2AMPA

Crystal structure of porcine transmissible gastroenteritis virus mpro in complex with an inhibitor n1
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
299
structure length
299
Chain Sequence
SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRVINYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSSTDAFSMLAAKTGQSVEKLLDSIVRLNKGFGGRTILSYGSLCDEFTPTEVIRQMYGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of Wide-Spectrum Inhibitors Targeting Coronavirus Main Proteases.
pubmed doi rcsb
source organism Transmissible gastroenteritis virus
molecule tags Hydrolase
molecule keywords 3C-like proteinase
total genus 79
structure length 299
sequence length 299
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2ampA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ampA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ampA01
1AD8H 4OS2A 1JIMA 2PKSC 2BY6X 1JIRA 3ATIA 3E6PH 3RXEA 1MTNB 3BG4B 1UTJA 4X1SU 3E8LA 3K6ZA 2G4TA 1EP5A 1ABIH 1K1NA 1VJAU 2VIDA 5JBAS 1NT1A 1MQ6A 4FU8A 3K6YA 1FY8E 1S5SA 2BY8X 1P01A 1WOFA 3M7TA 1O2MA 2R0KA 3OY6U 1QURH 3KGPA 2P59A 2ZFFH 1BTXA 3GYMA 3LGUA 1C9TA 1SGQE 1OP2A 5JBBS 3RXIA 2F91A 1UTNA 2CF8H 5E2PA 1GCTC 5DP8A 4B2AA 1RD3B 1ORFA 2FPZA 1TX7A 4X8SH 3MU0A 1O0DH 1TX8A 4DG4A 1BBRH 1C5WB 2H5CA 2QAAA 2ZWLH 4UONA 4HGCA 1LHFH 2GT7A 3SU4A 2C8XB 2P95A 1DWDH 1O5BB 1J15A 1C4V2 3EBNA 3H7TA 1T8LA 5CMXH 1K28D 5AFZH 1C5VA 4WMEA 5C5NA 1Y5AT 2W26A 3F9HA 3SJOA 1WQVH 1CA0C 2AGGX 5DP3A 2W7SA 2PHBA 2A5AA 3KQEA 1F0TA 1ARBA 1GI9B 4YOGA 5C1XA 4BAQB 1Z1IA 7GCHF 4ABAA 1O2WA 4MNYA 2FWWA 4MPUA 3RMLH 3FP6E 3MU1A 2FOCA 4E7NA 5AF9H 1LPGB 5AHGH 8LPRA 1G3DA 1Y59T 3A7TA 1GVZA 2ZHQH 2P93A 4NIWA 6CHAC 1D6RA 1Y3YA 1MTWA 1TPSA 3KNXA 3BN9A 3M5OA 3E91A 2FTMA 4AFUA 1EQ9A 2ZI2H 3U9AH 1O2GH 1GBLA 1THPB 1BRAA 3GY7A 3GY4A 1LVMA 2SGDE 1SLWB 4Y71A 3SHAH 1AE8H 1G32B 3QWCH 3P8FA 2GCTC 2XC5A 2Y81A 3QTOH 1H9IE 5EOKA 4FUDA 1C2FA 4DVAU 2JH6D 1D9IA 1LVOA 1V2TT 4WH8A 4B73A 2XTTB 1MKWH 5A09A 1GMDF 4B1TA 3QLPH 1HYLA 1YPMH 1ELVA 3ZVGA 3BTTE 1GBHA 2ZU5A 3U98H 2Z9JA 4WVPE 3QZQA 2GZ7A 4GHQA 4DCDA 1GGDB 1EZUC 3UR6A 5DKMA 4XSKU 1ETRH 1H4WA 1V2WT 3LGVA 1N8OC 1E36B 3MMGA 1SFIA 1HAXB 1DY8A 2JETC 1GWAA 1OWJA 4SGBE 3O8RA 4JZFH 1TPOA 4OS1A 2UUJB 3SV9A 1FI8A 4WXIA 4BANB 2AIQA 1EZQA 3GCTF 3VB5A 4XE4A 4YOIA 2Y5HA 3CP7A 4WXVA 3BG8A 2ODPA 2PR3A 1P8VC 4BOHA 4BXSA 5CHAB 4CRBA 2FLRH 2UWLA 3UPEA 5I25A 3L3TA 1BRCE 4YLQH 1HAGE 5F03A 3LONA 4BAKB 2JH5D 5G4BA 1HV7A 3URDA 3RMOH 4XBBA 1BHXF 1XUKA 4I8KA 3SNAA 3F9FA 3TPIZ 4NIVA 4SGAE 3RMNH 3SU1A 4ABGA 5C3NA 2A45B 4YZUA 4X0WU 5IDKA 2Z3DA 4H6TA 1Y3VA 2OQ5A 5J4SA 3D65E 1KXDA 1KXFA 1UVOA 1ZTKA 3U8OH 4NG9H 3RXGA 4AOQA 5CE1A 4LZ1H 1BMAA 1ZGVA 4MNVA 1O3LA 5EW1H 1K1MA 1NZQH 3QO6A 1MCTA 3PMHB 4ABFA 2VINA 1QL8A 3NZIA 1O3CA 1T31A 2R3UA 3KCGH 1ZPZA 3ZYEA 2Y7XA 2WV5A 2GZ9A 2BQWB 1HFDA 3TIUA 1KLIH 2IOTA 4H42U 1YLDA 1AUTC 2VB0A 1AVXA 1EUFA 3B8JA 5C1UA 1H9HE 2FOAA 4RN6A 4LXBH 1IHTH 4M7GA 3A83A 1LMWB 1XVOA 2AMDA 1ZHRA 3SNCA 7LPRA 1LTOA 1TX6A 2Y80A 4OS5A 1YPHC 2FOGA 3P95A 4ZHAA 2OC8A 3TK9A 3SORA 4OS6A 1YF4A 2B7DH 2HPPH 1G3EA 5EPYA 2OC7A 1UCYE 3RXMA 2PUQH 1FQ3A 1GHAF 2OC0A 5EQQA 1C1TA 1G2LA 4NFEA 5B6OA 3T27A 5EG4A 1ZZZA 2ZF0H 2Z6BD 2G81E 2GMTC 2BDIA 2H9EH 3VB4A 2BHGA 4I31A 2F9OA 1TRMA 1YGCH 2A4QA 3DFJA 4A5TS 3SGQE 1CGJE 1O32A 1GBBA 3ODFA 1C2MA 1TMBH 4K69A 3F6UH 3SU0A 4WMDA 2CHAC 3T5FH 1KYNA 1GHYH 2M5TA 1P09A 1ZHPA 3GDVA 2SGPE 2BLWA 3JZ2B 1ETTH 1IQFA 2ASUB 1IQHA 3SV2H 3K2UA 4KTCA 1C1MA 2O8WA 1UTPA 1ZYOA 3BTHE 3MNSA 1C5LH 3QGJA 2AGIX 2GCHG 1GJBB 4UFFH 2P3FH 2Z3CA 2Z9GA 2NWNA 1RS0A 2FZZA 4DY7B 2A2QH 3BTQE 5K7RA 1P02A 2XC4A 1FLEE 3O8DA 1BBRE 1BTHH 3GCHC 1L4DA 1MD8A 1ZPCA 2H9TH 2OD3B 2FYRA 5T6FA 3KIDU 2XCFA 3BSQA 2OUAA 2ZNKH 1PPCE 7GCHG 1YPJH 1H1BA 1ELGA 4K1SA 1ZSJA 2RG3A 5HM9A 2NU4E 3GYLB 3GDSA 4CREA 1FZZA 3D49H 1TNKA 1LQEA 3NCLA 2R2WU 1D4PB 3ZVCA 1GL0E 1NROH 4CH2B 1C2LA 1NU7B 2FOBA 3RC6A 2CJIA 5JDUB 4UEHH 1GL1A 1ANDA 1QJ6B 1WCZA 1F5RA 1XUJA 2J9NA 4X2VA 4MPWA 2ZU4A 1WBGB 3SN8A 4WMFA 1G37A 3LIWA 2FESH 4WF8A 1O34A 1ESBA 3SHCH 4OS7A 3EQ0H 1Y5BT 3E90B 2OLGA 3KF2A 1ELCA 3I77A 4JZ1A 2XWAA 1A3BH 2H6MA 1ZLRA 3T29A 2A1DB 2O8MA 1LKBA 3UNRA 1HNEE 2Z9KA 2VU8E 1C2DA 1Q31A 2HWLB 1F0UA 2GKVE 1CGHA 1D3TB 1PPBH 3RC5A 1LPZB 1XX9A 2DUCA 5FAHA 1FY5A 2F9UA 5A2MH 2FLBH 1MUEB 1HAVB 1OS8A 1DFPA 3TU7H 3M3SA 1AZ8A 1TYNA 3P70B 1AWFH 3PTNA 1RIWB 4D76A 1TNJA 1H8IH 1W14U 3B9FH 3VB3A 1LHGH 2CHAB 1K21H 2ZDMA 2J94A 4I7YH 2R2MB 4KTUA 2FS9A 3M5NA 7KMEH 2WPHS 1K1LA 3UQVA 4ISNA 2CXVA 3UWIA 2ZU3A 3T28A 2C93B 4MG3A 2BDHA 1NPMA 4GCHG 4B74A 3MTYA 3T25A 1NU9A 3KQCA 1S84A 2EEKA 4ISIH 2ANMH 1SOTA 2A5IA 1MMJN 5EXNA 1K22H 2ZDNA 1JOUB 3NKKA 2OQUA 2J4IA 1G9IE 3MH5A 5DJ7A 1Q2WA 1Z1JA 1EJAA 2P3UB 1O3OA 3Q3XA 2O8LA 1KXEA 4CRDA 1HIAA 1NFUA 1NS3A 2IJOB 4B2CA 2WUBA 5FHTA 3OYPA 1BDAA 3RLWH 2HGTH 1SQAA 1G3CA 1O2XA 1OWDA 3O8CA 1S82A 5PTPA 1A5IA 3R3GB 3ELAH 3ENSB 1VITG 3SZNA 1V2RT 3T62A 4U2WA 4AFSA 1ZPBA 2ZU1A 2QV1A 2BX4A 3GY6A 1GJAB 1O3IA 1UVUH 5L30H 3HKJB 4K5ZA 1NFWA 3RXBA 1OX1A 4YTAA 3SNBA 4DW2U 1W10U 1S6FA 5GCHG 2F9BH 1P2JA 5LPEA 4XDEA 4CRFA 3SUDA 2PTCE 1AY6H 1O2ZA 1IQMA 1O3NA 4UFDH 1KTTB 2XWBI 3VGCC 2OP9A 4X8VH 1CHOG 1ZTJA 2YOLA 1ZSLA 1ZR0A 3PLPA 3U8RH 2BLVA 1SGYE 2C8ZB 3EA9A 3W94A 4U30A 3TGKE 2GD4B 3EYDA 3OX7U 1P03A 5LPFA 5GJ4B 5DP5A 1LVYA 1SG8B 1A61H 1BTWA 2KAIA 3IITA 1TGBA 2ZCHP 2AGEX 4CRCA 3SW2B 1C5XB 5HXFA 4F49A 3LU9B 2UUFB 4X1NU 2ANWA 3BTEE 5DPAA 1A5HA 3MOCA 2ANKH 5A8XA 1H8DH 2BOKA 1UTQA 1A2CH 1P57B 1MKXH 1V2NT 1EB2A 1YPEH 2TPIZ 1ANBA 1LDTT 4LOYH 1EP6A 1WAYB 5EXLA 3LGIA 2BLOA 2BD5A 2Q1JA 1BA8B 1FN8A 4ABHA 2BVRH 6LPRA 3TJNA 9LPRA 1YBWA 2H5DA 1PQ7A 4Y7AA 1DITH 2PW8H 3TLOA 2VH0A 3P8NA 4Y76A 4AGJA 3UNSA 3UWJH 1V2MT 3GCTG 1QBOA 5FBIA 2ZGCA 4TPIZ 1YPLH 2H2ZA 1SPJA 2JETB 3M35A 1HCGA 4IMZA 1NTPA 2FOFA 8KME2 1J17T 2CGAA 2J34A 1TOCB 3MH4A 3PYHA 1EPTA 1GG6C 1O2RA 1SGEE 1V2ST 3A7WA 5DO4H 2SNWA 4FXGH 4TY7A 1FAXA 1C2EA 2XBWA 1VZQH 1B0EA 1MTSA 5ESBA 1HBTH 4NCYA 1ZJKA 4Y0ZE 2A31A 1W11U 4KKDA 5DP6A 1GI2A 1O37A 3UUZA 5IYTA 4RKJB 1O3PB 2QA9E 3TJUA 1QJ1B 2D1JA 2GCTB 3LJOA 1L1JA 2A7CA 3M37A 1W0ZU 2Y5FA 2TGDA 1XXDA 2FI4E 3MO9A 4KGAA 4AYVB 3P6ZB 4K8YA 4ZHLU 2A5KA 1ZMNA 4AG2A 2FOMB 1L1GA 1N6YA 1PPEE 1VJ9U 1BTUA 1CE5A 3I78A 5E2OA 2WPKS 3LGYA 1C1UH 1O36A 3ZZ9A 2ZCLP 1C2JA 1Z6JH 1BQYA 1G36A 1DWBH 2B8OH 4NWKA 1IQKA 1IHSH 2J38A 2V0BA 4X2WA 2Z9IA 2HPQH 2VVVA 2TIOA 1V2VT 2JH0D 1W2KH 3MO6A 4Q7YA 4B71A 2ZDAH 2PGBB 3N7OA 3ZZ8A 2ZO3H 1GJ9B 1GHVH 2ZDKA 4J2YB 5DP7A 1YKTA 4A7IB 2C3SA 4GCHF 1GVKB 2FXRA 1U6QA 1SGNE 3MYWA 4IN1A 2ZC9H 1HRTH 4FUIA 4X6MA 1VCQA 2QXJA 1SC8U 1SLUB 2GGVB 2PWXA 1RTLA 2PV9B 1GMDG 4ZAEA 4FVBA 3SOSA 2WPMS 4GSOA 2G5NA 4ABEA 1UMAH 2GVFA 1Z8GA 2OBQA 1QCPA 2BB4A 3SI3H 3RXHA 4JMYA 3KHVA 3PM3A 2Z9LA 4MNWA 6GCHF 3DD2H 1O3GA 2Y6TA 3E0PB 3IWMA 4BXWA 1ABJH 2HNTE 3GCHB 2EC9H 3AW0A 1AVGH 2FP7B 4Y79A 4GAWA 3ZZ5A 2BXUH 4AORA 4NFFA 1LVBA 1GCTB 1SQTA 1BMNH 2PSYA 1GJ7B 1GHBF 2BD2A 4I8HA 1WTGH 4XBDA 1UO6A 3GCOA 3ZZ3A 1C5ZB 1TONA 1EAXA 4Z6AH 3RXVA 4ISOA 2Y82A 1NFXA 2ZFTA 3LH3A 3ZZ7A 3SUEA 1O33A 3SU5A 3F9GA 1C1VH 3V3MA 2ANYA 3PMAB 3FP8E 3A7YA 2DE8A 1XVMA 4GVUA 4YT7H 3F9EA 3A8BA 5E0GA 1MKXK 1ESTA 4Y0YE 1GHAG 1AIXH 2XCNA 4Y8ZA 1GHBG 2BDBA 1F5LA 2G8TA 4FUEA 2PTNA 4NA9H 4FU7A 4WH6A 3ZZ4A 2ZGJA 1A1RA 4THNH 3ITIA 2QC2A 3T26A 2O8UA 2VIPA 3PMBB 4NZQA 1T8MA 2BTCE 3R0FA 3EA8A 1ELDE 1UVPA 1ZGIA 2FODA 1PYTD 3B23B 2KAIB 2NU0E 1GHZA 1O38A 2LIZA 2GCHF 1O3AA 2UWPA 4F4OC 4BAHB 1BCUH 4UE7H 1MCVA 3DT0H 2ZHWH 1NM6A 2A32A 1IQJA 1GMCG 2V35A 1O2YA 3P92A 3RUOA 1QBVH 1UJ1A 1SGRE 3M61U 1MZDA 4D9RA 2VIWA 2QF3A 1NESE 4Q7XA 3RXRA 4B76A 1TFXA 1J14A 2DE9A 2ODYB 1UK2A 1CVWH 4ABIA 3ODDA 1KLTA 3S69A 1E37B 2AMPA 1CU1A 3Q3YA 4MLFB 4E06H 1GJ5H 1TBZH 4JZDH 1ETSH 2OINA 4WJG2 3AVZA 3ZZBA 5A8YA 4O3UA 1O2JA 4JK6A 1V2UT 2BD8A 2FOEA 2K7XA 3AASA 2VWNA 1C2GA 1NO9H 2VH6A 3K65B 4I8GA 3RP2A 3RU4D 1C5YB 1EX3A 2LNCA 5A0AE 3S7HB 1ID5H 1EPTB 2H1UA 3CS7A 1EOJA 1T8NA 3U8TH 4AB8A 1LPKB 3QN7A 2ZP0H 2A4GA 4D9QA 2GZ8A 1IQIA 3A80A 3RXAA 3A7VA 4TYDA 4OGXA 3SJ9A 1T32A 5TJXA 4X1RU 1P06A 1AFQC 2BD4A 2QXGA 1JRSA 1ZMJA 1YC0A 2JKHA 3V12A 3PLKA 1Z6EA 1GDNA 3BTDE 3EA7A 1NRRH 3LPRA 4DGJA 5GXPA 1THRH 2ZFPH 1O5EH 3TITA 2W3IA 1DVAH 3HGNA 1SR5C 1IQEA 3NUMA 1GG6B 1QBNA 1C5PA 2LPRA 4DT7B 2YNBA 1EOLA 1HXFH 4ABJA 5E8EH 3VEQB 1SGDE 1D3DB 2BD7A 1C1SA 4I8JA 4IS5A 5JBCS 3A86A 1G2MA 1BRUP 1SGTA 2QXIA 3ZVEA 4DOQA 1EAUA 1EKBB 1TALA 3MNBA 1SLVB 3SBKA 2QGRA 2EA3A 3RXDA 1TBQH 1N6XA 3RXOA 3HGPA 1TA2A 3LH1A 6ESTA 1NRQH 2AEIH 4ZKNU 1TA6A 1F5KU 4FUFA 1C1RA 4CR9A 3H5CB 4X6OA 1FY4A 2STAE 4ZKRU 3WY8A 1VITF 1O3JA 1VCPA 5FX6A 3A8DA 1F7ZA 3RMMH 4FUGA 2XBYA 1MD7A 4JK5A 1V6DA 1EPTC 5FCRA 2FO9A 4GHTA 4K2YA 1PFXC 1ZSKA 1QIXB 3BTWE 2GMTB 1SLXB 1FONA 1D6WA 2ZGBH 1PQ5A 1SGPE 5FXLA 3RXQA 3RDZA 5DP9A 5ABWA 1DUAA 3EE0B 1DPOA 3RXCA 1O2LA 1O3EA 4B2BA 1WQSA 1KDQB 1C1WH 1RFNA 2ZCKP 1FPCH 1SGCA 4INKA 4JYUH 2VIQA 2UUYA 1S83A 4H4FA 2BD9A 2ZTXA 1ANCA 1PQ8A 2FX4A 2XYAA 3MHWU 1OP0A 4BAOB 4GPGA 1XMNB 3MH7A 1AB9B 1O5CB 1C2HA 1TOMH 1TGSZ 1TBRH 3UOUA 3TGIE 4XFQA 1OKXA 2BYAX 3E16B 4R8TB 5TCCA 3D23A 4QT8C 1BITA 2ZQ2A 5F8XA 2BY9X 2F3CE 3A8CA 1THSH 3M5MA 1Q3XA 4FU9A 4ZKOU 1O35A 1FPHH 1MTUA 4IBLH 2C4FH 3LC5A 1J16A 3M36A 1GDUA 2ZHFH 4ZH8A 1C5TA 1OP8A 1O2VA 1DOJA 1WSSH 1ELAA 1QTFA 4DURA 1GI7B 2GX4A 2ZFQH 5T3HA 3SUGA 1A0JA 1SQOA 1P10A 3G01A 1SOZA 3M3TA 3GISB 4I8LA 2WYGA 2W3KA 4OS4A 4ZMAH 4YO9A 1BZXE 1HAHH 1CHGA 2FM2A 1QQUA 1C1QA 4MTBA 1GVLA 1S81A 3FZDA 1DANH 5L2YH 3CENA 1HJAC 2ZG0H 2HRVA 4PROA 2HLCA 4HFPB 4OGYA 1EXFA 3GCNA 3MO3A 1S85A 3ESTA 1GJ8B 3FFGA 1RGQA 3FAOA 4IN2A 5HYOA 3TNSA 1RIWC 2O8TA 2VNTA 2XXLA 1O30A 1ZJDA 1AVWA 1J8AA 3GICB 3SGAE 1E0FD 4CBNA 1GI5A 3S9CA 2ZPSA 4XOJA 1YLCA 2G51A 1KXBA 3TK6A 1BTPA 1P3EA 3LOXA 2AYWA 2ODQA 1N8OB 4ZXXH 3TGJE 1GI4A 3HPTB 4RKOB 4X8TH 4B75A 3H7OA 1A3EH 3RM0H 3KN2A 3ZZDA 4NA8A 3LC3A 1E35B 4NGAH 4X8UH 1O2HA 2GDEH 1C4Y2 2AS9A 3M3VA 4A1VA 1KDQA 1K1JA 2ZGXH 3AW1A 1YPHE 3Q76A 4Y6DA 3RXUA 2PSXA 1AI8H 4BAMB 5JYIA 2XBXA 1AGJA 2BZ6H 1P04A 2CN0H 5AFYH 1NRPH 2P3TB 3ZZCA 1QHRB 4INHA 1O3KA 2BDGA 1PJPA 1HAIH 1F0SA 1C5RA 2CV3A 1GI1A 1HAZB 1P12E 3L6PA 4JYVH 3UREA 4NWLA 2EI7A 1XUIA 1CT2E 2G4UA 1OWIA 4CH8B 2GV7A 3V13A 1QA7A 3RXFA 1TGNA 2HNTF 3SU2A 4AFZA 1NY22 1GCDA 2BZAA 1PQAA 2VWOA 1FMGA 2W7UA 4X2XA 1KY9A 1UVSH 3TVJB 2BDYA 2PGQB 5C2ZA 1GJ4H 1QQ4A 1TGCA 1YYY1 3QTVH 3U69H 2GDDA 1CT4E 1UVTH 2ZTYA 3BIVH 3M7QA 5BRRE 1WUNH 2C8WB 1HLTH 3BIUH 1GMHG 4O9VA 5E0JA 3Q77A 1SGIB 4IGDA 3GY2A 3MU4A 2RDLA 5JBTA 3PLBA 1TLDA 2A7HA 3ZZ6A 1P2IA 3M5LA 3QX5H 1OYQA 1TQ0B 1OSSA 1BJVA 1V2JT 3K9XB 3RC4A 1HPGA 1OWEA 1RRKA 2BY7X 4IC6A 1TWXB 3ZZAA 3P17H 2BOHB 4ESTE 1V2KT 1QB9A 4ASHA 1AE5A 5HMAA 4X1PU 1XUHA 2HVXA 3UTUH 1O2TA 2QY0B 3ZVFA 2VVUA 4U01A 2TBSA 4FVDA 4CRGA 1KSNA 4MDSA 1A7SA 1C2KA 2VVCA 1H9LB 2VJ1A 2ZIQH 3GDUA 1K9OE 4ZKSU 3TJOA 1BMLA 5DGJA 3RXLA 3S0NA 4D7GA 5DG6A 1GMCF 3ZV8A 1KXCA 1TAWA 5DK1A 3GY3A 5EXMA 4RSPA 5C1YA 2FIRH 1LKAA 3M7UA 2FDAA 1UHBB 4FUHA 2B9LA 1S0QA 2PFEA 1DT2A 4X2YA 1TMUH 1V2PT 3PWBA 1SGFG 1IOEA 3HK6B 1JWTA 1BHXB 2OCVB 1O2UA 2XBVA 2BX3A 3C27B 5E0HA 3GOVB 1O2QA 1E34B 2G52A 3OY5U 4JYTA 1C9PA 1PPFE 1GJCB 1PYTC 1TB6H 3UQOA 4BTTB 1V3XA 2FI3E 2THFB 3EDXB 2HALA 4NIYA 3ZV9A 2P94A 1O2SA 5C5OA 1GBKA 4TWWA 4X6NA 1QR3E 3FZZA 2NU3E 5EPNA 1BIOA 3SU3A 2V3HH 3MU8A 1A4WH 1O3HA 8GCHF 3RXSA 1UCYK 2SGAA 3SQHE 1TIOA 3A84A 1OWKA 1SGFA 3VGCB 1D3PB 5JPMH 1W13U 2BVSH 3P8OA 2ZPQA 1Y3XA 1QJ7B 1DWEH 4CR5A 3SUFA 3KEEA 1BOQA 5GCHF 1M9UA 1C4U2 2XRCA 5H4IB 2ZFRH 5FCKA 1KTSB 3A89A 4MQAA 1O2PA 1VGCC 1P11E 3JZ1B 1FDPA 1C2IA 4AGKA 3SV7A 1GI6A 3U1IB 3UY9A 1IQGA 4IMQA 2F9VA 2SGEE 1QB6A 1G3BA 2ZDVH 3VXFH 3BEIB 4AG1A 1AKSB 3UNQA 1Z8RA 1EAIA 4BTIB 1DWCH 2WV4A 2ZGHA 4VGCC 1QFKH 1RTFB 3OTJE 2ZHDA 3QGNB 4GLYA 1CBWC 1TQ7B 3SJKA 1DY9A 4NSVA 1YCPH 1P9UA 1DSTA 1FJSA 1MTNC 1LHDH 1K1OA 1KLJH 3S9BA 2WINI 1BBRK 1T4UH 1K1PA 3QZRA 4K3JA 3V7TA 3LKWA 2IPHA 2PUXB 4IW4E 1HJ8A 1UK3A 3PO1B 1N1LA 1CGIE 1UTOA 1LHCH 2GV6A 2QN5T 1RTKA 3KQBA 4MVNA 1W8BH 5J4QA 4A1XA 2YNAA 3SQEE 2K1QA 1UTMA 2A4OA 1SI5H 2BMGB 4NA7A 1G30B 5HGGA 3FANA 2Y7ZA 3VFEA 2WPJS 2PLXA 3RU4E 5AVDA 1TPPA 1EZSC 1O2KA 3F1SB 5BPEA 3MNXA 1C5QA 1AU8A 4UFEH 3PO1C 4I33A 1YM0A 2ZTZA 5K0HA 4INLA 3SGBE 2ESTE 3Q00A 2FEQH 5L2ZH 4BNRA 1SSXA 1HIAB 5A0CA 1TGTA 1F2SE 2P8OB 1GBFA 4CRAA 4AZ2B 1HAOH 3STIA 5JB8S 3BEFB 1UTKA 3W95A 2ALVA 1O3MA 1SMFE 2G5VA 1WV7H 5I46H 1QNJA 4O03A 4VGCB 2BY5X 1O2OA 1YCPK 2FTLE 3OSYA 2TGAA 1PPGE 1CO7E 4CHAB 1C5OH 2VGCC 4KELA 5FX5A 1OYTH 3PTBA 1GBIA 2VWLA 1XKBC 1B7XB 1C1NA 1CQQA 3SNDA 1GBJA 4FUBA 1T4VH 1GI8B 1ELFA 2GTBA 1BRBE 6GCHG 2NU2E 1AN1E 2STBE 1EASA 4UD9H 1DXWA 1FY3A 5GWZA 2J95A 1DLKB 3U1JB 2ZHEH 5A8ZA 2VIOA 4K1TA 1BB0B 4DJZB 2ZPRA 2A2XH 3A7ZA 4WWYA 2SGQE 3SV8A 3MI4A 3BV9B 3ZYDA 1O2NA 3GY8A 5EODA 2NU1E 2C90B 3EAJA 1WYKA 2QXHA 3LT3A 1YPGH 3KL6A 1AKSA 1FV9A 1PPHE 2BM2A 3TNTA 1IQNA 5EW2H 1TE0A 2F9PA 3PROA 4Y8XA 1IQLA 3URCA 1SVPA 1AQ7A 4A1TA 1OOKB 3RXTA 4A92A 3A8AA 2ZFSA 5F8TA 1DS2E 1HAPH 1KIGH 2ILNA 1EJNA 1A5GH 2XC0A 3PWCA 5T6GA 4BTUB 2V3OH 1GBTA 1GGDC 3E3TA 2OBOA 1O39A 3VB7A 2UUKB 1EJMA 3BTGE 2GP9B 1MH0A 3F68H 1HUTH 1ELEE 1DXPA 3AAVA 3I29A 4UDWH 1YPKH 1TRNA 1BT7A 5LGOA 1SHHB 4TY6A 3E0NB 4U32A 1A0LA 1QGFA 2V6NA 4MPXA 2HNTC 1P9SA 2VGCB 4CHAC 1AHTH 1GHWH 1P2QA 3RXJA 3RXPA 5L6NH 3QUMP 2QIQA 3D62A 3A7XA 3MH6A 1ZRKA 1O5GH 1CHOF 1C1PA 4UFGH 2ZDLA 1MTVA 1DLEA 1F0RA 2F83A 3NWUA 3PB1E 2CMYA 2QCYA 5GDSH 6CHAB 1L4ZA 1LQDB 1T8OA 4Z0KA 5GIBA 2ZECA 1QRWA 4X1QU 1QY6A 3ATMA 3BTFE 5EQRA 1ACBE 2XW9A 4HI3A 2D26C 2QYIA 1JBUH 4GUXA 1O5AB 2J2UA 1QB1A 4Q2KA 2BXTH 1S6HA 1Y3UA 3ATKA 1W7XH 2BVXH 2OC1A 2F9NA 1XKAC 1CA0B 1SL3A 1HJ9A 1FAKH 1DX5M 4ZHMU 1LCYA 3TH4H 4X6PA 5LPRA 1C5MD 1Z8JB 3E1XB 4K8BA 2W5EA 1IAUA 4K1EA 1JXPA 1FIZA 1MBMA 3GY5A 5DP4A 2GT8A 2CF9H 1NRSH 4JZEH 2C8YB 1Z71A 4KTSA 1K2I1 1TNIA 2ZA5A 4NZLA 1S0RA 2TGPZ 1V2QT 2I6QA 3MWIU 1GBEA 4LK4A 2EI8A 2FOHA 1P3CA 3FVFB 3FP7E 2RCEA 3A88A 3A82A 5F6MA 2AH4X 3LDXH 3SI4H 1W3CA 1HB0B 3UIRA 1UTLM 3V0XA 3UR9A 1LHEH 1DUEA 1BTYA 1MQ5A 3BTKE 5EU8A 1MAYA 1QRZA 1AO5A 3SU6A 2IN2A 3ATWA 2R3YA 1D3QB 5FBEA 2A7JA 2OTVA 3EGKH 3KQDA 1O5DH 5CHAC 1B5GH 5ESTE 4ABBA 1ZHMA 4AYYB 3BG4C 1MAXA 4I32A 5C20A 1CSOE 1P2MA 5F8ZA 2PKAB 2Y5GA 2P8OC 1V2OT 1MU8B 2FS8A 2ZKSA 1RXPA 3ZVAA 2AFQB 2ZZUH 5ETXA 1UCYH 4YT6H 3LGTA 4HTCH 1SHYA 4ISHH 1GBMA 2EI6A 1OXGA 3BF6H 2SGFE 1P2OA 1HXEH 1WTHD 2Q6DA 1C1OA 3TH3H 2H9HA 2UWOA 1W0YH 3C1KA 2FMJA 2VWMA 4MPVA 3CS0A 3TJVA 2AMQA 1MBQA 3DFLA 1HJAB 1TNLA 3T2NA 1JRTA 4AN7A 4IC5A 3SJIA 4JZIA 1GDQA 1DSUA 3RU4T 3SJ8A 1LO6A 2A4RA 2FI5E 1K1IA 1ZMLA 3A87A 1ARCA 4D7FA 3S7KB 3HKIB 3OU0A 1SBWA 2HOBA 2AERH 3ZVBA 2R9PA 1AWHB 2OXSA 1HDTH 1W7GH 4ABDA 1XXFA 2Z7FE 9ESTA 1Y5UT 1T7CA 1QA0A 2VIVA 3MNCA 3RM2H 3STJA 3MFJA 1AUJA 1CBWB 5T6DA 3BEUA 4DIIH 4Q7ZA 1NFYA 1BJUA 1EATA 4TWYA 3MU5A 2ZU2A 4KP0A 4YM9A 1EZXC 1TNHA 5SGAE 2FYQA 4J1YA 2WUCA 1CT0E 3RLYH 4MNXA 1CA8B 1VGCB 3SO3A 1BMMH 3DA9B 2Q6GA 2D2DA 1P0SH 1HGTH 1WU1A 3L33A 3QDZB 4YESB 5EGMA 4AFQA 1OWHA 2BD3A 1FIWA 1AB9C 4E05H 1MU6B 4WY3A 2SNVA 3NK8A 4AB9A 2I6SA 3S9AA 3HK3B 1TNGA 1ZTLA 4ISLA 4Y7BA 3UOPA 1V2LT 4XBCA 1VITH 3PMJA 3PV4A 1GBDA 4YOJA 1QL7A 1UK4A 2FX6A 4O97A 1ANEA 1ELBA 2WPIS 1VR1H 2AIPA 3AAUA 1F92A 2ULLA 2BQ7B 1A46H 3NXPA 3VPKA 4NSYA 4Y10E 1GPZA 2Z3EA 4NIXA 2G55A 1Y8TA 4CBOA 1HAVA 3SV6A 1XUGA 7ESTE 2ZEBA 1O3FA 5A0BA 1P2KA 3SNEA 2Z94A 2R0LA 1ZOMA 1VCWA 4Y8YA 2BQ6B 4ZUHA 1NRNH 3UFAA 1O2IA 3ZVDA 5GPIB 1MKWK 2G00A 3DUXH 4FUJA 1DDJA 2BDCA 2P16A 2RA3A 2Q6FA 3VXEH 4R0IA 1DE7H 1GJ6A 3A81A 1ZRBA 1HAYB 4D8NA 1EAWA 2B0FA 2PKSB 1KXAA 5FPTA 3LJJA 3TK5A 1C5UA 1MZAA 1O3DA 1YCPM 8GCHG 1GI3A 1ESAA 1E38B 1L1NA 1FUJA 1GBCA 3DHKH 1C5SA 4ZXYH 1SB1H 1FNIA 1GBAA 1ELTA 5C67A 1TABE 1AZZA 4YLUA 1NC6A 1QL9A 2D8WA 2BDAA 1X7AC 1FY1A 1P05A 2J92A 3LGWA 4LZ4B 1DM4B 1AFQB 1TRYA 3ATLA 1JMOH 1Z8IB 3RXKA 1Z7KA 2RA0A 2TRMA 2B5TB 1UHBA 3NPSA 1FXYA 1BUIA 1L0ZA 3VB6A 1B0FA 5HM2A 1YP9A 4O3TA 4JCNA 3Q3KA 4ZROA 2QF0A 5FPYA 5EQSA 4Y11E 2O9QA 5LH8A 3IG6B 3P8GA 1O5FH 3TH2H 3O8BA 2BLQA 1XM1A 1INCA 3QK1A 1RJXB 1DICA 2A0QB 1GHXH 1A0HB 4AX9H 2PKAA 1W12U 5TCAA 3BTME 1BTZA 2WYJA 1P2NA 4H6SB 3HATH 4HZHA 1O31A 1QRXA 2WPLS 1TMTH 1OPHB 4E7RG 5JB9S 1L2EA 1AMHA 2ZQ1A 2TGTA 4Q80A 4FUCA 1FN6A 1AFEH 1J9CH 5FPSA 1GJDB 2XNIA 1SFQB 1TPAE 1Y3WA 1PPZA 1GI0A 4A6LA 2SFAA 8ESTE 4K60A 1EB1H 1GMHF 1C5NH 3A85A 4DIHH 1XUFA 2ALPA 4TPYA 1O3BA 1NN6A
chains in the Genus database with same CATH superfamily
1AD8H 4OS2A 1JIMA 2PKSC 2BY6X 1JIRA 3ATIA 3E6PH 3RXEA 1MTNB 3U28C 3BG4B 1UTJA 4X1SU 3E8LA 3K6ZA 2G4TA 1EP5A 1ABIH 1K1NA 1VJAU 3OTPA 3SZEA 2VIDA 5JBAS 1NT1A 1MQ6A 4FU8A 3K6YA 1FY8E 1S5SA 2BY8X 1P01A 1WOFA 3M7TA 1O2MA 2R0KA 3OY6U 1QURH 3KGPA 2P59A 2ZFFH 1BTXA 3GYMA 3LGUA 1C9TA 1SGQE 1OP2A 2JIZD 5JBBS 1SQRA 3RXIA 2F91A 1UTNA 2CF8H 5E2PA 1GCTC 5DP8A 4B2AA 1RD3B 1ORFA 2FPZA 1TX7A 4X8SH 3MU0A 1O0DH 1TX8A 4DG4A 1BBRH 1C5WB 2H5CA 2QAAA 2ZWLH 4UONA 4HGCA 1LHFH 2GT7A 3SU4A 2C8XB 2P95A 5DN6D 1DWDH 5CDFE 1O5BB 1J15A 3AK5A 1C4V2 4OM9A 3EBNA 3H7TA 1T8LA 5CMXH 1K28D 5AFZH 1C5VA 2YMSB 3UAIC 4Q63A 1YLNA 4WMEA 5C5NA 4RI0A 1Y5AT 2W26A 3F9HA 3SJOA 1WQVH 1CA0C 2AGGX 5DP3A 2W7SA 2PHBA 2A5AA 3KQEA 1F0TA 1ARBA 1GI9B 4YOGA 5C1XA 4BAQB 1Z1IA 2KR7A 7GCHF 4ABAA 1O2WA 4MNYA 2FWWA 4MPUA 3RMLH 3F2GA 3FP6E 3MU1A 2FOCA 4E7NA 5AF9H 1LPGB 5AHGH 8LPRA 1G3DA 1Y59T 3A7TA 1GVZA 2ZHQH 2P93A 4NIWA 3OFND 6CHAC 1D6RA 1Y3YA 1MTWA 1TPSA 3KNXA 3BN9A 3M5OA 3E91A 2FTMA 4AFUA 1EQ9A 4XD7D 3GS9A 2ZI2H 3U9AH 1O2GH 1GBLA 1THPB 1BRAA 3GY7A 3GY4A 1LVMA 2SGDE 1SLWB 4Y71A 3SHAH 1AE8H 1G32B 3QWCH 3P8FA 2GCTC 2XC5A 2Y81A 3QTOH 1H9IE 5EOKA 4FUDA 1C2FA 4DVAU 2JH6D 3H09A 1D9IA 1LVOA 1V2TT 4WH8A 4B73A 2XTTB 1MKWH 5A09A 1GMDF 4B1TA 3QLPH 1HYLA 4M9FA 1YPMH 1ELVA 3ZVGA 3BTTE 1GBHA 2ZU5A 3U98H 2Z9JA 4WVPE 5CHBA 3QZQA 2GZ7A 4GHQA 4DCDA 1GGDB 1EZUC 3UR6A 5DKMA 4XSKU 1ETRH 1H4WA 1V2WT 3LGVA 1N8OC 1E36B 3MMGA 1SFIA 1HAXB 1DY8A 2JETC 1GWAA 1OWJA 4SGBE 3O8RA 4JZFH 1TPOA 4OS1A 2UUJB 3SV9A 1FI8A 4WXIA 4BANB 2AIQA 1EZQA 3GCTF 3VB5A 4XE4A 4YOIA 2Y5HA 3CP7A 4WXVA 3BG8A 2ODPA 2PR3A 1P8VC 4BOHA 4BXSA 5C94A 5CHAB 4CRBA 2FLRH 2UWLA 3UPEA 1VKYA 5I25A 3L3TA 1BRCE 4YLQH 1HAGE 5F03A 3LONA 4BAKB 2JH5D 5G4BA 1HV7A 3URDA 3RMOH 4XBBA 1BHXF 1XUKA 4I8KA 3SNAA 2QE7D 3F9FA 3TPIZ 4NIVA 4SGAE 3RMNH 3SU1A 4ABGA 5C3NA 2A45B 4YZUA 4X0WU 5IDKA 2Z3DA 4H6TA 1Y3VA 2OQ5A 5J4SA 3D65E 5EIYA 3KQ5A 1KXDA 1KXFA 1UVOA 1ZTKA 3U8OH 4NG9H 3RXGA 3N7EA 4AOQA 5CE1A 4LZ1H 1BMAA 1COWD 1ZGVA 4MNVA 1O3LA 5EW1H 1K1MA 1NZQH 3QO6A 1MCTA 3PMHB 4ABFA 2VINA 1QL8A 3NZIA 1O3CA 1T31A 2R3UA 3KCGH 1ZPZA 3ZYEA 2Y7XA 2WV5A 2GZ9A 2BQWB 1HFDA 5KEDA 3TIUA 1KLIH 2IOTA 4H42U 1YLDA 1AUTC 2VB0A 1AVXA 1EUFA 3B8JA 5C1UA 1H9HE 2FOAA 4RN6A 3F3BA 4LXBH 3KYFA 1IHTH 4M7GA 3A83A 1LMWB 1XVOA 2AMDA 1ZHRA 4RT1A 3PV5A 3SNCA 7LPRA 1LTOA 1TX6A 2Y80A 4OS5A 1YPHC 2FOGA 3P95A 4ZHAA 2OC8A 3TK9A 3SORA 4OS6A 1YF4A 2B7DH 2HPPH 1G3EA 5EPYA 2OC7A 1UCYE 3RXMA 2PUQH 4AC9A 1FQ3A 1GHAF 2OC0A 5EQQA 1C1TA 1G2LA 4ACAA 4NFEA 5B6OA 3T27A 1S6LA 5EG4A 1ZZZA 2ZF0H 2Z6BD 2G81E 2GMTC 1SKYE 2BDIA 2H9EH 3VB4A 2BHGA 4I31A 2F9OA 1TRMA 1YGCH 2A4QA 3DFJA 4A5TS 1OHHD 3SGQE 1CGJE 1O32A 1GBBA 3ODFA 1C2MA 1TMBH 4K69A 2L6OA 3F6UH 3SU0A 4WMDA 2CHAC 3T5FH 1KYNA 1GHYH 2M5TA 1P09A 1ZHPA 3GDVA 2LP6A 2SGPE 2BLWA 3JZ2B 1ETTH 1IQFA 2ASUB 1IQHA 3SV2H 3K2UA 4KTCA 1C1MA 2O8WA 1UTPA 1ZYOA 3BTHE 3MNSA 1C5LH 3QGJA 2AGIX 2GCHG 1GJBB 4UFFH 2KCOA 2P3FH 2Z3CA 2AHME 2Z9GA 2NWNA 1RS0A 2FZZA 4DY7B 2A2QH 3BTQE 3OAAD 5K7RA 1P02A 2XC4A 1FLEE 3O8DA 1BBRE 1BTHH 3GCHC 1L4DA 1MD8A 1ZPCA 2H9TH 2EY4C 2FYRA 2OD3B 5T6FA 3KIDU 2XCFA 3BSQA 2OUAA 2ZNKH 1PPCE 7GCHG 1YPJH 1H1BA 1ELGA 4K1SA 1ZSJA 2RG3A 5HM9A 2NU4E 3GYLB 3GDSA 4CREA 1FZZA 5B6LA 3D49H 1TNKA 1LQEA 3NCLA 2R2WU 1D4PB 3ZVCA 1GL0E 1NROH 4CH2B 1C2LA 1NU7B 2FOBA 3RC6A 2CJIA 5JDUB 4UEHH 1GL1A 1ANDA 1QJ6B 1WCZA 1F5RA 1XUJA 2J9NA 4X2VA 4MPWA 2ZU4A 1WBGB 3SN8A 4WMFA 1G37A 3LIWA 2FESH 4WF8A 1O34A 1ESBA 3SHCH 4OS7A 3EQ0H 3F0OA 1Y5BT 3E90B 2OLGA 3KF2A 1ELCA 3I77A 4JZ1A 2XWAA 1A3BH 2H6MA 1ZLRA 3T29A 2A1DB 2O8MA 1LKBA 3UNRA 1HNEE 2Z9KA 2VU8E 1C2DA 1Q31A 2HWLB 1F0UA 2GKVE 1CGHA 1D3TB 1PPBH 3RC5A 1LPZB 1XX9A 2DUCA 5FAHA 1FY5A 2F9UA 5A2MH 2FLBH 1MUEB 3WWFA 1HAVB 1OS8A 1DFPA 3TU7H 3M3SA 1AZ8A 1TYNA 3P70B 1AWFH 3PTNA 1RIWB 4D76A 1TNJA 2KCPA 1H8IH 1W14U 3B9FH 3VB3A 1LHGH 2CHAB 1K21H 2ZDMA 2J94A 4I7YH 2R2MB 4KTUA 2FS9A 3M5NA 7KMEH 2WPHS 1K1LA 3UQVA 4ISNA 2CXVA 3UWIA 2ZU3A 3T28A 2C93B 4MG3A 2BDHA 1NPMA 4GCHG 4B74A 3MTYA 3T25A 1NU9A 3KQCA 1S84A 2EEKA 4ISIH 2ANMH 1SOTA 2A5IA 1MMJN 5EXNA 1K22H 2ZDNA 1JOUB 3NKKA 2OQUA 2J4IA 1G9IE 3MH5A 5DJ7A 3NRLA 1Q2WA 1Z1JA 1EJAA 2P3UB 1O3OA 3Q3XA 2O8LA 1KXEA 4CRDA 1HIAA 1NFUA 2GJGA 1NS3A 2IJOB 4B2CA 2WUBA 5FHTA 3OYPA 1BDAA 3RLWH 2HGTH 1SQAA 1G3CA 1O2XA 1OWDA 3O8CA 1S82A 5PTPA 1A5IA 3R3GB 3ELAH 3ENSB 1VITG 3SZNA 1V2RT 3T62A 3PV2A 4U2WA 4AFSA 1ZPBA 2ZU1A 2QV1A 2BX4A 3GY6A 1GJAB 1O3IA 1UVUH 5L30H 3HKJB 4K5ZA 1NFWA 3RXBA 1OX1A 4YTAA 3SNBA 4DW2U 1W10U 1S6FA 5GCHG 2F9BH 1P2JA 5LPEA 4XDEA 4CRFA 3SUDA 5HIZA 2PTCE 1AY6H 1O2ZA 1IQMA 1O3NA 4UFDH 1KTTB 2XWBI 3VGCC 2OP9A 4X8VH 1CHOG 1ZTJA 2YOLA 1ZSLA 1ZR0A 3PLPA 3U8RH 2BLVA 1SGYE 2C8ZB 3EA9A 3W94A 4U30A 3TGKE 2GD4B 3EYDA 3OX7U 1P03A 5LPFA 5GJ4B 5DP5A 1LVYA 1SG8B 1A61H 1BTWA 2KAIA 3EE7A 3IITA 1TGBA 2ZCHP 2AGEX 3W1EA 4CRCA 3SW2B 1C5XB 5HXFA 4F49A 3LU9B 2UUFB 4X1NU 2ANWA 3BTEE 5DPAA 1A5HA 3MOCA 2ANKH 5A8XA 1H8DH 2BOKA 1UTQA 1A2CH 1P57B 1MKXH 1V2NT 1EB2A 1YPEH 2TPIZ 1ANBA 1LDTT 4LOYH 1EP6A 1WAYB 5EXLA 3LGIA 2BLOA 2BD5A 2Q1JA 1BA8B 4ZCNA 1FN8A 4ABHA 2BVRH 6LPRA 3TJNA 9LPRA 1YBWA 2H5DA 1PQ7A 4Y7AA 1DITH 2PW8H 1MABB 3TLOA 2VH0A 3P8NA 4Y76A 4AGJA 3UNSA 3UWJH 1V2MT 3GCTG 1QBOA 5FBIA 3PRDA 2ZGCA 4TPIZ 1YPLH 2H2ZA 2M2AA 1SPJA 2JETB 3M35A 1HCGA 4IMZA 1NTPA 2FOFA 2IJD1 8KME2 1J17T 2CGAA 2J34A 1TOCB 3MH4A 5HIYA 3PYHA 1EPTA 1GG6C 1O2RA 1SGEE 1V2ST 3A7WA 5DO4H 2SNWA 4FXGH 4TY7A 1FAXA 1C2EA 2XBWA 1VZQH 1B0EA 2W6JD 1MTSA 5ESBA 1HBTH 4NCYA 1ZJKA 4Y0ZE 2A31A 1W11U 4KKDA 5DP6A 1GI2A 1O37A 3UUZA 5IYTA 4RKJB 1O3PB 2QA9E 3TJUA 1QJ1B 2D1JA 2GCTB 3LJOA 2F4LA 1L1JA 2A7CA 3M37A 1W0ZU 2Y5FA 2TGDA 1XXDA 2FI4E 3MO9A 4KGAA 4AYVB 3P6ZB 4K8YA 4ZHLU 2A5KA 1ZMNA 4AG2A 2FOMB 1L1GA 1N6YA 1PPEE 1VJ9U 1BTUA 1CE5A 3I78A 5E2OA 2WPKS 3LGYA 1C1UH 1O36A 3ZZ9A 2ZCLP 1C2JA 1Z6JH 1BQYA 1G36A 1DWBH 2B8OH 4NWKA 1IQKA 1IHSH 2J38A 2V0BA 4X2WA 2Z9IA 2HPQH 2VVVA 2TIOA 1V2VT 2JH0D 1W2KH 3MO6A 4Q7YA 4B71A 2ZDAH 2PGBB 3N7OA 3ZZ8A 2ZO3H 1GJ9B 1GHVH 2ZDKA 4J2YB 3OEHD 5DP7A 1YKTA 4A7IB 2C3SA 4GCHF 1GVKB 2FXRA 1U6QA 1SGNE 3MYWA 4IN1A 2ZC9H 2RFKC 1HRTH 4FUIA 4X6MA 1VCQA 2QXJA 1SC8U 1SLUB 1NBMD 2GGVB 2PWXA 1RTLA 2PV9B 1GMDG 4ZAEA 4FVBA 2F43B 2WPMS 3SOSA 4GSOA 2G5NA 4ABEA 1UMAH 2GVFA 1Z8GA 2YMSC 2OBQA 1QCPA 2BB4A 3SI3H 3RXHA 4JMYA 3KHVA 3PM3A 2Z9LA 4MNWA 6GCHF 3DD2H 1O3GA 2Y6TA 3E0PB 3IWMA 4BXWA 1ABJH 2HNTE 3GCHB 2EC9H 3AW0A 1AVGH 2FP7B 2L74A 4Y79A 4GAWA 3ZZ5A 2BXUH 4AORA 4NFFA 1LVBA 1GCTB 1SQTA 1BMNH 2PSYA 1GJ7B 1GHBF 2BD2A 4I8HA 1WTGH 4XBDA 1UO6A 3GCOA 3ZZ3A 1C5ZB 1TONA 1EAXA 4Z6AH 3RXVA 4ISOA 2Y82A 1NFXA 2ZFTA 2JDID 2XNDD 3LH3A 3ZZ7A 3SUEA 1O33A 3SU5A 3F9GA 1C1VH 3V3MA 2ANYA 3PMAB 2WSSD 3FP8E 3A7YA 2DE8A 1XVMA 4GVUA 4YT7H 3F9EA 3A8BA 5E0GA 1MKXK 1ESTA 4Y0YE 1GHAG 1AIXH 2XCNA 4Y8ZA 1GHBG 2BDBA 1F5LA 2G8TA 4FUEA 2PTNA 4NA9H 4FU7A 4WH6A 3ZZ4A 2ZGJA 1A1RA 4THNH 3ITIA 2QC2A 3T26A 2O8UA 2VIPA 3PMBB 4NZQA 1T8MA 2BTCE 3R0FA 3EA8A 1ELDE 1UVPA 1ZGIA 2FODA 1PYTD 3B23B 2KAIB 2NU0E 5KGOA 3VG8A 1GHZA 1O38A 2LIZA 2GCHF 1O3AA 2UWPA 4F4OC 4BAHB 1BCUH 4UE7H 1MCVA 3DT0H 2ZHWH 4TT3D 1NM6A 2A32A 1IQJA 1GMCG 2V35A 1O2YA 3P92A 3RUOA 1QBVH 1UJ1A 1SGRE 4P02A 3M61U 1MZDA 4D9RA 2VIWA 2QF3A 1NESE 3N7DA 4Q7XA 3RXRA 4B76A 1TFXA 1J14A 2DE9A 2ODYB 2KCYA 1UK2A 1CVWH 4ABIA 2J97A 1KLTA 3ODDA 1E37B 2AMPA 1CU1A 3S69A 3Q3YA 4MLFB 4E06H 1GJ5H 1TBZH 4JZDH 1ETSH 2OINA 4WJG2 2CK3D 3AVZA 3ZZBA 5A8YA 4O3UA 1O2JA 4JK6A 1V2UT 2BD8A 2FOEA 2K7XA 3AASA 2VWNA 1C2GA 1NO9H 2VH6A 3K65B 3FKSD 4I8GA 3RP2A 3RU4D 1W0KD 1C5YB 1EX3A 2LNCA 5T1VA 5A0AE 3S7HB 1ID5H 1EPTB 2H1UA 3CS7A 1EOJA 1T8NA 3U8TH 4AB8A 4I86A 2XOKD 1LPKB 3QN7A 2ZP0H 2A4GA 4D9QA 2GZ8A 1IQIA 3A80A 3RXAA 3A7VA 4TYDA 4OGXA 5IK2D 3SJ9A 1T32A 5TJXA 4X1RU 1P06A 1AFQC 2BD4A 2QXGA 4HG6A 1JRSA 1ZMJA 1YC0A 2JKHA 3V12A 1EFRD 1Z6EA 3PLKA 1GDNA 3BTDE 3EA7A 1NRRH 3LPRA 4DGJA 5GXPA 1THRH 2ZFPH 1O5EH 3TITA 2W3IA 1DVAH 3HGNA 1SR5C 1IQEA 3NUMA 1GG6B 1QBNA 1C5PA 2LPRA 4DT7B 2YNBA 1EOLA 1HXFH 4ABJA 5E8EH 3VEQB 1SGDE 1D3DB 2BD7A 1C1SA 4I8JA 4IS5A 5JBCS 3A86A 1G2MA 1BRUP 1SGTA 2QXIA 3ZVEA 4DOQA 1EAUA 1EKBB 1TALA 3MNBA 1SLVB 3SBKA 2QGRA 2EA3A 3RXDA 1TBQH 1N6XA 3RXOA 3HGPA 1TA2A 3LH1A 6ESTA 2EQNA 1NRQH 2AEIH 4ZKNU 1TA6A 1F5KU 4FUFA 1C1RA 4CR9A 2J98A 3H5CB 4X6OA 1FY4A 2STAE 4ZKRU 3WY8A 1VITF 1O3JA 1VCPA 5FX6A 3A8DA 1F7ZA 3RMMH 4FUGA 2XBYA 1MD7A 4JK5A 1V6DA 1EPTC 5FCRA 2FO9A 4GHTA 4K2YA 1PFXC 1ZSKA 1QIXB 2IPQX 2GMTB 1SLXB 3BTWE 1FONA 1D6WA 2ZGBH 1PQ5A 1SGPE 5FL7D 5FXLA 3RXQA 3RDZA 5DP9A 5ABWA 1DUAA 3EE0B 1DPOA 3RXCA 4B6EA 1O2LA 1O3EA 4B2BA 1WQSA 1KDQB 1C1WH 1RFNA 2ZCKP 1FPCH 3KYGA 1SGCA 4INKA 4JYUH 2VIQA 2UUYA 1S83A 4H4FA 2BD9A 2ZTXA 1ANCA 1PQ8A 2FX4A 2XYAA 3MHWU 1OP0A 4BAOB 4GPGA 1XMNB 3MH7A 1AB9B 1O5CB 4F55A 1C2HA 1TOMH 1TGSZ 1TBRH 1BMFD 3UOUA 3TGIE 4XFQA 1OKXA 2BYAX 3E16B 4R8TB 5TCCA 3D23A 4QT8C 1BITA 2ZQ2A 5F8XA 2BY9X 5C0TA 2F3CE 3A8CA 1THSH 2WPDD 3M5MA 1Q3XA 4FU9A 4ZKOU 1O35A 1FPHH 1MTUA 4IBLH 2C4FH 3LC5A 1J16A 3M36A 1GDUA 2ZHFH 4ZH8A 1C5TA 1OP8A 1O2VA 1DOJA 1WSSH 1ELAA 1QTFA 4DURA 1GI7B 2GX4A 2ZFQH 5T3HA 3SUGA 1A0JA 1SQOA 1P10A 3G01A 1SOZA 3M3TA 1H8HD 3GISB 4I8LA 2WYGA 2W3KA 4OS4A 4ZMAH 4YO9A 1BZXE 1HAHH 1CHGA 2FM2A 1QQUA 1C1QA 4MTBA 1WDIA 1GVLA 1S81A 3FZDA 1DANH 5L2YH 1QZ8A 3CENA 1HJAC 2ZG0H 2HRVA 4PROA 2HLCA 4HFPB 4OGYA 1EXFA 3GCNA 3MO3A 1S85A 3ESTA 1GJ8B 3FFGA 1RGQA 3FAOA 4IN2A 5HYOA 3TNSA 1RIWC 2O8TA 2VNTA 2XXLA 1O30A 1ZJDA 1AVWA 1J8AA 3GICB 3SGAE 4XRNA 1E0FD 4CBNA 2HLDD 1GI5A 3S9CA 2ZPSA 4XOJA 1YLCA 2G51A 1KXBA 3TK6A 1BTPA 1P3EA 3LOXA 2AYWA 2ODQA 1N8OB 4ZXXH 3TGJE 1GI4A 3HPTB 4RKOB 4X8TH 4Q4LA 4B75A 3H7OA 1A3EH 3RM0H 3KN2A 3ZZDA 4NA8A 3LC3A 1E35B 4NGAH 2JJ1D 4X8UH 1O2HA 2GDEH 1C4Y2 2AS9A 3M3VA 4A1VA 1KDQA 1K1JA 2ZGXH 3AW1A 1YPHE 3Q76A 4Y6DA 3RXUA 2PSXA 1AI8H 4BAMB 5JYIA 2XBXA 1AGJA 2BZ6H 5GNDA 1P04A 3F2FA 2CN0H 5AFYH 1NRPH 4TSFD 2P3TB 3ZZCA 1QHRB 2QF4A 1O3KA 2BDGA 1PJPA 1HAIH 4INHA 1F0SA 1C5RA 2CV3A 1GI1A 1HAZB 1P12E 3L6PA 4JYVH 3UREA 4NWLA 2EI7A 1XUIA 1CT2E 2G4UA 1OWIA 4CH8B 1YY3A 2GV7A 3V13A 1QA7A 3RXFA 1TGNA 2HNTF 3SU2A 4AFZA 1NY22 1GCDA 2BZAA 1PQAA 2VWOA 1FMGA 2W7UA 4X2XA 1KY9A 1UVSH 3TVJB 2BDYA 2PGQB 5C2ZA 4YXWD 1GJ4H 1QQ4A 1TGCA 1YYY1 3QTVH 3U69H 2GDDA 1CT4E 1UVTH 2ZTYA 3BIVH 3M7QA 5BRRE 1WUNH 2C8WB 1HLTH 4FOUC 3BIUH 1GMHG 4O9VA 2WHXA 5E0JA 3Q77A 1SGIB 4IGDA 3GY2A 3MU4A 2RDLA 5JBTA 5EJZA 3PLBA 1TLDA 5EJ1A 2A7HA 3ZZ6A 1P2IA 3M5LA 3QX5H 1OYQA 1TQ0B 1OSSA 1BJVA 1V2JT 3K9XB 3RC4A 1HPGA 1OWEA 1RRKA 2BY7X 4IC6A 1TWXB 3ZZAA 3P17H 2RDEA 3F0PA 2BOHB 4ESTE 2V7QD 1V2KT 1QB9A 4ASHA 1E1QD 1AE5A 5HMAA 4X1PU 4P00A 1XUHA 2HVXA 3UTUH 1O2TA 2QY0B 3ZVFA 2VVUA 4U01A 2TBSA 4FVDA 4CRGA 1KSNA 4MDSA 1A7SA 1C2KA 2VVCA 1H9LB 2WV9A 2VJ1A 2ZIQH 3GDUA 1K9OE 4ZKSU 3TJOA 1BMLA 5DGJA 3RXLA 3S0NA 4D7GA 5DG6A 1GMCF 3ZV8A 1KXCA 1TAWA 5DK1A 3GY3A 5EXMA 4RSPA 5C1YA 2FIRH 4ASUD 1LKAA 3M7UA 2FDAA 1UHBB 4FUHA 2B9LA 1S0QA 2PFEA 1DT2A 4X2YA 1TMUH 1V2PT 3PWBA 1SGFG 1IOEA 3HK6B 1JWTA 1BHXB 2OCVB 5C17A 1O2UA 2XBVA 2BX3A 3C27B 5E0HA 3GOVB 1O2QA 4B6FA 1E34B 2G52A 3OY5U 4JYTA 1C9PA 1PPFE 1GJCB 1PYTC 1TB6H 3UQOA 4BTTB 1V3XA 2FI3E 2THFB 3EDXB 2HALA 4NIYA 3ZV9A 2P94A 1O2SA 3OEED 5C5OA 1GBKA 4TWWA 4X6NA 1QR3E 3FZZA 2NU3E 5EPNA 1BIOA 3SU3A 2V3HH 3MU8A 1A4WH 1O3HA 8GCHF 3RXSA 1UCYK 2SGAA 3SQHE 1TIOA 3A84A 1OWKA 1SGFA 3VGCB 1D3PB 5JPMH 1W13U 2BVSH 3P8OA 2ZPQA 1Y3XA 1QJ7B 1DWEH 4CR5A 3SUFA 3CNRA 3KEEA 1BOQA 5GCHF 1M9UA 3N99A 1C4U2 2XRCA 5H4IB 1WXRA 2ZFRH 2OK5A 5FCKA 1KTSB 3A89A 4MQAA 1O2PA 1VGCC 1P11E 3JZ1B 1FDPA 1C2IA 4AGKA 3SV7A 1GI6A 3U1IB 3UY9A 1IQGA 4IMQA 2F9VA 2SGEE 1QB6A 1G3BA 2ZDVH 3VXFH 3BEIB 4AG1A 1AKSB 3UNQA 1K0HA 1Z8RA 1EAIA 4BTIB 1DWCH 1E1RD 2WV4A 2ZGHA 4VGCC 1QFKH 1RTFB 3OTJE 2ZHDA 3QGNB 4GLYA 1CBWC 1TQ7B 3SJKA 4FETA 1DY9A 4NSVA 1YCPH 1P9UA 1DSTA 1FJSA 2HVYB 2JJ2D 1MTNC 1LHDH 1K1OA 1KLJH 3S9BA 2WINI 1BBRK 1T4UH 1K1PA 3QZRA 4K3JA 3V7TA 5C0UA 3LKWA 2IPHA 2PUXB 4IW4E 1HJ8A 1UK3A 3PO1B 1N1LA 1CGIE 1UTOA 1LHCH 2GV6A 2QN5T 1RTKA 3KQBA 4MVNA 1W8BH 5J4QA 4A1XA 2YNAA 3SQEE 2K1QA 1UTMA 2A4OA 1SI5H 2BMGB 4NA7A 1G30B 5HGGA 3FANA 2Y7ZA 3VFEA 2WPJS 2PLXA 3RU4E 5AVDA 3MQKC 1TPPA 1EZSC 1O2KA 1YWUA 3F1SB 5BPEA 3MNXA 1C5QA 1AU8A 4UFEH 4Z1MD 3PO1C 4I33A 2KM0A 1YM0A 1E79D 2ZTZA 5K0HA 4INLA 3SGBE 2ESTE 3Q00A 2FEQH 5L2ZH 4BNRA 1SSXA 1HIAB 5F53A 5A0CA 1TGTA 1F2SE 2P8OB 1GBFA 4CRAA 4AZ2B 1HAOH 2KCAA 3STIA 5JB8S 3BEFB 2QF5A 1UTKA 3W95A 2ALVA 1O3MA 1SMFE 2G5VA 1WV7H 5I46H 1QNJA 4O03A 4VGCB 2BY5X 1O2OA 1YCPK 2FTLE 3OSYA 2TGAA 1PPGE 1CO7E 4CHAB 1C5OH 2VGCC 4KELA 5FX5A 1OYTH 3PTBA 1GBIA 2VWLA 1XKBC 1B7XB 1C1NA 1CQQA 3SNDA 1GBJA 4FUBA 1T4VH 1GI8B 1ELFA 2GTBA 1BRBE 6GCHG 2NU2E 1AN1E 2STBE 1EASA 3FO8D 4UD9H 1FY3A 5GWZA 2J95A 1DLKB 1DXWA 2K8IA 3U1JB 2ZHEH 5A8ZA 2VIOA 4K1TA 1BB0B 4DJZB 2ZPRA 2A2XH 3A7ZA 4WWYA 2SGQE 3SV8A 3DSOA 3MI4A 3BV9B 3ZYDA 1O2NA 3GY8A 5EODA 2NU1E 2C90B 3EAJA 1WYKA 2QXHA 3LT3A 1YPGH 3KL6A 1AKSA 1FV9A 1PPHE 2BM2A 3TNTA 1IQNA 5EW2H 1TE0A 2F9PA 3PROA 4Y8XA 1IQLA 3URCA 1SVPA 1AQ7A 4A1TA 1OOKB 3RXTA 4A92A 3A8AA 2ZFSA 5F8TA 1DS2E 1HAPH 1KIGH 2ILNA 1EJNA 1A5GH 2XC0A 3PWCA 5T6GA 4BTUB 2V3OH 1GBTA 1GGDC 3E3TA 2OBOA 1O39A 3VB7A 2UUKB 1EJMA 3BTGE 2GP9B 1MH0A 3F68H 1HUTH 1ELEE 1DXPA 2J5UA 3AAVA 3I29A 4UDWH 1YPKH 1TRNA 1BT7A 5LGOA 1SHHB 4TY6A 3E0NB 4U32A 1A0LA 1QGFA 2V6NA 4MPXA 2HNTC 1P9SA 1UW7A 2VGCB 4CHAC 1AHTH 1GHWH 1P2QA 3RXJA 3RXPA 5L6NH 3QUMP 1NBME 2QIQA 3D62A 3A7XA 3MH6A 1ZRKA 1O5GH 1CHOF 1C1PA 4UFGH 2ZDLA 1MTVA 1DLEA 1F0RA 2F83A 3NWUA 3PB1E 2CMYA 2QCYA 5GDSH 6CHAB 1L4ZA 1LQDB 1T8OA 4Z0KA 5GIBA 2ZECA 1QRWA 4X1QU 1QY6A 3ATMA 3BTFE 5EQRA 1ACBE 2XW9A 4HI3A 2D26C 4ACBA 2QYIA 1JBUH 4GUXA 1O5AB 2J2UA 1QB1A 4Q2KA 2BXTH 1S6HA 1Y3UA 3ATKA 1W7XH 2BVXH 2OC1A 2F9NA 1XKAC 5EJLA 1CA0B 1SL3A 1HJ9A 1FAKH 1DX5M 4ZHMU 1LCYA 4RT0A 3TH4H 4X6PA 5LPRA 1C5MD 1Z8JB 3E1XB 4K8BA 2W5EA 1IAUA 4K1EA 1JXPA 1FIZA 1MBMA 3GY5A 5DP4A 2GT8A 2CF9H 1NRSH 4JZEH 2C8YB 1Z71A 4KTSA 1K2I1 1TNIA 2ZA5A 4F48B 4NZLA 1S0RA 2TGPZ 1V2QT 2I6QA 3MWIU 1GBEA 4LK4A 2EI8A 2FOHA 1P3CA 3FVFB 3FP7E 2RCEA 3A88A 3A82A 5F6MA 2AH4X 3LDXH 3SI4H 1W3CA 1HB0B 3UIRA 1UTLM 3V0XA 3UR9A 1LHEH 1DUEA 1BTYA 3FOAA 1MQ5A 3BTKE 5EU8A 1MAYA 1QRZA 1AO5A 3SU6A 2IN2A 3ATWA 2R3YA 1D3QB 5FBEA 2A7JA 2OTVA 3EGKH 3KQDA 1O5DH 5CHAC 1B5GH 5ESTE 4ABBA 1ZHMA 4AYYB 3BG4C 1MAXA 4I32A 5C20A 1CSOE 2J98B 1P2MA 5F8ZA 2PKAB 2Y5GA 2P8OC 1V2OT 1MU8B 2FS8A 2ZKSA 1RXPA 3F2HA 3ZVAA 2AFQB 2ZZUH 5ETXA 1UCYH 4YT6H 3LGTA 4HTCH 1SHYA 4ISHH 1GBMA 2EI6A 1OXGA 3BF6H 2SGFE 1P2OA 1HXEH 1WTHD 2KZ4A 2Q6DA 1C1OA 3TH3H 2H9HA 2UWOA 1W0YH 3C1KA 2FMJA 2VWMA 4MPVA 3CS0A 3TJVA 2AMQA 1MBQA 3DFLA 1HJAB 1TNLA 3T2NA 1JRTA 4AN7A 4IC5A 3SJIA 4JZIA 1GDQA 1DSUA 3RU4T 3SJ8A 1LO6A 2A4RA 2FI5E 1K1IA 1ZMLA 3A87A 1ARCA 4D7FA 3S7KB 3HKIB 3OU0A 3SYJA 1SBWA 2HOBA 2AERH 3ZVBA 2R9PA 1AWHB 2OXSA 1HDTH 1W7GH 4ABDA 1XXFA 2Z7FE 9ESTA 1Y5UT 1T7CA 1QA0A 2VIVA 3MNCA 3RM2H 3STJA 3MFJA 1AUJA 1CBWB 5T6DA 3BEUA 4DIIH 4Q7ZA 1NFYA 3UB0A 1BJUA 1EATA 4TWYA 3MU5A 2ZU2A 4KP0A 4YM9A 1EZXC 1TNHA 5SGAE 2FYQA 2KFWA 4J1YA 2WUCA 1CT0E 3RLYH 4MNXA 1CA8B 1VGCB 3SO3A 1BMMH 2K0QA 3DA9B 2Q6GA 2D2DA 1P0SH 1HGTH 1WU1A 3L33A 2KX4A 3QDZB 5KECA 4YESB 5EGMA 4AFQA 1OWHA 2BD3A 1FIWA 1AB9C 4E05H 1MU6B 4WY3A 2SNVA 3NK8A 4AB9A 2I6SA 3S9AA 3HK3B 1TNGA 1ZTLA 4ISLA 4Y7BA 3UOPA 1V2LT 2W6ID 5HKKD 4XBCA 1VITH 3PMJA 3PV4A 1GBDA 4YOJA 1QL7A 1UK4A 2FX6A 4O97A 1ANEA 1ELBA 2WPIS 1VR1H 2AIPA 3OE7D 3AAUA 1F92A 2ULLA 2BQ7B 1A46H 3NXPA 3VPKA 4NSYA 4Y10E 1GPZA 2Z3EA 4NIXA 2G55A 1Y8TA 4CBOA 1HAVA 3SV6A 1XUGA 7ESTE 2ZEBA 1O3FA 5A0BA 2YMSD 1P2KA 2V3MA 3SNEA 2Z94A 2R0LA 1ZOMA 1VCWA 4Y8YA 2BQ6B 4ZUHA 1NRNH 3UFAA 2WZQA 1O2IA 3ZVDA 5GPIB 1MKWK 2G00A 3DSGA 3DUXH 4FUJA 1DDJA 2BDCA 3FN8A 2P16A 2RA3A 2Q6FA 3VXEH 4R0IA 1DE7H 1GJ6A 3A81A 1ZRBA 1HAYB 4D8NA 1FX0B 1EAWA 2B0FA 2PKSB 1KXAA 5FPTA 3LJJA 3TK5A 1C5UA 1MZAA 1O3DA 1YCPM 8GCHG 1GI3A 1ESAA 1E38B 1L1NA 1FUJA 1GBCA 3DHKH 1C5SA 4ZXYH 1SB1H 1FNIA 1GBAA 1ELTA 5C67A 1TABE 1AZZA 4YLUA 1NC6A 1QL9A 2D8WA 2BDAA 1X7AC 1FY1A 1P05A 2J92A 3LGWA 4LZ4B 1DM4B 1AFQB 1TRYA 3PRBA 3ZIAD 3ATLA 1JMOH 1Z8IB 3RXKA 1Z7KA 2RA0A 2TRMA 2B5TB 1UHBA 1W0JD 3NPSA 1FXYA 1BUIA 1L0ZA 3VB6A 1B0FA 5HM2A 1YP9A 4O3TA 4JCNA 3Q3KA 4ZROA 2QF0A 3DSPA 5FPYA 5EQSA 4Y11E 2O9QA 5LH8A 3IG6B 3P8GA 1O5FH 3TH2H 3O8BA 2BLQA 1H8ED 1XM1A 1INCA 3QK1A 1RJXB 1DICA 2A0QB 1GHXH 1A0HB 4AX9H 2PKAA 1W12U 5TCAA 3BTME 1BTZA 2WYJA 1P2NA 4H6SB 3HATH 4HZHA 1O31A 1QRXA 2WPLS 1TMTH 1OPHB 2VBCA 4E7RG 5JB9S 1L2EA 1AMHA 2ZQ1A 2TGTA 4Q80A 4FUCA 1FN6A 1AFEH 1J9CH 5FPSA 1GJDB 3DCLA 2XNIA 1KMHB 1SFQB 1TPAE 1Y3WA 3WW7A 1PPZA 1GI0A 3WWBA 4A6LA 4DT4A 2SFAA 8ESTE 4K60A 1EB1H 1GMHF 1C5NH 2PP6A 5DSFA 3A85A 4DIHH 2LELA 1XUFA 2ALPA 4TPYA 1O3BA 1NN6A
chains in the Genus database with same CATH topology
1AD8H 4OS2A 1JIMA 2PKSC 2BY6X 1JIRA 3ATIA 3E6PH 3RXEA 1MTNB 3BG4B 1UTJA 4X1SU 3E8LA 3K6ZA 2G4TA 1EP5A 1ABIH 1K1NA 1VJAU 2VIDA 5JBAS 1NT1A 1MQ6A 4FU8A 3K6YA 1FY8E 1S5SA 2BY8X 1P01A 1WOFA 3M7TA 1O2MA 2R0KA 3OY6U 1QURH 3KGPA 2P59A 2ZFFH 1BTXA 3GYMA 3LGUA 1C9TA 1SGQE 1OP2A 5JBBS 3RXIA 2F91A 1UTNA 2CF8H 5E2PA 1GCTC 5DP8A 4B2AA 1RD3B 1ORFA 2FPZA 1TX7A 4X8SH 3MU0A 1O0DH 1TX8A 4DG4A 1BBRH 1C5WB 2H5CA 2QAAA 2ZWLH 4UONA 4HGCA 1LHFH 2GT7A 3SU4A 2C8XB 2P95A 1DWDH 1O5BB 1J15A 1C4V2 3EBNA 3H7TA 1T8LA 5CMXH 1K28D 5AFZH 1C5VA 4WMEA 5C5NA 1Y5AT 2W26A 3F9HA 3SJOA 1WQVH 1CA0C 2AGGX 5DP3A 2W7SA 2PHBA 2A5AA 3KQEA 1F0TA 1ARBA 1GI9B 4YOGA 5C1XA 4BAQB 1Z1IA 7GCHF 4ABAA 1O2WA 4MNYA 2FWWA 4MPUA 3RMLH 3FP6E 3MU1A 2FOCA 4E7NA 5AF9H 1LPGB 5AHGH 8LPRA 1G3DA 1Y59T 3A7TA 1GVZA 2ZHQH 2P93A 4NIWA 6CHAC 1D6RA 1Y3YA 1MTWA 1TPSA 3KNXA 3BN9A 3M5OA 3E91A 2FTMA 4AFUA 1EQ9A 2ZI2H 3U9AH 1O2GH 1GBLA 1THPB 1BRAA 3GY7A 3GY4A 1LVMA 2SGDE 1SLWB 4Y71A 3SHAH 1AE8H 1G32B 3QWCH 3P8FA 2GCTC 2XC5A 2Y81A 3QTOH 1H9IE 5EOKA 4FUDA 1C2FA 4DVAU 2JH6D 1D9IA 1LVOA 1V2TT 4WH8A 4B73A 2XTTB 1MKWH 5A09A 1GMDF 4B1TA 3QLPH 1HYLA 1YPMH 1ELVA 3ZVGA 3BTTE 1GBHA 2ZU5A 3U98H 2Z9JA 4WVPE 3QZQA 2GZ7A 4GHQA 4DCDA 1GGDB 1EZUC 3UR6A 5DKMA 4XSKU 1ETRH 1H4WA 1V2WT 3LGVA 1N8OC 1E36B 3MMGA 1SFIA 1HAXB 1DY8A 2JETC 1GWAA 1OWJA 4SGBE 3O8RA 4JZFH 1TPOA 4OS1A 2UUJB 3SV9A 1FI8A 4WXIA 4BANB 2AIQA 1EZQA 3GCTF 3VB5A 4XE4A 4YOIA 2Y5HA 3CP7A 4WXVA 3BG8A 2ODPA 2PR3A 1P8VC 4BOHA 4BXSA 5CHAB 4CRBA 2FLRH 2UWLA 3UPEA 5I25A 3L3TA 1BRCE 4YLQH 1HAGE 5F03A 3LONA 4BAKB 2JH5D 5G4BA 1HV7A 3URDA 3RMOH 4XBBA 1BHXF 1XUKA 4I8KA 3SNAA 3F9FA 3TPIZ 4NIVA 4SGAE 3RMNH 3SU1A 4ABGA 5C3NA 2A45B 4YZUA 4X0WU 5IDKA 2Z3DA 4H6TA 1Y3VA 2OQ5A 5J4SA 3D65E 1KXDA 1KXFA 1UVOA 1ZTKA 3U8OH 4NG9H 3RXGA 4AOQA 5CE1A 4LZ1H 1BMAA 1ZGVA 4MNVA 1O3LA 5EW1H 1K1MA 1NZQH 3QO6A 1MCTA 3PMHB 4ABFA 2VINA 1QL8A 3NZIA 1O3CA 1T31A 2R3UA 3KCGH 1ZPZA 3ZYEA 2Y7XA 2WV5A 2GZ9A 2BQWB 1HFDA 3TIUA 1KLIH 2IOTA 4H42U 1YLDA 1AUTC 2VB0A 1AVXA 1EUFA 3B8JA 5C1UA 1H9HE 2FOAA 4RN6A 4LXBH 1IHTH 4M7GA 3A83A 1LMWB 1XVOA 2AMDA 1ZHRA 3SNCA 7LPRA 1LTOA 1TX6A 2Y80A 4OS5A 1YPHC 2FOGA 3P95A 4ZHAA 2OC8A 3TK9A 3SORA 4OS6A 1YF4A 2B7DH 2HPPH 1G3EA 5EPYA 2OC7A 1UCYE 3RXMA 2PUQH 1FQ3A 1GHAF 2OC0A 5EQQA 1C1TA 1G2LA 4NFEA 5B6OA 3T27A 5EG4A 1ZZZA 2ZF0H 2Z6BD 2G81E 2GMTC 2BDIA 2H9EH 3VB4A 2BHGA 4I31A 2F9OA 1TRMA 1YGCH 2A4QA 3DFJA 4A5TS 3SGQE 1CGJE 1O32A 1GBBA 3ODFA 1C2MA 1TMBH 4K69A 3F6UH 3SU0A 4WMDA 2CHAC 3T5FH 1KYNA 1GHYH 2M5TA 1P09A 1ZHPA 3GDVA 2SGPE 2BLWA 3JZ2B 1ETTH 1IQFA 2ASUB 1IQHA 3SV2H 3K2UA 4KTCA 1C1MA 2O8WA 1UTPA 1ZYOA 3BTHE 3MNSA 1C5LH 3QGJA 2AGIX 2GCHG 1GJBB 4UFFH 2P3FH 2Z3CA 2Z9GA 2NWNA 1RS0A 2FZZA 4DY7B 2A2QH 3BTQE 5K7RA 1P02A 2XC4A 1FLEE 3O8DA 1BBRE 1BTHH 3GCHC 1L4DA 1MD8A 1ZPCA 2H9TH 2OD3B 2FYRA 5T6FA 3KIDU 2XCFA 3BSQA 2OUAA 2ZNKH 1PPCE 7GCHG 1YPJH 1H1BA 1ELGA 4K1SA 1ZSJA 2RG3A 5HM9A 2NU4E 3GYLB 3GDSA 4CREA 1FZZA 3D49H 1TNKA 1LQEA 3NCLA 2R2WU 1D4PB 3ZVCA 1GL0E 1NROH 4CH2B 1C2LA 1NU7B 2FOBA 3RC6A 2CJIA 5JDUB 4UEHH 1GL1A 1ANDA 1QJ6B 1WCZA 1F5RA 1XUJA 2J9NA 4X2VA 4MPWA 2ZU4A 1WBGB 3SN8A 4WMFA 1G37A 3LIWA 2FESH 4WF8A 1O34A 1ESBA 3SHCH 4OS7A 3EQ0H 1Y5BT 3E90B 2OLGA 3KF2A 1ELCA 3I77A 4JZ1A 2XWAA 1A3BH 2H6MA 1ZLRA 3T29A 2A1DB 2O8MA 1LKBA 3UNRA 1HNEE 2Z9KA 2VU8E 1C2DA 1Q31A 2HWLB 1F0UA 2GKVE 1CGHA 1D3TB 1PPBH 3RC5A 1LPZB 1XX9A 2DUCA 5FAHA 1FY5A 2F9UA 5A2MH 2FLBH 1MUEB 1HAVB 1OS8A 1DFPA 3TU7H 3M3SA 1AZ8A 1TYNA 3P70B 1AWFH 3PTNA 1RIWB 4D76A 1TNJA 1H8IH 1W14U 3B9FH 3VB3A 1LHGH 2CHAB 1K21H 2ZDMA 2J94A 4I7YH 2R2MB 4KTUA 2FS9A 3M5NA 7KMEH 2WPHS 1K1LA 3UQVA 4ISNA 2CXVA 3UWIA 2ZU3A 3T28A 2C93B 4MG3A 2BDHA 1NPMA 4GCHG 4B74A 3MTYA 3T25A 1NU9A 3KQCA 1S84A 2EEKA 4ISIH 2ANMH 1SOTA 2A5IA 1MMJN 5EXNA 1K22H 2ZDNA 1JOUB 3NKKA 2OQUA 2J4IA 1G9IE 3MH5A 5DJ7A 1Q2WA 1Z1JA 1EJAA 2P3UB 1O3OA 3Q3XA 2O8LA 1KXEA 4CRDA 1HIAA 1NFUA 1NS3A 2IJOB 4B2CA 2WUBA 5FHTA 3OYPA 1BDAA 3RLWH 2HGTH 1SQAA 1G3CA 1O2XA 1OWDA 3O8CA 1S82A 5PTPA 1A5IA 3R3GB 3ELAH 3ENSB 1VITG 3SZNA 1V2RT 3T62A 4U2WA 4AFSA 1ZPBA 2ZU1A 2QV1A 2BX4A 3GY6A 1GJAB 1O3IA 1UVUH 5L30H 3HKJB 4K5ZA 1NFWA 3RXBA 1OX1A 4YTAA 3SNBA 4DW2U 1W10U 1S6FA 5GCHG 2F9BH 1P2JA 5LPEA 4XDEA 4CRFA 3SUDA 2PTCE 1AY6H 1O2ZA 1IQMA 1O3NA 4UFDH 1KTTB 2XWBI 3VGCC 2OP9A 4X8VH 1CHOG 1ZTJA 2YOLA 1ZSLA 1ZR0A 3PLPA 3U8RH 2BLVA 1SGYE 2C8ZB 3EA9A 3W94A 4U30A 3TGKE 2GD4B 3EYDA 3OX7U 1P03A 5LPFA 5GJ4B 5DP5A 1LVYA 1SG8B 1A61H 1BTWA 2KAIA 3IITA 1TGBA 2ZCHP 2AGEX 4CRCA 3SW2B 1C5XB 5HXFA 4F49A 3LU9B 2UUFB 4X1NU 2ANWA 3BTEE 5DPAA 1A5HA 3MOCA 2ANKH 5A8XA 1H8DH 2BOKA 1UTQA 1A2CH 1P57B 1MKXH 1V2NT 1EB2A 1YPEH 2TPIZ 1ANBA 1LDTT 4LOYH 1EP6A 1WAYB 5EXLA 3LGIA 2BLOA 2BD5A 2Q1JA 1BA8B 1FN8A 4ABHA 2BVRH 6LPRA 3TJNA 9LPRA 1YBWA 2H5DA 1PQ7A 4Y7AA 1DITH 2PW8H 3TLOA 2VH0A 3P8NA 4Y76A 4AGJA 3UNSA 3UWJH 1V2MT 3GCTG 1QBOA 5FBIA 2ZGCA 4TPIZ 1YPLH 2H2ZA 1SPJA 2JETB 3M35A 1HCGA 4IMZA 1NTPA 2FOFA 8KME2 1J17T 2CGAA 2J34A 1TOCB 3MH4A 3PYHA 1EPTA 1GG6C 1O2RA 1SGEE 1V2ST 3A7WA 5DO4H 2SNWA 4FXGH 4TY7A 1FAXA 1C2EA 2XBWA 1VZQH 1B0EA 1MTSA 5ESBA 1HBTH 4NCYA 1ZJKA 4Y0ZE 2A31A 1W11U 4KKDA 5DP6A 1GI2A 1O37A 3UUZA 5IYTA 4RKJB 1O3PB 2QA9E 3TJUA 1QJ1B 2D1JA 2GCTB 3LJOA 1L1JA 2A7CA 3M37A 1W0ZU 2Y5FA 2TGDA 1XXDA 2FI4E 3MO9A 4KGAA 4AYVB 3P6ZB 4K8YA 4ZHLU 2A5KA 1ZMNA 4AG2A 2FOMB 1L1GA 1N6YA 1PPEE 1VJ9U 1BTUA 1CE5A 3I78A 5E2OA 2WPKS 3LGYA 1C1UH 1O36A 3ZZ9A 2ZCLP 1C2JA 1Z6JH 1BQYA 1G36A 1DWBH 2B8OH 4NWKA 1IQKA 1IHSH 2J38A 2V0BA 4X2WA 2Z9IA 2HPQH 2VVVA 2TIOA 1V2VT 2JH0D 1W2KH 3MO6A 4Q7YA 4B71A 2ZDAH 2PGBB 3N7OA 3ZZ8A 2ZO3H 1GJ9B 1GHVH 2ZDKA 4J2YB 5DP7A 1YKTA 4A7IB 2C3SA 4GCHF 1GVKB 2FXRA 1U6QA 1SGNE 3MYWA 4IN1A 2ZC9H 1HRTH 4FUIA 4X6MA 1VCQA 2QXJA 1SC8U 1SLUB 2GGVB 2PWXA 1RTLA 2PV9B 1GMDG 4ZAEA 4FVBA 3SOSA 2WPMS 4GSOA 2G5NA 4ABEA 1UMAH 2GVFA 1Z8GA 2OBQA 1QCPA 2BB4A 3SI3H 3RXHA 4JMYA 3KHVA 3PM3A 2Z9LA 4MNWA 6GCHF 3DD2H 1O3GA 2Y6TA 3E0PB 3IWMA 4BXWA 1ABJH 2HNTE 3GCHB 2EC9H 3AW0A 1AVGH 2FP7B 4Y79A 4GAWA 3ZZ5A 2BXUH 4AORA 4NFFA 1LVBA 1GCTB 1SQTA 1BMNH 2PSYA 1GJ7B 1GHBF 2BD2A 4I8HA 1WTGH 4XBDA 1UO6A 3GCOA 3ZZ3A 1C5ZB 1TONA 1EAXA 4Z6AH 3RXVA 4ISOA 2Y82A 1NFXA 2ZFTA 3LH3A 3ZZ7A 3SUEA 1O33A 3SU5A 3F9GA 1C1VH 3V3MA 2ANYA 3PMAB 3FP8E 3A7YA 2DE8A 1XVMA 4GVUA 4YT7H 3F9EA 3A8BA 5E0GA 1MKXK 1ESTA 4Y0YE 1GHAG 1AIXH 2XCNA 4Y8ZA 1GHBG 2BDBA 1F5LA 2G8TA 4FUEA 2PTNA 4NA9H 4FU7A 4WH6A 3ZZ4A 2ZGJA 1A1RA 4THNH 3ITIA 2QC2A 3T26A 2O8UA 2VIPA 3PMBB 4NZQA 1T8MA 2BTCE 3R0FA 3EA8A 1ELDE 1UVPA 1ZGIA 2FODA 1PYTD 3B23B 2KAIB 2NU0E 1GHZA 1O38A 2LIZA 2GCHF 1O3AA 2UWPA 4F4OC 4BAHB 1BCUH 4UE7H 1MCVA 3DT0H 2ZHWH 1NM6A 2A32A 1IQJA 1GMCG 2V35A 1O2YA 3P92A 3RUOA 1QBVH 1UJ1A 1SGRE 3M61U 1MZDA 4D9RA 2VIWA 2QF3A 1NESE 4Q7XA 3RXRA 4B76A 1TFXA 1J14A 2DE9A 2ODYB 1UK2A 1CVWH 4ABIA 3ODDA 1KLTA 3S69A 1E37B 2AMPA 1CU1A 3Q3YA 4MLFB 4E06H 1GJ5H 1TBZH 4JZDH 1ETSH 2OINA 4WJG2 3AVZA 3ZZBA 5A8YA 4O3UA 1O2JA 4JK6A 1V2UT 2BD8A 2FOEA 2K7XA 3AASA 2VWNA 1C2GA 1NO9H 2VH6A 3K65B 4I8GA 3RP2A 3RU4D 1C5YB 1EX3A 2LNCA 5A0AE 3S7HB 1ID5H 1EPTB 2H1UA 3CS7A 1EOJA 1T8NA 3U8TH 4AB8A 1LPKB 3QN7A 2ZP0H 2A4GA 4D9QA 2GZ8A 1IQIA 3A80A 3RXAA 3A7VA 4TYDA 4OGXA 3SJ9A 1T32A 5TJXA 4X1RU 1P06A 1AFQC 2BD4A 2QXGA 1JRSA 1ZMJA 1YC0A 2JKHA 3V12A 3PLKA 1Z6EA 1GDNA 3BTDE 3EA7A 1NRRH 3LPRA 4DGJA 5GXPA 1THRH 2ZFPH 1O5EH 3TITA 2W3IA 1DVAH 3HGNA 1SR5C 1IQEA 3NUMA 1GG6B 1QBNA 1C5PA 2LPRA 4DT7B 2YNBA 1EOLA 1HXFH 4ABJA 5E8EH 3VEQB 1SGDE 1D3DB 2BD7A 1C1SA 4I8JA 4IS5A 5JBCS 3A86A 1G2MA 1BRUP 1SGTA 2QXIA 3ZVEA 4DOQA 1EAUA 1EKBB 1TALA 3MNBA 1SLVB 3SBKA 2QGRA 2EA3A 3RXDA 1TBQH 1N6XA 3RXOA 3HGPA 1TA2A 3LH1A 6ESTA 1NRQH 2AEIH 4ZKNU 1TA6A 1F5KU 4FUFA 1C1RA 4CR9A 3H5CB 4X6OA 1FY4A 2STAE 4ZKRU 3WY8A 1VITF 1O3JA 1VCPA 5FX6A 3A8DA 1F7ZA 3RMMH 4FUGA 2XBYA 1MD7A 4JK5A 1V6DA 1EPTC 5FCRA 2FO9A 4GHTA 4K2YA 1PFXC 1ZSKA 1QIXB 3BTWE 2GMTB