YM0A 2Z9KA 2FOHA 3A80A 4BAKB 3TJUA 1AFQB 4O03A 1BTPA 3P8GA 3UQVA 4UONA 1KTSB 4NZLA 2ZGHA 2BD4A 1SI5H 2EC9H 1V2RT 4Y76A 5GPIB 3RXIA 3OU0A 4UDWH 5DP7A 2Z94A 1OOKB 5DO4H 3KQBA 1XVOA 3EQ0H 2YOLA 3ZVBA 1DWDH 1KY9A 3BEUA 3AW0A 4MTBA 2PGBB 4FUFA 1SG8B 3LGUA 3VB3A 3ODDA 6GCHF 4OS5A 2H1UA 5AFZH 2A5AA 1WSSH 4FVBA 3EYDA 4YM9A 4XBDA 2SGQE 4DGJA 1K1PA 3ZZDA 2FOBA 1WU1A 4AX9H 1C5TA 1OX1A 2O8LA 3RXMA 4FUGA 1SGCA 3ZYDA 4DCDA 1J15A 1THPB 1GDQA 4FXGH 1OWIA 1IQFA 5JBAS 5A0CA 2TPIZ 3GICB 3PYHA 2J9NA 2BY7X 1GJ4H 5H4IB 1IQGA 4IW4E 4LOYH 2ZTYA 1HNEE 1AZZA 1C5RA 4B2AA 3TPIZ 1OP8A 2WPIS 2WYGA 3MU0A 4Y0YE 5T6DA 1ESTA 3A8AA 2ZU3A 1TPPA 1O3AA 1KIGH 1QTFA 2H5CA 1DLEA 1FNIA 5E8EH 4NA8A 3BTWE 3M5OA 3UWJH 3HGNA 5JPMH 4UFGH 4MPVA 1SBWA 1EAWA 1P2MA 2O8MA 3V0XA 3NXPA 1QFKH 1HUTH 2SGEE 1C9PA 5GCHG 3ATWA 3MO6A 1EB1H 3C1KA 1DFPA 5C1YA 1MAXA 2ZECA 3SUEA 4IMZA 5FX5A 1MQ6A 1DWBH 4XBCA 1XKBC 1BCUH 1INCA 1XM1A 1O2XA 4ISIH 3BG4C 3N7OA 2ZWLH 2IOTA 1WUNH 1EKBB 4A1VA 1UK2A 3WY8A 3TVJB 3LGVA 4UFEH 2BQWB 3UNRA 1MZAA 3OY5U 1LVOA 1LKBA 2A5IA 3KEEA 1S84A 4FUJA 1ESAA 3VGCC 3PB1E 3RXTA 4E7NA 1MD7A 1BDAA 1FN8A 2ZCLP 2HNTE 2AYWA 2KAIB 4DT7B 2ZP0H 4B74A 1NRQH 1VITG 3HGPA 3H7OA 3KN2A 3DA9B 3EDXB 4GVUA 1PYTD 2GP9B 5J4SA 2PKSC 1J16A 1FPHH 4FUEA 1GGDC 2O9QA 1TNGA 1AKSA 1QRZA 2VWOA 1C1WH 3B23B 2F9NA 4Y8XA 5SGAE 1FDPA 2Z6BD 3JZ1B 1GMDG 1YPHE 2QXGA 3CENA 1RIWC 1WTHD 2SFAA 2F9OA 7ESTE 2BDGA 2GV7A 1O37A 1OWHA 2A7HA 1TX8A 2A0QB 2JETC 1NRSH 4DG4A 1GHZA 4AORA 4XBBA 1QCPA 2ZI2H 2BD8A 3STJA 1EJMA 1XUGA 1NN6A 4CRFA 2F91A 3BEIB 3RXEA 4E06H 2WINI 1XUHA 1O3IA 3URDA 3RU4D 1CSOE 1UO6A 4KTCA 3GDSA 4OS7A 3MU5A 3T26A 3QDZB 2CHAB 4GCHF 3GY3A 1GHVH 3FVFB 5JB8S 3LC5A 5EOKA 3QGJA 1A5HA 3DT0H 2Z3DA 1C5WB 3S7KB 3CS0A 4WXIA 4XOJA 4LXBH 1TGSZ 3SBKA 2FI4E 4ZH8A 1XX9A 1PQAA 4CR9A 4AN7A 2ZGBH 1TBQH 3SV9A 1NM6A 4A6LA 5DPAA 4UFFH 2O8UA 5DP5A 5AF9H 1BMNH 1V2KT 3ZZCA 1TNLA 2WV4A 3PROA 4WH6A 4CRAA 4X1QU 1GJ9B 1YYY1 3FP8E 3QO6A 2VH0A 1KDQB 1LVYA 1ZRKA 1FV9A 2A5KA 4U2WA 1L1NA 2ZFQH 1EOLA 4AGJA 1AY6H 1HDTH 1DOJA 3MO9A 3M35A 2GMTB 4ABIA 4K69A 2VGCB 2ULLA 3GCHB 1C5SA 5LPFA 5DP4A 3RXOA 5DG6A 1DWEH 3MI4A 5HM2A 1J14A 4ZXYH 4JK5A 5A0BA 1WQSA 3B8JA 1Q2WA 1O30A 1S85A 1VJ9U 1Z6EA 5FX6A 1P02A 2C3SA 3QWCH 2O8TA 1C2JA 3DFLA 3GY5A 4Y79A 5GXPA 1HAOH 2GZ9A 3S9CA 2J34A 2UWLA 5A09A 1AFQC 4TWWA 1TMBH 1ELDE 2HNTC 3E91A 2ODPA 1UTQA 5K0HA 1F92A 1O5GH 1UCYK 3E6PH 3MWIU 1HCGA 1QL7A 4ABFA 1PJPA 2ZEBA 1FI8A 2PGQB 2PLXA 1KYNA 1SGTA 2BDIA 1NTPA 5EGMA 1O2YA 1SPJA 2EA3A 1XUIA 1GCDA 2RCEA 3CP7A 2VNTA 2OQUA 1ANBA 1N6YA 2BMGB 3M3VA 3SJKA 5GDSH 4ASHA 2OBOA 3U8RH 1HV7A 1LMWB 4DJZB 1YPHC 3MNCA 4K2YA 3UREA 4ZKNU 1TNHA 5FBIA 4MNWA 4IN2A 3UOUA 1GBEA 2SNWA 1KXCA 1O3GA 4I33A 2FTLE 1DPOA 2R0KA 2XC5A 3SUFA 1A46H 3TLOA 4ZXXH 1V2ST 4NSVA 1YKTA 1LHGH 3MH6A 5E0GA 2LNCA 1UHBB 3ZVFA 2ZHDA 2ANYA 1HAZB 2Z9IA 1P2KA 4FUHA 1UTKA 1TB6H 1FUJA 3T28A 1C5XB 4Y8ZA 4HI3A 3GCTF 1TFXA 2PSYA 3A8DA 4X8UH 3E0PB 1CGIE 1Y5UT 3TJNA 1IQHA 1DM4B 1UVPA 1UTMA 3M7QA 2FOAA 2DE9A 4X2YA 3RMOH 5FPYA 1BTUA 2GKVE 1FAKH 4K1EA 2RA0A 1LHFH 4UFDH 2PHBA 7GCHG 1P3EA 4X6PA 1A3EH 4YT6H 4A5TS 1BB0B 1UVSH 3A7TA 2ANKH 4YESB 2Z9LA 2B0FA 4U30A 3V3MA 8KME2 2FXRA 1LVMA 5A8YA 1TLDA 2ZFFH 3UWIA 3PMHB 2W7SA 1EPTB 5EXNA 1S83A 1YC0A 1PPBH 4K1TA 4ISLA 1FJSA 1C1NA 2AEIH 3P8OA 4ABAA 2BDHA 3W95A 1YBWA 1M9UA 5T3HA 2GCTB 3M5NA 2FP7B 2AIQA 3MU4A 1HJ8A 2ZPRA 3PV4A 1OPHB 2H9TH 1N8OB 2FLRH 4ZHLU 3ZZ8A 1RJXB 5HMAA 4B2BA 2FX4A 3A88A 1MKWK 1SQAA 3VB5A 3S0NA 1UJ1A 1IHSH 3FP6E 2AGEX 2FS8A 1P2QA 1QBVH 1SGPE 3AAUA 4FU8A 2FYQA 4ZUHA 1A3BH 3Q3YA 2DUCA 1QL8A 3NPSA 4M7GA 1O2KA 1HAIH 1F5LA 2ANWA 1O5BB 1E34B 2C8YB 1P0SH 3KHVA 1V6DA 3O8DA 4X1NU 3A7WA 2WUCA 1O3FA 1GBHA 1P2NA 3ZVGA 4WMDA 1DVAH 2Y81A 3BTDE 2ZFTA 1GDNA 1N6XA 1NFXA 2PV9B 3BIVH 4CRDA 3SHCH 3GCTG 1AI8H 5GIBA 1ID5H 4DVAU 2D1JA 1VITH 1HFDA 3A81A 3VB6A 2FMJA 3KIDU 1YGCH 3CS7A 3DFJA 3PTNA 1AUTC 4JZEH 1HAVB 2FM2A 4TPYA 1O2SA 4ESTE 1HJAB 1GHBF 3PTBA 1OXGA 3ZVDA 2FI5E 1ESBA 1Y59T 3VB4A 1F5KU 1C1TA 2FODA 5L30H 1P9UA 1WV7H 1SFQB 2BM2A 1P57B 1S6HA 1TGBA 5L2ZH 1DUAA 3R3GB 5AHGH 4I8GA 4Y0ZE 1AB9B 1SHHB 2OQ5A 3ZVAA 3EGKH 3GYLB 1SMFE 2BZ6H 1BIOA 2ZPSA 4MNXA 3D49H 2BLVA 4OS4A 2GT8A 4R8TB 2CF9H 3SQHE 2F83A 1ELCA 1VR1H 4ZROA 2P3FH 2F3CE 2FOMB 4YO9A 2GDDA 2QXIA 2OC0A 2CHAC 1C1VH 4KELA 2GDEH 2ZC9H 1BBRK 2Q6GA 4DW2U 4THNH 1KTTB 4U32A 1ZMJA 2H2ZA 9ESTA 1FY1A 1GHWH 5DK1A 3RMMH 1QY6A 3GDVA 5FXLA 6CHAB 4WH8A 3E8LA 1BITA 1EZXC 2ZHWH 1YPMH 2BDCA 2P59A 3B9FH 5F8ZA 1K1JA 3UIRA 4AYVB 2XCFA 1O3DA 4I32A 2R9PA 1QR3E 4J2YB 1GMCF 3TGJE 4H6SB 1TOCB 2BLOA 2WPLS 3LGIA 3U8TH 1A1RA 1BHXB 1ZR0A 3BTME 2ZU1A 1W10U 1P05A 1BQYA 1T32A 1Z8IB 2A7CA 1C5UA 1OWJA 3ESTA 1NRNH 2GMTC 2PKAB 2VGCC 2ZDVH 1UTOA 3GCHC 1GBTA 5ESTE 3RXCA 2F9PA 2VWLA 5C5NA 3AVZA 5DP6A 1O2ZA 4CH8B 4WJG2 1GJ6A 2KAIA 2AMQA 1OWEA 1SHYA 1P2JA 4NCYA 4NGAH 4Q80A 5JYIA 4LZ4B 3BSQA 2HALA 3BIUH 1OP2A 1O2OA 4ABGA 1MKXK 3UFAA 4IC5A 2WPJS 4XSKU 2H6MA 1SLUB 2XC0A 2PUQH 1G2LA 1O3LA 4GLYA 2WPMS 1O5DH 3U1IB 1QB6A 1V2UT 1P04A 1G3BA 3LONA 5L6NH 2F9BH 1GHAG 3PMBB 3M7UA 4ZHMU 3LGWA 1P2IA 1A5GH 2WUBA 1W8BH 2BQ6B 2A4OA 1K22H 4LK4A 3SV6A 4BXSA 2ZGCA 2Z9JA 5J4QA 4H4FA 5IYTA 2BTCE 1CO7E 2ZFPH 3T62A 1GI8B 3TNTA 5A0AE 1YPKH 2VH6A 3K65B 4MG3A 1GBIA 1TAWA 1V2WT 3P95A 3ITIA 1NU7B 3A89A 4Y71A 2WYJA 1W0ZU 1ZHRA 4X8SH 1BTXA 3NCLA 1GDUA 5BRRE 1HRTH 1MQ5A 1WOFA 3ZZ5A 2QAAA 1GI2A 3GCOA 1RS0A 1O31A 4DIIH 3MTYA 3DD2H 5TCAA 1HXEH 1O3KA 1YPLH 2VIVA 3I29A 6LPRA 2BD5A 2BX3A 1AQ7A 4NZQA 1RD3B 7KMEH 3RU4T 1OS8A 5FHTA 3K2UA 1AZ8A 2EEKA 1ORFA 2NWNA 4JZIA 2ZU2A 2BVSH 2ODQA 1GBLA 4R0IA 3RM2H 2XYAA 1C2IA 2VWMA 1KDQA 2HOBA 1PPHE 1NZQH 1K28D 1MZDA 1UK4A 1EAIA 2QA9E 1Y3YA 1P12E 5C67A 1K1NA 3A84A 3A8CA 1DS2E 3RXKA 1ELTA 1C1UH 2Y5GA 1TGCA 4NIXA 4CRBA 1C1MA 1EPTC 1LHDH 2QN5T 2GD4B 3UNQA 2Z7FE 4MPXA 1ARBA 2GV6A 4B71A 1DLKB 3PLPA 1FAXA 2GCTC 2HWLB 4FU9A 3RXHA 1GL1A 1MAYA 1CA0B 4I8LA 2FYRA 1BBRH 1K1OA 3PO1B 1N8OC 3SJIA 2A32A 3O8BA 3ZZ3A 3O8CA 1Z71A 4MLFB 4FU7A 1O3HA 2A2XH 1IHTH 1DITH 3MH4A 3V12A 2SGFE 1O3BA 3RXLA 3T2NA 4I8JA 3MO3A 1TGTA 1Q3XA 1E0FD 1THSH 1PPZA 2AMDA 4TY6A 1HAHH 2HPPH 1L0ZA 4ZAEA 2BOHB 3OX7U 1AU8A 1TNIA 1TNJA 1YCPH 2J95A 1P2OA 2F9VA 1P11E 3F9GA 2Z9GA 1BTYA 1KSNA 4GHTA 2FOFA 2W26A 3E16B 4ABBA 2BB4A 4YTAA 6GCHG 1KXAA 4D9RA 4I8HA 1HJAC 4GPGA 1AIXH 4O97A 1UHBA 2I6SA 2C8WB 3Q77A 2VWNA 3ATIA 2SGDE 1MKXH 2GT7A 4WMFA 1ETSH 2ZFSA 1EOJA 4NA9H 5T6FA 3QUMP 3SUGA 1AB9C 1TNKA 4A92A 1MTSA 3SI4H 1ZTJA 2HLCA 1ZTKA 1K1MA 1TBZH 1FY3A 5JDUB 2QGRA 1ZGIA 1O33A 3KNXA 1ACBE 4K8BA 1DY9A 1SFIA 1X7AC 1LPZB 1HBTH 1YCPM 1RXPA 1W3CA 1A0HB 1C9TA 3MFJA 4B75A 1VCQA 2AFQB 2H5DA 3A7VA 1GMHF 1O2GH 1BBRE 3M61U 1L1GA 1EPTA 1JBUH 2HRVA 2Y5HA 2UUYA 1CT4E 1O3JA 1SGIB 6CHAC 2BDBA 3ATLA 1ZPBA 1HXFH 3PM3A 2ZA5A 2P95A 3UNSA 1C2MA 1Z8GA 1OWKA 2NU1E 3E3TA 1LDTT 1W11U 2ALVA 1O5EH 2QXHA 1UVUH 3U8OH 1PPCE 2XCNA 4WMEA 1P09A 4X2WA 2VIOA 4UE7H 1QRXA 7LPRA 3F9EA 1GJ5H 3H7TA 1ZSLA 4ISNA 3O8RA 3S9BA 1GJAB 2M5TA 3LOXA 1C5PA 4NWLA 4NG9H 4X2VA 1KXBA 2FESH 3SU0A 1F2SE 2ZIQH 1DY8A 2AGIX 1EASA 4XE4A 4IN1A 2V3HH 3KGPA 3DUXH 2OD3B 4ABHA 1O3MA 2BD2A 1HAVA 1XXDA 4Y10E 1QBOA 4JYVH 2BLQA 3SZNA 3ELAH 5EW2H 1ETTH 3RXGA 2GCHF 4Y7AA 5B6OA 1TPSA 1GJBB 1A61H 3M3TA 1SGDE 2C4FH 2XBWA 4JCNA 1DDJA 5TJXA 1TPOA 1GJCB 3NWUA 2OLGA 3SJ8A 3NK8A 1SGQE 1DANH 1GBJA 1WYKA 2CJIA 1ZJKA 1CGHA 4BTUB 1BMMH 4INHA 5EPYA 1GL0E 4MVNA 2ZF0H 5C5OA 1SB1H 3IITA 2BD7A 3ZV9A 1C2GA 2FPZA 3M5MA 4OS1A 3T5FH 5CHAB 5C20A 3D65E 1JRSA 1AE5A 1GI9B 3SU6A 2ZDLA 1G37A 2A4QA 2BY5X 3BTGE 3P17H 1GBAA 2HNTF 1RRKA 4BOHA 1ARCA 2PTNA 8GCHF 4GCHG 2BZAA 3Q3XA 2ZKSA 3RXBA 1JXPA 1WAYB 1JWTA 1AD8H 3RLYH 4BXWA 2BX4A 1C5VA 4X8TH 3U1JB 5EW1H 1HPGA 1CQQA 2C93B 1GI1A 2P16A 1CU1A 3ATKA 2XRCA 1A5IA 4JYTA 2V3OH 4JZFH 1OYQA 1F0TA 3M5LA 2ANMH 3IG6B 1HAXB 1OYTH 3BTHE 1KLTA 1TMUH 5E0JA 2B7DH 4K8YA 1NFWA 1O2JA 1Y5BT 1GBKA 2G4UA 2ZU4A 1CT2E 2Y7ZA 3BTKE 4I8KA 3ZZ9A 1CT0E 1LTOA 1S82A 2G5VA 4AZ2B 2WPKS 3P8FA 1E36B 3SU3A 5FPTA 1CA0C 2J38A 1Z6JH 2P8OB 1RGQA 1O3OA 2F9UA 3SI3H 3ZZ7A 3PO1C 3F1SB 4YT7H 1LPGB 3ODFA 2BYAX 2FX6A 2QY0B 2ZCHP 1ELBA 1GJDB 2ZDMA 2I6QA 1CGJE 1ANEA 3LJJA 2ASUB 1C5LH 1T8LA 1J17T 4RKJB 2Q6FA 2B5TB 5DJ7A 1YF4A 4X6OA 1PFXC 2XWBI 2VVVA 3OYPA 1ZLRA 4MNYA 3Q76A 4JK6A 4MNVA 1AFEH 3SGQE 2TIOA 2BXUH 2LPRA 2XC4A 3MYWA 4B1TA 3PMJA 3C27B 3K6ZA 2V0BA 1B0FA 1Z1IA 1G3CA 2VIPA 1NO9H 4YZUA 1JMOH 1W7XH 5I46H 2P94A 3E1XB 1ZOMA 3SO3A 1D6RA 2XXLA 4TWYA 3MHWU 5A8XA 1V2QT 2R3YA 1XKAC 4OGXA 5F8TA 1B0EA 1ZHMA 1EP6A 1F0RA 1Y8TA 2BY6X 2G5NA 1C4U2 1EATA 1OKXA 2CGAA 1ZJDA 2IN2A 1TRYA 1L4DA 3OTJE 1MCVA 1D3DB 4ABDA 2PFEA 2ESTE 1QBNA 3ZV8A 1C2KA 1MTNB 4NIYA 1GCTB 1E35B 2V35A 3RLWH 1BT7A 4NWKA 1ABJH 1SVPA 3MNBA 3QTVH 1FXYA 3EAJA 4AFZA 3BTFE 2AIPA 4DY7B 2UUFB 3M36A 1NESE 5DP8A 3RXJA 1HLTH 5FBEA 1NRPH 1C5YB 5ESBA 3LU9B 1NU9A 1A0LA 4ZKRU 2JH5D 1SGEE 4NIWA 1L2EA 4DURA 4GSOA 1DXWA 5L2YH 1LHEH 1W13U 2ZGJA 3FAOA 2EI7A 3H5CB 4QT8C 2XBXA 1AHTH 1MU6B 1V2VT 3FP7E 3ZZ6A 1S6FA 1K2I1 1TGNA 1O36A 1BJUA 4WVPE 1EB2A 3GYMA 2D8WA 3LGYA 1GI5A 1C1OA 1V2PT 4O9VA 4YLQH 5JBCS 2BHGA 1C5ZB 3PWBA 4OS6A 5BPEA 1Z8JB 4MPWA 1RTFB 3UPEA 3UR6A 2EI8A 2O8WA 5FPSA 5E0HA 2G52A 1DXPA 1F0SA 2XW9A 3A8BA 3LH1A 1O2QA 1GBCA 1TX6A 4GAWA 2OXSA 2V6NA 4WY3A 1H8DH 1QJ6B 1VJAU 1TX7A 3Q3KA 4IC6A 4F49A 5EU8A 3T29A 1TE0A 2P3TB 4AGKA 2PTCE 3QN7A 5EQQA 1W12U 1IQEA 3NUMA 3SU1A 1TBRH 4XFQA 1D3QB 1GBMA 1S0RA 1A4WH 1SGFG 3FANA 5E2OA 5LPRA 5HM9A 1FIWA 1V2LT 2XWAA 1H8IH 2FOEA 3P6ZB 3VB7A 2Q1JA 2QYIA 5G4BA 1RFNA 2VIWA 3F9HA 2D26C 5PTPA 3TIUA 3RXRA 1ZHPA 1KXDA 2W7UA 5E2PA 3QGNB 4U01A 5AVDA 1G36A 3SGBE 2GTBA 1UK3A 1TOMH 1O34A 1Z8RA 1BMLA 2Q6DA 1YCPK 3HKJB 1C2DA 3ZZAA 3RC5A 3ZZ4A 4Q2KA 2AS9A 1SGYE 3S69A 5CE1A 1S0QA 2PW8H 4MDSA 1O39A 1QJ7B 1S81A 1DICA 1O3EA 1SC8U 2BVXH 3GY4A 3OSYA 3QX5H 1QIXB 1GHBG 2C8ZB 1EJNA 4Z6AH 1H9HE 3PLKA 1OWDA 2XBYA 3LIWA 2ZHQH 1MH0A 1MUEB 2BY9X 1FONA 3RU4E 3SNEA 1XVMA 3UTUH 1IQJA 2VVUA 5ABWA 2Z3CA 1IQNA 3MU8A 2R2MB 1C2FA 1QRWA 2WV5A 1LO6A 1YP9A 3MH7A 2ZDAH 2FS9A 3SNBA 1K1IA 3UQOA 3HK3B 5LPEA 1W0YH 2NU4E 3KQCA 4A1TA 4GHQA 3SNCA 4AYYB 3RMLH 5CHAC 1RTLA 1JIRA 1MD8A 2H9HA 1C1QA 5C1XA 4X6NA 4NFFA 2AH4X 1QL9A 2WPHS 1GHXH 2IJOB 3AASA 1DSUA 3K6YA 3E0NB 4D9QA 2Y6TA 1UVOA 2G51A 1LQDB 2PUXB 2UUJB 2OC7A 4H6TA 1BRAA 3V7TA 1QQUA 1O3CA 1LKAA 4ISHH 4OS2A 2BXTH 4FUIA 1SSXA 1SL3A 2PWXA 4Q7YA 5FCKA 1A7SA 1TMTH 2OINA 2ZO3H 3A7ZA 1IOEA 3BF6H 4X6MA 1ZGVA 3HK6B 1GMCG 1MCTA 4AFUA 2BDYA 1AE8H 2VIQA 2FTMA 2ZTXA 2Y7XA 1PQ8A 1IQMA 1HAPH 1IAUA 2VVCA 1NFUA 2UUKB 1UTJA 3L33A 3QK1A 1NFYA 3TJVA 5A8ZA 3LC3A 4BAMB 3TU7H 3QZRA 2TRMA 1J8AA 4E05H 3S9AA 1DWCH 1XXFA 1QJ1B 4B73A 3SJOA 1FN6A 2CMYA 4X1SU 2P8OC 1ELGA 1YLDA 1H9LB 1C5OH 1GBFA 5GCHF 1O3NA
chains in the Genus database with same CATH superfamily
4CHAB 3LDXH 1PYTC 1C1PA 1AO5A 4DOQA 3D23A 4OGYA 1UTNA 1DSTA 3LH3A 4Q7XA 1ELVA 1BTZA 3KCGH 2SNVA 1ETRH 3TGKE 3T27A 3FZZA 2V3MA 1PQ5A 1PPFE 1BRBE 1AGJA 5F03A 3F0OA 4KTSA 1UTLM 1GBBA 2J97A 3ZZBA 1VGCB 1B5GH 3F2HA 2W6JD 4BAQB 1TALA 1W2KH 2TGAA 1ZYOA 1O2UA 3FZDA 4F4OC 3UR9A 1N1LA 1IQKA 1QB9A 2IPHA 1GBDA 1O2PA 2FZZA 4ACBA 1NRRH 5GWZA 1VITF 3RXFA 4X2XA 1XUKA 3BG8A 1BRCE 2G55A 2FOGA 1T8MA 2R0LA 1FIZA 2ZTZA 1LVBA 5HXFA 4HGCA 2QV1A 1YLCA 5DP3A 4RT0A 1Y3XA 1F0UA 2G00A 1ELAA 1GMDF 5LGOA 1MTNC 1YLNA 4K1SA 1GCTC 1K1LA 1ZSKA 1QQ4A 1FY8E 2YNBA 3P8NA 3QLPH 4YOGA 2ZQ1A 1C2HA 3R0FA 1O0DH 3WWBA 1Q31A 2GZ8A 2Y82A 2ILNA 1G9IE 3D62A 1VCPA 1Y3UA 5JBBS 1O2MA 1WBGB 1D9IA 1GVKB 1L4ZA 3K9XB 4SGBE 1O2VA 1SGRE 4NA7A 1FY4A 1HIAB 1GJ7B 1RTKA 1U6QA 3TNSA 4O3UA 1ELEE 2TGPZ 4IS5A 1P03A 4HTCH 2Z3EA 4AB9A 3RXDA 1O2IA 4K5ZA 1PPGE 1AWHB 3M37A 2OBQA 2R2WU 3UUZA 1EJAA 3AW1A 2L74A 1C5QA 1C1SA 1D3TB 4BTIB 1BUIA 3SQEE 1QA7A 1WXRA 1GHYH 2VJ1A 1E38B 1EXFA 1T8NA 1O5CB 4INLA 3STIA 1GI3A 1SLVB 1AVWA 1QHRB 4A1XA 1Y3VA 2FOCA 3RP2A 2NU2E 1GWAA 1T4UH 1HB0B 4AFSA 5JBTA 4WXVA 1G2MA 3BN9A 1JOUB 4D8NA 1G30B 2OC1A 2V7QD 2A2QH 5FAHA 1SLXB 4RI0A 3VEQB 1T4VH 2AMPA 1AWFH 2TGDA 1LPKB 5I25A 1TYNA 4Q7ZA 5EJLA 1YPGH 3F9FA 1BTHH 2FI3E 2YNAA 1V2JT 1CHOF 2GVFA 2Y80A 4BAOB 4CBOA 1YPEH 2NU3E 3LKWA 3OY6U 1V2NT 4BANB 3DHKH 1BTWA 2BQ7B 2XTTB 2TBSA 1P8VC 1EAUA 3NZIA 1BHXF 2A4GA 3GCNA 5F6MA 3U9AH 4J1YA 1EX3A 1ELFA 3A7XA 1O5AB 1TRNA 1O32A 1V2OT 2CF8H 1CE5A 2STBE 4Y7BA 3LJOA 3PWCA 3SV8A 2OC8A 4OM9A 3DSPA 4JZ1A 4IMQA 3I78A 3TGIE 3KF2A 1O2NA 4TY7A 1GG6B 4BTTB 1QGFA 3SU5A 1GI0A 3UAIC 1P3CA 1V3XA 3IWMA 1JRTA 1H1BA 2ZHEH 1C2EA 1TRMA 5T6GA 1O5FH 1EAXA 1SR5C 3BTTE 2BY8X 4VGCB 1WDIA 5K7RA 1MTWA 3V13A 1GMHG 4X1PU 1NC6A 3A82A 3Q00A 3TH4H 5LH8A 2GX4A 1ZTLA 2SGAA 1H9IE 1Z1JA 1FQ3A 1TABE 5C3NA 3TH2H 4LZ1H 2QF0A 1MBMA 1AUJA 3FKSD 3SU2A 2FEQH 1A2CH 2BDAA 3BEFB 1C5NH 3VPKA 1E37B 3I77A 1D3PB 2NU0E 1C2LA 1DE7H 4D7GA 2CN0H 2A45B 3EE7A 1JIMA 2J94A 4PROA 3GY8A 5EQRA 3VXEH 4I7YH 3U98H 5AFYH 3F68H 2ZGXH 1CHOG 1C4V2 1NS3A 5EXMA 1FPCH 3TITA 3GY2A 1O2HA 7GCHF 2K1QA 3P92A 3SNAA 1OSSA 1MU8B 1Y3WA 1ZMNA 1CBWB 2VINA 3RMNH 8ESTE 4CH2B 4HZHA 5F53A 4H42U 8LPRA 4BAHB 1UMAH 4A7IB 4P02A 5HYOA 1GPZA 3SORA 4YOJA 3PMAB 3N7EA 2R3UA 3BTEE 1BRUP 1KXFA 3TK6A 1S5SA 1VCWA 4ISOA 5DN6D 1A0JA 4FUDA 1XMNB 1ZPZA 4CHAC 2WSSD 3CNRA 2PKAA 3SW2B 4INKA 1T7CA 3KQDA 3EA8A 3RXUA 2VU8E 1MBQA 4JMYA 3L6PA 1P01A 3ENSB 1DX5M 2GZ7A 3EA7A 2GCHG 3TK9A 5FCRA 2P3UB 4ZKOU 3F2FA 4AG2A 3TK5A 1BMAA 4KKDA 1GI7B 1O38A 3W94A 4NIVA 1T31A 4YOIA 3OAAD 1VGCC 1AN1E 4CRGA 2JH6D 2P93A 5DKMA 3SUDA 2W3IA 3U28C 1FZZA 3F6UH 2TGTA 1NROH 1EUFA 1LQEA 4FUCA 1SQOA 1SGNE 1EZQA 5EQSA 3A7YA 5C1UA 4I86A 2PR3A 1GVLA 2HVXA 2W3KA 1SQTA 3DSOA 4TPIZ 5KGOA 2A4RA 3A85A 2CXVA 4Y6DA 1EP5A 3RXVA 4MQAA 1FLEE 1FX0B 4B2CA 1OP0A 3SNDA 3BV9B 1VZQH 3LPRA 4SGAE 4ZMAH 1ABIH 2W5EA 4KP0A 1E79D 4AFQA 1ZMLA 2THFB 1O2WA 4NFEA 4ABJA 3RXSA 1C5MD 3MNXA 4FUBA 1G3EA 1V2TT 1AVGH 8GCHG 1AKSB 1QURH 1TWXB 1AVXA 4ABEA 4TYDA 2AGGX 3S7HB 1DUEA 3PRDA 1PQ7A 1QB1A 3SV2H 4BNRA 3A83A 4P00A 3M3SA 1B7XB 1BJVA 1HGTH 2J98A 1WTGH 4XDEA 2QF4A 3TJOA 2QC2A 3URCA 3ZVEA 3L3TA 3SN8A 1TONA 2UWOA 2ZQ2A 1LHCH 5HGGA 3UY9A 2K7XA 3LT3A 3VFEA 1W0KD 1ZZZA 1D6WA 1F7ZA 2OCVB 2A31A 3RDZA 3SU4A 1HYLA 2BD3A 3VG8A 2HGTH 2YMSB 4YXWD 4WWYA 4AG1A 1ZRBA 1MTVA 1Z7KA 2HPQH 3RC6A 4UEHH 1ANCA 2WPDD 5DGJA 3VXFH 3HPTB 2ZG0H 1BOQA 4B6EA 3HATH 2AERH 2RG3A 1H8ED 3GISB 1IQIA 4AB8A 2VIDA 1K9OE 3SGAE 2WV9A 1HAGE 1Y5AT 5EPNA 2FDAA 5EG4A 1GI6A 4HFPB 1W7GH 2ODYB 5C2ZA 2JH0D 1QNJA 3G01A 3P70B 4NSYA 3MU1A 3GOVB 2G4TA 9LPRA 4I31A 5DP9A 4IBLH 2PSXA 3EA9A 1G32B 1TA6A 5A2MH 2ZNKH 4JYUH 3ATMA 3RXQA 3BG4B 1O2LA 3GY7A 2H9EH 4Y8YA 1CHGA 2C8XB 2ZFRH 5ETXA 3SOSA 4RSPA 1P9SA 2ZDKA 1W14U 2LIZA 1F5RA 1FMGA 5EIYA 4CR5A 1SOZA 3VGCB 4AOQA 2QIQA 3E90B 3RUOA 1HJ9A 3PLBA 2FO9A 1ZSJA 1UTPA 1CA8B 2J2UA 1THRH 3TH3H 4MPUA 4CBNA 3U69H 1SOTA 2KZ4A 4UD9H 1GHAF 3FFGA 1UCYH 1G3DA 2OP9A 2JKHA 1AMHA 2PKSB 4K3JA 1O2TA 4K60A 4E7RG 4ZHAA 1C1RA 2ZZUH 1GGDB 3GY6A 4D7FA 1CVWH 2B8OH 1MMJN 2ZU5A 2STAE 3MNSA 3SV7A 4RKOB 2XBVA 2VB0A 2BVRH 1RIWB 2EI6A 2ZDNA 1NBMD 5JB9S 2FIRH 1GG6C 1MTUA 2QCYA 2JETB 1KXEA 3T25A 2SGPE 3A87A 4RN6A 3GDUA 1KLIH 1HIAA 4Y11E 3RXPA 1YPJH 1BA8B 2K8IA 2GGVB 3ZYEA 1NY22 4VGCC 2J92A 4IGDA 3SHAH 4FVDA 5TCCA 1O2RA 4B76A 3M7TA 1V2MT 1GJ8B 4JZDH 4KGAA 2BOKA 2Y5FA 1TIOA 1SGFA 1DT2A 4X1RU 2ALPA 5CMXH 1O3PB 3EBNA 3RXAA 2A1DB 1QA0A 3OTPA 1IQLA 3MOCA 1L1JA 1ANDA 3AAVA 1XUFA 2RA3A 6ESTA 2C90B 2QXJA 1P10A 2ZHFH 1KMHB 3NKKA 5F8XA 3EE0B 2B9LA 2FWWA 1EZUC 1PPEE 5GJ4B 1FY5A 1KLJH 1H8HD 3UOPA 2CV3A 1TA2A 2UWPA 3ZVCA 1H4WA 4KTUA 2RDLA 1LCYA 1J9CH 2G8TA 1T8OA 2J4IA 3BTQE 2DE8A 3LGTA 1O35A 2FLBH 2QF3A 1TQ7B 3A86A 2BLWA 5EODA 4DIHH 4D76A 1CBWC 5C0UA 1GI4A 2G81E 1BZXE 1EQ9A 1UCYE 1TQ0B 1TPAE 4ZKSU 1SLWB 1HAYB 1XUJA 2ZCKP 2OUAA 3HKIB 3KQEA 4WF8A 4O3TA 4YLUA 1ZPCA 3MH5A 3QZQA 4CREA 4CRCA 2OTVA 4X0WU 3RC4A 1K21H 1WCZA 1GVZA 2ZPQA 3MMGA 1P06A 1D4PB 4Z0KA 1C4Y2 4GUXA 1WQVH 2XNIA 5EXLA 4X8VH 3SJ9A 3JZ2B 2XOKD 1MKWH 3KL6A 2A7JA 3QTOH 1EZSC 5IDKA 2BD9A 1NT1A 3RM0H 2D2DA 1UVTH 1NPMA 4ZCNA 1YM0A 2Z9KA 2FOHA 3A80A 4BAKB 3TJUA 1AFQB 4O03A 1BTPA 3P8GA 3UQVA 3FN8A 4UONA 1KTSB 4NZLA 2ZGHA 2BD4A 1SI5H 2EC9H 1V2RT 4Y76A 5GPIB 3RXIA 3OU0A 4UDWH 5DP7A 2Z94A 1OOKB 5DO4H 3KQBA 1XVOA 3EQ0H 2YOLA 3ZVBA 1DWDH 1KY9A 3BEUA 3AW0A 4MTBA 2PGBB 4FUFA 1SG8B 3LGUA 5KEDA 3VB3A 3ODDA 6GCHF 4OS5A 2H1UA 2GJGA 5IK2D 5AFZH 2A5AA 1WSSH 4FVBA 3EYDA 4YM9A 4XBDA 2SGQE 4DGJA 1K1PA 3ZZDA 2FOBA 1WU1A 3PV2A 4AX9H 1C5TA 1OX1A 2O8LA 3RXMA 4FUGA 1SGCA 3ZYDA 1SKYE 4DCDA 1J15A 1THPB 1GDQA 4FXGH 5CHBA 1OWIA 1IQFA 5JBAS 5A0CA 2TPIZ 3GICB 3PYHA 2J9NA 2BY7X 1GJ4H 5H4IB 2LELA 1IQGA 4IW4E 4TT3D 4LOYH 2ZTYA 1HNEE 1AZZA 1C5RA 4B2AA 3TPIZ 1OP8A 2WPIS 2WYGA 3MU0A 4Y0YE 2YMSC 5T6DA 1ESTA 3A8AA 2ZU3A 1TPPA 1O3AA 1KIGH 1QTFA 2H5CA 1DLEA 1FNIA 5E8EH 4NA8A 3BTWE 3M5OA 3UWJH 3HGNA 3AK5A 5JPMH 4UFGH 4MPVA 1SBWA 1EAWA 1P2MA 2O8MA 3V0XA 4FOUC 3NXPA 1QFKH 1HUTH 2SGEE 1C9PA 5GCHG 3ATWA 2HLDD 3MO6A 1EB1H 3C1KA 1DFPA 3KQ5A 5C1YA 1MAXA 2ZECA 3SUEA 4IMZA 5FX5A 1MQ6A 1DWBH 4XBCA 1YWUA 1XKBC 1BCUH 1INCA 1XM1A 1O2XA 4ISIH 3BG4C 3N7OA 2ZWLH 2IOTA 1WUNH 1EKBB 4A1VA 1UK2A 3WY8A 3TVJB 3LGVA 4UFEH 2BQWB 3UNRA 1MZAA 3OY5U 1LVOA 1LKBA 2A5IA 3KEEA 1S84A 4FUJA 1ESAA 3VGCC 3PB1E 3RXTA 4E7NA 1MD7A 1BDAA 1FN8A 2ZCLP 2HNTE 2AYWA 2KAIB 4DT7B 2ZP0H 4B74A 5C17A 5C0TA 1NRQH 1VITG 3HGPA 3H7OA 3KN2A 3DA9B 3EDXB 4GVUA 1PYTD 2GP9B 5J4SA 2PKSC 1J16A 1FPHH 4FUEA 1GGDC 2O9QA 1TNGA 1AKSA 1QRZA 2VWOA 1C1WH 3B23B 2F9NA 4Y8XA 5SGAE 1FDPA 2Z6BD 3JZ1B 1GMDG 1YPHE 2QXGA 3CENA 1RIWC 1WTHD 2SFAA 2F9OA 3OEED 7ESTE 2BDGA 2GV7A 1O37A 1OWHA 2A7HA 1TX8A 2A0QB 2JETC 1NRSH 4DG4A 1GHZA 4AORA 4XBBA 1QCPA 2ZI2H 2BD8A 3STJA 1EJMA 1XUGA 1W0JD 1NN6A 4CRFA 2F91A 3BEIB 3RXEA 4E06H 2WINI 1XUHA 1O3IA 3KYGA 3URDA 3RU4D 1CSOE 1UO6A 4KTCA 3GDSA 4OS7A 3MU5A 3T26A 3QDZB 2CHAB 4GCHF 3GY3A 4AC9A 1GHVH 3FVFB 5JB8S 3LC5A 5EOKA 3QGJA 1A5HA 3DT0H 2Z3DA 1C5WB 3S7KB 3CS0A 4WXIA 4XOJA 4LXBH 1TGSZ 3SBKA 2FI4E 4ZH8A 1XX9A 1PQAA 4CR9A 4AN7A 2ZGBH 1TBQH 4DT4A 3SV9A 1NM6A 4A6LA 5DPAA 4UFFH 2O8UA 5DP5A 5AF9H 1BMNH 1V2KT 3ZZCA 1TNLA 2WV4A 3PROA 4WH6A 4CRAA 4X1QU 1GJ9B 1YYY1 3FP8E 3QO6A 2VH0A 1KDQB 1LVYA 1ZRKA 1FV9A 2A5KA 2EQNA 4U2WA 1L1NA 2ZFQH 1EOLA 4AGJA 1AY6H 1HDTH 1DOJA 3MO9A 1NBME 3M35A 2GMTB 4ABIA 4K69A 2VGCB 2ULLA 3GCHB 1C5SA 5LPFA 5DP4A 3RXOA 5DG6A 1DWEH 2JDID 3MI4A 5HM2A 1J14A 4ZXYH 4JK5A 5A0BA 1WQSA 3B8JA 1Q2WA 1O30A 1S85A 1VJ9U 1Z6EA 5FX6A 1P02A 2C3SA 3QWCH 2HVYB 2O8TA 1C2JA 4RT1A 3DFLA 3GY5A 3PRBA 4Y79A 5GXPA 1HAOH 2GZ9A 3S9CA 2J34A 2PP6A 2RDEA 2UWLA 5A09A 1AFQC 4TWWA 1TMBH 5KECA 1ELDE 2HNTC 3E91A 2J5UA 2ODPA 1E1QD 1UTQA 5K0HA 1F92A 1O5GH 1UCYK 3E6PH 3MWIU 1HCGA 1QL7A 4ABFA 1PJPA 2ZEBA 1FI8A 2PGQB 2PLXA 1KYNA 1SGTA 2BDIA 1NTPA 5EGMA 1O2YA 1SPJA 2EA3A 1XUIA 1GCDA 2RCEA 3CP7A 2VNTA 2OQUA 1ANBA 1N6YA 2BMGB 3M3VA 3DSGA 3SJKA 3WWFA 5GDSH 4ASHA 2OBOA 3U8RH 1HV7A 1LMWB 4DJZB 1YPHC 3MNCA 4K2YA 3UREA 4ZKNU 1TNHA 5FBIA 4MNWA 4IN2A 3UOUA 1GBEA 2SNWA 1KXCA 1O3GA 4I33A 2FTLE 1DPOA 2R0KA 2XC5A 3SUFA 1A46H 3TLOA 4ZXXH 1V2ST 4NSVA 1YKTA 1LHGH 3MH6A 5E0GA 2LNCA 1UHBB 3F3BA 3ZVFA 2ZHDA 2ANYA 1HAZB 2Z9IA 1P2KA 4FUHA 4Q4LA 1UTKA 1TB6H 1FUJA 3T28A 1C5XB 4Y8ZA 4HI3A 3GCTF 1TFXA 4B6FA 2PSYA 3A8DA 4X8UH 3E0PB 1CGIE 1Y5UT 3TJNA 1IQHA 1DM4B 1UVPA 1UTMA 3M7QA 2FOAA 2DE9A 4X2YA 3RMOH 5FPYA 1BTUA 2GKVE 1FAKH 4K1EA 2RA0A 1LHFH 4UFDH 2PHBA 3FOAA 7GCHG 1P3EA 4X6PA 1A3EH 4YT6H 4A5TS 1BB0B 1UVSH 3A7TA 2ANKH 4YESB 2Z9LA 2B0FA 4U30A 3V3MA 8KME2 2FXRA 1LVMA 5A8YA 1TLDA 2ZFFH 3UWIA 3PMHB 2W7SA 1EPTB 5EXNA 1S83A 1YC0A 1PPBH 4K1TA 4ISLA 1FJSA 1C1NA 2AEIH 3P8OA 4ABAA 2BDHA 3W95A 1YBWA 1M9UA 5T3HA 2GCTB 3M5NA 2FP7B 2AIQA 3MU4A 1HJ8A 2ZPRA 3PV4A 1OPHB 2H9TH 1N8OB 2FLRH 4ZHLU 3ZZ8A 1RJXB 5HMAA 4B2BA 2FX4A 3A88A 1MKWK 1SQAA 3VB5A 3S0NA 2KR7A 1UJ1A 1IHSH 3FP6E 2AGEX 2FS8A 1P2QA 1QBVH 1SGPE 3AAUA 4FU8A 2FYQA 4ZUHA 1A3BH 3Q3YA 2DUCA 1QL8A 3NPSA 4M7GA 1O2KA 1HAIH 1F5LA 2ANWA 1O5BB 1E34B 2C8YB 1P0SH 3KHVA 1V6DA 3O8DA 4X1NU 3A7WA 2WUCA 1O3FA 1GBHA 1P2NA 3ZVGA 4WMDA 1DVAH 2Y81A 3BTDE 2ZFTA 1GDNA 1N6XA 1NFXA 2PV9B 2KX4A 3BIVH 4CRDA 3SHCH 3GCTG 1AI8H 5GIBA 1ID5H 4DVAU 2D1JA 1VITH 1HFDA 3A81A 3VB6A 2FMJA 3KIDU 1YGCH 3CS7A 3DFJA 3PTNA 1AUTC 4JZEH 1HAVB 2FM2A 4TPYA 1O2SA 4ESTE 1HJAB 1GHBF 3PTBA 1OXGA 3ZVDA 2FI5E 1ESBA 1Y59T 3VB4A 1F5KU 3F2GA 1C1TA 2FODA 5L30H 1P9UA 1WV7H 1SFQB 2BM2A 3FO8D 1P57B 1S6HA 1TGBA 5L2ZH 1DUAA 3R3GB 5AHGH 4I8GA 4Y0ZE 1AB9B 1SHHB 2OQ5A 3ZVAA 3EGKH 3GYLB 1SMFE 2BZ6H 1BIOA 2ZPSA 4MNXA 3D49H 2BLVA 4OS4A 2GT8A 4R8TB 2CF9H 3SQHE 2F83A 1ELCA 1VR1H 4ZROA 2P3FH 2F3CE 2FOMB 4YO9A 2GDDA 2QXIA 2EY4C 2OC0A 2CHAC 1C1VH 4KELA 5FL7D 3UB0A 1COWD 2GDEH 2ZC9H 5DSFA 1BBRK 4ASUD 2F4LA 2Q6GA 3F0PA 4DW2U 4THNH 1KTTB 4U32A 1ZMJA 2H2ZA 9ESTA 1FY1A 1GHWH 5DK1A 3RMMH 1QY6A 3GDVA 5FXLA 6CHAB 4WH8A 3E8LA 1BITA 1EZXC 2ZHWH 1YPMH 2BDCA 2P59A 3B9FH 5F8ZA 1K1JA 3N99A 3UIRA 4AYVB 2XCFA 1O3DA 4I32A 2R9PA 1QR3E 4J2YB 1UW7A 4XRNA 1GMCF 3TGJE 4H6SB 1TOCB 3ZIAD 2BLOA 2WPLS 3LGIA 3U8TH 1A1RA 1BHXB 1ZR0A 3BTME 2ZU1A 1W10U 1P05A 1BQYA 1T32A 1Z8IB 2A7CA 1C5UA 1OWJA 3ESTA 1NRNH 2GMTC 2PKAB 2VGCC 2ZDVH 1UTOA 3GCHC 1GBTA 5ESTE 3RXCA 2F9PA 2VWLA 5C5NA 3AVZA 2JJ1D 5DP6A 1O2ZA 4CH8B 4WJG2 1GJ6A 2KAIA 2AMQA 1OWEA 1SHYA 3DCLA 1P2JA 4NCYA 4NGAH 4Q80A 5JYIA 4LZ4B 3BSQA 2HALA 3BIUH 3MQKC 1OP2A 1O2OA 4ABGA 1MKXK 3UFAA 5CDFE 4IC5A 2WPJS 4XSKU 2H6MA 1SLUB 2XC0A 2PUQH 1G2LA 1O3LA 4GLYA 2WPMS 2L6OA 1O5DH 3U1IB 1QB6A 1V2UT 1P04A 1G3BA 3LONA 5L6NH 3SZEA 2F9BH 1GHAG 3PMBB 3M7UA 4ZHMU 3LGWA 5C94A 1P2IA 1A5GH 2WUBA 1W8BH 2BQ6B 2A4OA 1K22H 4LK4A 3SV6A 4BXSA 2ZGCA 2Z9JA 5J4QA 4H4FA 5IYTA 2BTCE 1CO7E 2ZFPH 3T62A 1GI8B 3TNTA 5A0AE 1YPKH 2VH6A 3K65B 4MG3A 1GBIA 1TAWA 1V2WT 3P95A 3ITIA 1NU7B 3A89A 4Y71A 2WYJA 1W0ZU 2K0QA 1ZHRA 4X8SH 1BTXA 3NCLA 1GDUA 5BRRE 1HRTH 1MQ5A 2QE7D 4FETA 1WOFA 3ZZ5A 2QAAA 1GI2A 3GCOA 1RS0A 1O31A 4DIIH 3MTYA 2KCPA 5HKKD 3DD2H 5TCAA 1HXEH 1OHHD 1O3KA 1YPLH 2VIVA 3I29A 6LPRA 2BD5A 5GNDA 2LP6A 2BX3A 1AQ7A 4NZQA 1RD3B 7KMEH 3RU4T 1OS8A 5FHTA 3K2UA 1AZ8A 2EEKA 1ORFA 2NWNA 4JZIA 2ZU2A 2BVSH 2ODQA 1GBLA 4R0IA 3RM2H 2XYAA 1C2IA 2WHXA 2VWMA 1KDQA 2HOBA 1PPHE 1NZQH 1K28D 5HIYA 1MZDA 1UK4A 1EAIA 2QA9E 1Y3YA 1P12E 5C67A 1K1NA 3A84A 3A8CA 1DS2E 3RXKA 1ELTA 1C1UH 2Y5GA 1TGCA 3SYJA 4NIXA 4CRBA 1C1MA 1EPTC 3OEHD 1LHDH 2QN5T 2GD4B 3UNQA 2Z7FE 4MPXA 1ARBA 1QZ8A 2GV6A 1DLKB 4B71A 3PLPA 1FAXA 2GCTC 2HWLB 4FU9A 3NRLA 3RXHA 1GL1A 1MAYA 1CA0B 4I8LA 2FYRA 1BBRH 1K1OA 3PO1B 1N8OC 3SJIA 2A32A 3O8BA 3ZZ3A 3O8CA 1Z71A 4MLFB 4FU7A 1O3HA 2A2XH 1IHTH 1DITH 3MH4A 3V12A 2SGFE 1O3BA 3RXLA 3T2NA 4I8JA 3MO3A 4HG6A 1TGTA 1Q3XA 1E0FD 1THSH 1PPZA 2AMDA 4TY6A 1HAHH 2HPPH 1L0ZA 1SQRA 4ZAEA 2BOHB 3OX7U 1AU8A 1TNIA 1TNJA 1YCPH 2J95A 1P2OA 2F9VA 1P11E 3F9GA 2Z9GA 1BTYA 1KSNA 4GHTA 2FOFA 2W26A 3E16B 4ABBA 4XD7D 2BB4A 4YTAA 2JIZD 6GCHG 1KXAA 4D9RA 4I8HA 1HJAC 4GPGA 1AIXH 4O97A 1UHBA 2I6SA 2C8WB 3Q77A 2VWNA 3ATIA 2SGDE 1MKXH 2GT7A 4WMFA 1ETSH 4F55A 2ZFSA 1EOJA 2KM0A 4NA9H 5T6FA 3QUMP 3SUGA 1AB9C 1TNKA 4A92A 1MTSA 3SI4H 1ZTJA 2HLCA 1ZTKA 1K1MA 1TBZH 1EFRD 1FY3A 5JDUB 2QGRA 1ZGIA 1O33A 3KNXA 5EJ1A 1ACBE 4K8BA 1DY9A 1SFIA 1X7AC 1LPZB 2KCAA 1HBTH 1YCPM 1RXPA 1W3CA 1A0HB 1C9TA 3MFJA 4B75A 1VCQA 2AFQB 2H5DA 3A7VA 1GMHF 1O2GH 1BBRE 1VKYA 3M61U 1L1GA 1EPTA 1JBUH 2HRVA 2Y5HA 2UUYA 1CT4E 1O3JA 1SGIB 2OK5A 6CHAC 2BDBA 3ATLA 1ZPBA 1HXFH 3OFND 3PM3A 2ZA5A 2P95A 3UNSA 1C2MA 1Z8GA 1OWKA 2NU1E 3E3TA 1LDTT 1W11U 5HIZA 2ALVA 1O5EH 2QXHA 1UVUH 3U8OH 1PPCE 2XCNA 4WMEA 1P09A 4X2WA 2VIOA 2YMSD 4UE7H 5B6LA 1QRXA 7LPRA 3GS9A 3F9EA 1GJ5H 3H7TA 1ZSLA 4ISNA 3O8RA 3S9BA 1GJAB 2M5TA 3LOXA 1C5PA 4NWLA 4NG9H 4X2VA 1KXBA 2FESH 3SU0A 1F2SE 2ZIQH 1DY8A 2AGIX 1EASA 4XE4A 4IN1A 2V3HH 3KGPA 3DUXH 2OD3B 4ABHA 1O3MA 2BD2A 2JJ2D 1HAVA 5EJZA 1XXDA 4Y10E 1QBOA 4JYVH 2BLQA 3SZNA 3ELAH 5EW2H 4TSFD 1ETTH 3RXGA 2GCHF 1S6LA 4Y7AA 5B6OA 1TPSA 1GJBB 1A61H 3M3TA 1SGDE 2C4FH 2XBWA 4JCNA 1DDJA 5TJXA 5T1VA 1TPOA 1GJCB 3NWUA 2OLGA 3SJ8A 3NK8A 1SGQE 1DANH 1GBJA 1WYKA 2CJIA 1ZJKA 1CGHA 4BTUB 1BMMH 4INHA 5EPYA 1GL0E 4MVNA 2ZF0H 2KFWA 5C5OA 1SB1H 3IITA 2BD7A 3ZV9A 1C2GA 2FPZA 3M5MA 4OS1A 3T5FH 5CHAB 5C20A 3D65E 1JRSA 1AE5A 1GI9B 3SU6A 2ZDLA 1G37A 2A4QA 2BY5X 3BTGE 3P17H 1GBAA 2HNTF 1RRKA 4BOHA 1ARCA 2PTNA 8GCHF 4GCHG 2BZAA 3Q3XA 2ZKSA 3RXBA 1JXPA 1WAYB 2IJD1 1JWTA 1AD8H 3RLYH 2KCOA 4BXWA 2BX4A 1C5VA 4X8TH 3U1JB 5EW1H 1HPGA 1CQQA 2C93B 1GI1A 2P16A 1CU1A 3ATKA 2XRCA 1A5IA 2XNDD 4JYTA 2V3OH 4JZFH 1OYQA 1F0TA 3M5LA 2ANMH 3IG6B 1HAXB 1OYTH 2QF5A 3BTHE 3PV5A 1KLTA 1TMUH 5E0JA 2B7DH 4K8YA 1NFWA 1O2JA 1Y5BT 1GBKA 2G4UA 2ZU4A 1CT2E 2Y7ZA 3BTKE 4I8KA 3ZZ9A 1CT0E 1LTOA 1S82A 2G5VA 4AZ2B 2RFKC 2WPKS 3P8FA 1E36B 3SU3A 5FPTA 1CA0C 2J38A 1Z6JH 2P8OB 1RGQA 1O3OA 2F9UA 3SI3H 3ZZ7A 3PO1C 3F1SB 4YT7H 1LPGB 3ODFA 2BYAX 2FX6A 2QY0B 2ZCHP 1ELBA 1GJDB 2ZDMA 2I6QA 1CGJE 1ANEA 3LJJA 2ASUB 1C5LH 1T8LA 1J17T 4RKJB 2Q6FA 2B5TB 5DJ7A 1YF4A 4X6OA 1PFXC 2XWBI 2VVVA 3OYPA 1ZLRA 4MNYA 3Q76A 4JK6A 4MNVA 1AFEH 3SGQE 2TIOA 2BXUH 2LPRA 2XC4A 3MYWA 4B1TA 3PMJA 3C27B 3K6ZA 2V0BA 1B0FA 1Z1IA 1G3CA 2VIPA 1NO9H 4YZUA 1JMOH 1W7XH 4M9FA 5I46H 2P94A 3E1XB 1ZOMA 3SO3A 1D6RA 2XXLA 4TWYA 2M2AA 3MHWU 5A8XA 1V2QT 2R3YA 1XKAC 4OGXA 5F8TA 1B0EA 1ZHMA 1EP6A 1F0RA 1Y8TA 2BY6X 2G5NA 1C4U2 1EATA 1OKXA 2CGAA 2KCYA 1ZJDA 2IN2A 1TRYA 1L4DA 3OTJE 1MCVA 1D3DB 4ABDA 2PFEA 2ESTE 1QBNA 3ZV8A 1C2KA 1MTNB 1E1RD 4NIYA 1GCTB 1E35B 2V35A 3RLWH 1BT7A 4NWKA 1ABJH 1SVPA 3MNBA 3QTVH 1FXYA 3EAJA 4AFZA 3BTFE 2AIPA 4DY7B 1K0HA 2UUFB 3M36A 1NESE 5DP8A 3RXJA 1HLTH 5FBEA 1NRPH 1C5YB 5ESBA 3LU9B 1NU9A 1A0LA 4ZKRU 2JH5D 1SGEE 4NIWA 1L2EA 4DURA 4GSOA 1DXWA 5L2YH 1LHEH 1W13U 2ZGJA 3FAOA 2EI7A 3H5CB 4QT8C 2F43B 2XBXA 1AHTH 1MU6B 1V2VT 3FP7E 3ZZ6A 1S6FA 1K2I1 1TGNA 1O36A 1BJUA 4WVPE 1EB2A 3GYMA 2D8WA 3LGYA 1GI5A 1C1OA 1V2PT 2VBCA 4O9VA 4YLQH 5JBCS 2BHGA 3KYFA 1C5ZB 3PWBA 4OS6A 5BPEA 3W1EA 1Z8JB 4MPWA 1RTFB 3UPEA 3UR6A 2EI8A 2O8WA 5FPSA 5E0HA 2G52A 1DXPA 1F0SA 2XW9A 3A8BA 3LH1A 1O2QA 1GBCA 1TX6A 4GAWA 1BMFD 2OXSA 2V6NA 4WY3A 1H8DH 1QJ6B 1VJAU 1TX7A 3Q3KA 4IC6A 4F49A 5EU8A 2CK3D 3T29A 1TE0A 2P3TB 4AGKA 2PTCE 3QN7A 2IPQX 5EQQA 1W12U 1IQEA 3NUMA 3SU1A 1TBRH 4XFQA 1D3QB 1GBMA 1S0RA 1A4WH 1SGFG 3FANA 5E2OA 5LPRA 5HM9A 1FIWA 1V2LT 2XWAA 1H8IH 2FOEA 3P6ZB 3VB7A 2Q1JA 2QYIA 5G4BA 1RFNA 2VIWA 3F9HA 2D26C 5PTPA 3TIUA 3RXRA 1ZHPA 1KXDA 2W7UA 5E2PA 3QGNB 4U01A 5AVDA 1G36A 3H09A 3SGBE 2GTBA 1UK3A 1TOMH 1O34A 1Z8RA 1BMLA 2Q6DA 1YCPK 3HKJB 1C2DA 3ZZAA 3RC5A 3ZZ4A 4Q2KA 2AS9A 1SGYE 3S69A 5CE1A 1S0QA 2PW8H 4MDSA 1O39A 1QJ7B 1S81A 1DICA 1O3EA 1SC8U 2BVXH 2W6ID 3GY4A 3OSYA 1QIXB 1GHBG 3QX5H 2C8ZB 1EJNA 4Z6AH 1H9HE 3PLKA 1OWDA 2XBYA 3LIWA 2ZHQH 1MH0A 1MUEB 2BY9X 1FONA 3RU4E 3SNEA 1XVMA 3UTUH 4ACAA 1IQJA 2VVUA 5ABWA 2Z3CA 1IQNA 3MU8A 2R2MB 1C2FA 1QRWA 2WV5A 1LO6A 1YP9A 3MH7A 2ZDAH 2FS9A 3SNBA 1K1IA 3UQOA 3HK3B 5LPEA 1W0YH 2NU4E 3KQCA 4A1TA 4GHQA 3SNCA 4AYYB 3RMLH 5CHAC 1RTLA 1JIRA 1MD8A 2H9HA 1C1QA 5C1XA 4X6NA 4NFFA 2AH4X 1QL9A 2WPHS 1GHXH 2IJOB 3AASA 1MABB 1DSUA 3K6YA 3E0NB 4D9QA 2Y6TA 1UVOA 2G51A 1LQDB 3N7DA 2PUXB 3OE7D 2UUJB 2OC7A 4H6TA 1BRAA 3V7TA 1QQUA 1O3CA 1YY3A 1LKAA 4ISHH 4OS2A 2BXTH 4FUIA 1SSXA 1SL3A 3WW7A 2PWXA 4Q7YA 5FCKA 2J98B 2WZQA 1A7SA 1TMTH 2OINA 4Q63A 2ZO3H 3A7ZA 1IOEA 3BF6H 4X6MA 1ZGVA 4F48B 3HK6B 1GMCG 1MCTA 4AFUA 2BDYA 1AE8H 2VIQA 2FTMA 2ZTXA 2Y7XA 1PQ8A 1IQMA 1HAPH 1IAUA 2VVCA 1NFUA 2UUKB 1UTJA 3L33A 3QK1A 2AHME 1NFYA 3TJVA 5A8ZA 3LC3A 4BAMB 3TU7H 3QZRA 2TRMA 1J8AA 4E05H 3S9AA 1DWCH 1XXFA 1QJ1B 4B73A 3SJOA 1FN6A 2CMYA 4X1SU 2P8OC 1ELGA 1YLDA 4Z1MD 1H9LB 1C5OH 1GBFA 5GCHF 1O3NA
chains in the Genus database with same CATH topology
4CHAB 3LDXH 1PYTC 1C1PA 1AO5A 4DOQA 3D23A 4OGYA 1UTNA 1DSTA 3LH3A 4Q7XA 1ELVA 1BTZA 3KCGH 2SNVA 1ETRH 3TGKE 3T27A 3FZZA 1PQ5A 1PPFE 1BRBE 1AGJA 5F03A 4KTSA 1UTLM 1GBBA 3ZZBA 1VGCB 1B5GH 4BAQB 1TALA 1W2KH 2TGAA 1ZYOA 1O2UA 3FZDA 4F4OC 3UR9A 1N1LA 1IQKA 1QB9A 2IPHA 1GBDA 1O2PA 2FZZA 1NRRH 5GWZA 1VITF 3RXFA 4X2XA 1XUKA 3BG8A 1BRCE 2G55A 2FOGA 1T8MA 2R0LA 1FIZA 2ZTZA 1LVBA 5HXFA 4HGCA 2QV1A 1YLCA 5DP3A 1Y3XA 1F0UA 2G00A 1ELAA 1GMDF 5LGOA 1MTNC 4K1SA 1GCTC 1K1LA 1ZSKA 1QQ4A 1FY8E 2YNBA 3P8NA 3QLPH 4YOGA 2ZQ1A 1C2HA 3R0FA 1O0DH 1Q31A 2GZ8A 2Y82A 2ILNA 1G9IE 3D62A 1VCPA 1Y3UA 5JBBS 1O2MA 1WBGB 1D9IA 1GVKB 1L4ZA 3K9XB 4SGBE 1O2VA 1SGRE 4NA7A 1FY4A 1HIAB 1GJ7B 1RTKA 1U6QA 3TNSA 4O3UA 1ELEE 2TGPZ 4IS5A 1P03A 4HTCH 2Z3EA 4AB9A 3RXDA 1O2IA 4K5ZA 1PPGE 1AWHB 3M37A 2OBQA 2R2WU 3UUZA 1EJAA 3AW1A 1C5QA 1C1SA 1D3TB 4BTIB 1BUIA 3SQEE 1QA7A 1GHYH 2VJ1A 1E38B 1EXFA 1T8NA 1O5CB 4INLA 3STIA 1GI3A 1SLVB 1AVWA 1QHRB 4A1XA 1Y3VA 2FOCA 3RP2A 2NU2E 1GWAA 1T4UH 1HB0B 4AFSA 5JBTA 4WXVA 1G2MA 3BN9A 1JOUB 4D8NA 1G30B 2OC1A 2A2QH 5FAHA 1SLXB 3VEQB 1T4VH 2AMPA 1AWFH 2TGDA 1LPKB 5I25A 1TYNA 4Q7ZA 1YPGH 3F9FA 1BTHH 2FI3E 2YNAA 1V2JT 1CHOF 2GVFA 2Y80A 4BAOB 4CBOA 1YPEH 2NU3E 3LKWA 3OY6U 1V2NT 4BANB 3DHKH 1BTWA 2BQ7B 2XTTB 2TBSA 1P8VC 1EAUA 3NZIA 1BHXF 2A4GA 3GCNA 5F6MA 3U9AH 4J1YA 1EX3A 1ELFA 3A7XA 1O5AB 1TRNA 1O32A 1V2OT 2CF8H 1CE5A 2STBE 4Y7BA 3LJOA 3PWCA 3SV8A 2OC8A 4JZ1A 4IMQA 3I78A 3TGIE 3KF2A 1O2NA 4TY7A 1GG6B 4BTTB 1QGFA 3SU5A 1GI0A 1P3CA 1V3XA 3IWMA 1JRTA 1H1BA 2ZHEH 1C2EA 1TRMA 5T6GA 1O5FH 1EAXA 1SR5C 3BTTE 2BY8X 4VGCB 5K7RA 1MTWA 3V13A 1GMHG 4X1PU 1NC6A 3A82A 3Q00A 3TH4H 5LH8A 2GX4A 1ZTLA 2SGAA 1H9IE 1Z1JA 1FQ3A 1TABE 5C3NA 3TH2H 4LZ1H 2QF0A 1MBMA 1AUJA 3SU2A 2FEQH 1A2CH 2BDAA 3BEFB 1C5NH 3VPKA 1E37B 3I77A 1D3PB 2NU0E 1C2LA 1DE7H 4D7GA 2CN0H 2A45B 1JIMA 2J94A 4PROA 3GY8A 5EQRA 3VXEH 4I7YH 3U98H 5AFYH 3F68H 2ZGXH 1CHOG 1C4V2 1NS3A 5EXMA 1FPCH 3TITA 3GY2A 1O2HA 7GCHF 2K1QA 3P92A 3SNAA 1OSSA 1MU8B 1Y3WA 1ZMNA 1CBWB 2VINA 3RMNH 8ESTE 4CH2B 4HZHA 4H42U 8LPRA 4BAHB 1UMAH 4A7IB 5HYOA 1GPZA 3SORA 4YOJA 3PMAB 2R3UA 3BTEE 1BRUP 1KXFA 3TK6A 1S5SA 1VCWA 4ISOA 1A0JA 4FUDA 1XMNB 1ZPZA 4CHAC 2PKAA 3SW2B 4INKA 1T7CA 3KQDA 3EA8A 3RXUA 2VU8E 1MBQA 4JMYA 3L6PA 1P01A 3ENSB 1DX5M 2GZ7A 3EA7A 2GCHG 3TK9A 5FCRA 2P3UB 4ZKOU 4AG2A 3TK5A 1BMAA 4KKDA 1GI7B 1O38A 3W94A 4NIVA 1T31A 4YOIA 1VGCC 1AN1E 4CRGA 2JH6D 2P93A 5DKMA 3SUDA 2W3IA 1FZZA 3F6UH 2TGTA 1NROH 1EUFA 1LQEA 4FUCA 1SQOA 1SGNE 1EZQA 5EQSA 3A7YA 5C1UA 2PR3A 1GVLA 2HVXA 2W3KA 1SQTA 4TPIZ 2A4RA 3A85A 2CXVA 4Y6DA 1EP5A 3RXVA 4MQAA 1FLEE 4B2CA 1OP0A 3SNDA 3BV9B 1VZQH 3LPRA 4SGAE 4ZMAH 1ABIH 2W5EA 4KP0A 4AFQA 1ZMLA 2THFB 1O2WA 4NFEA 4ABJA 3RXSA 1C5MD 3MNXA 4FUBA 1G3EA 1V2TT 1AVGH 8GCHG 1AKSB 1QURH 1TWXB 1AVXA 4ABEA 4TYDA 2AGGX 3S7HB 1DUEA 1PQ7A 1QB1A 3SV2H 4BNRA 3A83A 3M3SA 1B7XB 1BJVA 1HGTH 1WTGH 4XDEA 3TJOA 2QC2A 3URCA 3ZVEA 3L3TA 3SN8A 1TONA 2UWOA 2ZQ2A 1LHCH 5HGGA 3UY9A 2K7XA 3LT3A 3VFEA 1ZZZA 1D6WA 1F7ZA 2OCVB 2A31A 3RDZA 3SU4A 1HYLA 2BD3A 2HGTH 4WWYA 4AG1A 1ZRBA 1MTVA 1Z7KA 2HPQH 3RC6A 4UEHH 1ANCA 5DGJA 3VXFH 3HPTB 2ZG0H 1BOQA 3HATH 2AERH 2RG3A 3GISB 1IQIA 4AB8A 2VIDA 1K9OE 3SGAE 1HAGE 1Y5AT 5EPNA 2FDAA 5EG4A 1GI6A 4HFPB 1W7GH 2ODYB 5C2ZA 2JH0D 1QNJA 3G01A 3P70B 4NSYA 3MU1A 3GOVB 2G4TA 9LPRA 4I31A 5DP9A 4IBLH 2PSXA 3EA9A 1G32B 1TA6A 5A2MH 2ZNKH 4JYUH 3ATMA 3RXQA 3BG4B 1O2LA 3GY7A 2H9EH 4Y8YA 1CHGA 2C8XB 2ZFRH 5ETXA 3SOSA 4RSPA 1P9SA 2ZDKA 1W14U 2LIZA 1F5RA 1FMGA 4CR5A 1SOZA 3VGCB 4AOQA 2QIQA 3E90B 3RUOA 1HJ9A 3PLBA 2FO9A 1ZSJA 1UTPA 1CA8B 2J2UA 1THRH 3TH3H 4MPUA 4CBNA 3U69H 1SOTA 4UD9H 1GHAF 3FFGA 1UCYH 1G3DA 2OP9A 2JKHA 1AMHA 2PKSB 4K3JA 1O2TA 4K60A 4E7RG 4ZHAA 1C1RA 2ZZUH 1GGDB 3GY6A 4D7FA 1CVWH 2B8OH 1MMJN 2ZU5A 2STAE 3MNSA 3SV7A 4RKOB 2XBVA 2VB0A 2BVRH 1RIWB 2EI6A 2ZDNA 5JB9S 2FIRH 1GG6C 1MTUA 2QCYA 2JETB 1KXEA 3T25A 2SGPE 3A87A 4RN6A 3GDUA 1KLIH 1HIAA 4Y11E 3RXPA 1YPJH 1BA8B 3ZYEA 2GGVB 1NY22 4VGCC 2J92A 4IGDA 3SHAH 4FVDA 5TCCA 1O2RA 4B76A 3M7TA 1V2MT 1GJ8B 4JZDH 4KGAA 2BOKA 2Y5FA 1TIOA 1SGFA 1DT2A 4X1RU 2ALPA 5CMXH 1O3PB 3EBNA 3RXAA 2A1DB 1QA0A 1IQLA 3MOCA 1L1JA 1ANDA 3AAVA 1XUFA 2RA3A 6ESTA 2C90B 2QXJA 1P10A 2ZHFH 3NKKA 5F8XA 3EE0B 2B9LA 2FWWA 1EZUC 1PPEE 5GJ4B 1FY5A 1KLJH 3UOPA 2CV3A 1TA2A 2UWPA 3ZVCA 1H4WA 4KTUA 2RDLA 1LCYA 1J9CH 2G8TA 1T8OA 2J4IA 3BTQE 2DE8A 3LGTA 1O35A 2FLBH 2QF3A 1TQ7B 3A86A 2BLWA 5EODA 4DIHH 4D76A 1CBWC 1GI4A 2G81E 1BZXE 1EQ9A 1UCYE 1TQ0B 1TPAE 4ZKSU 1SLWB 1HAYB 1XUJA 2ZCKP 2OUAA 3HKIB 3KQEA 4WF8A 4O3TA 4YLUA 1ZPCA 3MH5A 3QZQA 4CREA 4CRCA 2OTVA 4X0WU 3RC4A 1K21H 1WCZA 1GVZA 2ZPQA 3MMGA 1P06A 1D4PB 4Z0KA 1C4Y2 4GUXA 1WQVH 2XNIA 5EXLA 4X8VH 3SJ9A 3JZ2B 1MKWH 3KL6A 2A7JA 3QTOH 1EZSC 5IDKA 2BD9A 1NT1A 3RM0H 2D2DA 1UVTH 1NPMA 1YM0A 2Z9KA 2FOHA 3A80A 4BAKB 3TJUA 1AFQB 4O03A 1BTPA 3P8GA 3UQVA 4UONA 1KTSB 4NZLA 2ZGHA 2BD4A 1SI5H 2EC9H 1V2RT 4Y76A 5GPIB 3RXIA 3OU0A 4UDWH 5DP7A 2Z94A 1OOKB 5DO4H 3KQBA 1XVOA 3EQ0H 2YOLA 3ZVBA 1DWDH 1KY9A 3BEUA 3AW0A 4MTBA 2PGBB 4FUFA 1SG8B 3LGUA 3VB3A 3ODDA 6GCHF 4OS5A 2H1UA 5AFZH 2A5AA 1WSSH 4FVBA 3EYDA 4YM9A 4XBDA 2SGQE 4DGJA 1K1PA 3ZZDA 2FOBA 1WU1A 4AX9H 1C5TA 1OX1A 2O8LA 3RXMA 4FUGA 1SGCA 3ZYDA 4DCDA 1J15A 1THPB 1GDQA 4FXGH 1OWIA 1IQFA 5JBAS 5A0CA 2TPIZ 3GICB 3PYHA 2J9NA 2BY7X 1GJ4H 5H4IB 1IQGA 4IW4E 4LOYH 2ZTYA 1HNEE 1AZZA 1C5RA 4B2AA 3TPIZ 1OP8A 2WPIS 2WYGA 3MU0A 4Y0YE 5T6DA 1ESTA 3A8AA 2ZU3A 1TPPA 1O3AA 1KIGH 1QTFA 2H5CA 1DLEA 1FNIA 5E8EH 4NA8A 3BTWE 3M5OA 3UWJH 3HGNA 5JPMH 4UFGH 4MPVA 1SBWA 1EAWA 1P2MA 2O8MA 3V0XA 3NXPA 1QFKH 1HUTH 2SGEE 1C9PA 5GCHG 3ATWA 3MO6A 1EB1H 3C1KA 1DFPA 5C1YA 1MAXA 2ZECA 3SUEA 4IMZA 5FX5A 1MQ6A 1DWBH 4XBCA 1XKBC 1BCUH 1INCA 1XM1A 1O2XA 4ISIH 3BG4C 3N7OA 2ZWLH 2IOTA 1WUNH 1EKBB 4A1VA 1UK2A 3WY8A 3TVJB 3LGVA 4UFEH 2BQWB 3UNRA 1MZAA 3OY5U 1LVOA 1LKBA 2A5IA 3KEEA 1S84A 4FUJA 1ESAA 3VGCC 3PB1E 3RXTA 4E7NA 1MD7A 1BDAA 1FN8A 2ZCLP 2HNTE 2AYWA 2KAIB 4DT7B 2ZP0H 4B74A 1NRQH 1VITG 3HGPA 3H7OA 3KN2A 3DA9B 3EDXB 4GVUA 1PYTD 2GP9B 5J4SA 2PKSC 1J16A 1FPHH 4FUEA 1GGDC 2O9QA 1TNGA 1AKSA 1QRZA 2VWOA 1C1WH 3B23B 2F9NA 4Y8XA 5SGAE 1FDPA 2Z6BD 3JZ1B 1GMDG 1YPHE 2QXGA 3CENA 1RIWC 1WTHD 2SFAA 2F9OA 7ESTE 2BDGA 2GV7A 1O37A 1OWHA 2A7HA 1TX8A 2A0QB 2JETC 1NRSH 4DG4A 1GHZA 4AORA 4XBBA 1QCPA 2ZI2H 2BD8A 3STJA 1EJMA 1XUGA 1NN6A 4CRFA 2F91A 3BEIB 3RXEA 4E06H 2WINI 1XUHA 1O3IA 3URDA 3RU4D 1CSOE 1UO6A 4KTCA 3GDSA 4OS7A 3MU5A 3T26A 3QDZB 2CHAB 4GCHF 3GY3A 1GHVH 3FVFB 5JB8S 3LC5A 5EOKA 3QGJA 1A5HA 3DT0H 2Z3DA 1C5WB 3S7KB 3CS0A 4WXIA 4XOJA 4LXBH 1TGSZ 3SBKA 2FI4E 4ZH8A 1XX9A 1PQAA 4CR9A 4AN7A 2ZGBH 1TBQH 3SV9A 1NM6A 4A6LA 5DPAA 4UFFH 2O8UA 5DP5A 5AF9H 1BMNH 1V2KT 3ZZCA 1TNLA 2WV4A 3PROA 4WH6A 4CRAA 4X1QU 1GJ9B 1YYY1 3FP8E 3QO6A 2VH0A 1KDQB 1LVYA 1ZRKA 1FV9A 2A5KA 4U2WA 1L1NA 2ZFQH 1EOLA 4AGJA 1AY6H 1HDTH 1DOJA 3MO9A 3M35A 2GMTB 4ABIA 4K69A 2VGCB 2ULLA 3GCHB 1C5SA 5LPFA 5DP4A 3RXOA 5DG6A 1DWEH 3MI4A 5HM2A 1J14A 4ZXYH 4JK5A 5A0BA 1WQSA 3B8JA 1Q2WA 1O30A 1S85A 1VJ9U 1Z6EA 5FX6A 1P02A 2C3SA 3QWCH 2O8TA 1C2JA 3DFLA 3GY5A 4Y79A 5GXPA 1HAOH 2GZ9A 3S9CA 2J34A 2UWLA 5A09A 1AFQC 4TWWA 1TMBH 1ELDE 2HNTC 3E91A 2ODPA 1UTQA 5K0HA 1F92A 1O5GH 1UCYK 3E6PH 3MWIU 1HCGA 1QL7A 4ABFA 1PJPA 2ZEBA 1FI8A 2PGQB 2PLXA 1KYNA 1SGTA 2BDIA 1NTPA 5EGMA 1O2YA 1SPJA 2EA3A 1XUIA 1GCDA 2RCEA 3CP7A 2VNTA 2OQUA 1ANBA 1N6YA 2BMGB 3M3VA 3SJKA 5GDSH 4ASHA 2OBOA 3U8RH 1HV7A 1LMWB 4DJZB 1YPHC 3MNCA 4K2YA 3UREA 4ZKNU 1TNHA 5FBIA 4MNWA 4IN2A 3UOUA 1GBEA 2SNWA 1KXCA 1O3GA 4I33A 2FTLE 1DPOA 2R0KA 2XC5A 3SUFA 1A46H 3TLOA 4ZXXH 1V2ST 4NSVA 1YKTA 1LHGH 3MH6A 5E0GA 2LNCA 1UHBB 3ZVFA 2ZHDA 2ANYA 1HAZB 2Z9IA 1P2KA 4FUHA 1UTKA 1TB6H 1FUJA 3T28A 1C5XB 4Y8ZA 4HI3A 3GCTF 1TFXA 2PSYA 3A8DA 4X8UH 3E0PB 1CGIE 1Y5UT 3TJNA 1IQHA 1DM4B 1UVPA 1UTMA 3M7QA 2FOAA 2DE9A 4X2YA 3RMOH 5FPYA 1BTUA 2GKVE 1FAKH 4K1EA 2RA0A 1LHFH