2AMYA

X-ray structure of human phosphomannomutase 2 (pmm2)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
243
structure length
240
Chain Sequence
PGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMNDHEIFTDPRTMGYSVTAPEDTRRICELLFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structure of Human Phosphomannomutase 2 (PMM2)
rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Phosphomannomutase 2
total genus 78
structure length 240
sequence length 243
ec nomenclature ec 5.4.2.8: Phosphomannomutase.
pdb deposition date 2005-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03332 PMM Eukaryotic phosphomannomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.20 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 2amyA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2amyA01
2JARA 3MMZA 1RMQA 1QYIA 3L8GA 1U7OA 2BY4A 1RC8A 2X4DA 2Q4TA 2JAUA 3L1UA 2CFSA 2NYVA 5AK3A 3ZWKA 3M1YA 4J03A 4CF3A 4UU1A 2IOHA 4Y3UA 5ALLA 1EK1A 2G08A 2I33A 3N07A 2P11A 3QUTA 5AVWA 4HYTA 2B1RA 2AGVA 2P69A 3QX7A 3WKBA 2ZOSA 3OCXA 2RB5A 5AM4A 4KNVA 1X42A 3E8MA 2O2XA 3NIWA 3GYGA 3RFUA 1L7NA 3ZI4A 2AMYA 4EEKA 3ZWDA 2YY6A 1ZRMA 2FPXA 2G09A 3KD3A 3ZX5A 5AKLA 3L5KA 3KZXA 3E84A 5ALGA 4BX3A 1U02A 4UAVA 3WK6A 5AKYA 5AI5A 1L6RA 5AW4A 4HGPA 2VKQA 2R8EA 2DQSA 4XQ0A 4JDPA 3PGVA 1RMYA 4NWIA 4RETA 4HGNA 5ALNA 5T41A 3EWIA 3SD7A 4EELA 2CFTA 5ALSA 1FEZA 2ODAA 3QXGA 2Q5EA 3W5AA 3PDWA 3W5BA 1YNSA 1L8OA 1RRCA 2G80A 5AM3A 4Y2JA 2PR7A 3AR6A 3IRUA 4MWOA 4PNHA 3QLEA 5AICA 5AKIA 4YH1A 4KX3A 2YMLA 2HDOA 1XPJA 1S8OA 1TE2A 2FPWA 5E0OA 2YJ6A 2HHLA 2ZBEA 3MPOA 1L7OA 3BWVA 4C4RA 2R8ZA 1Z4OA 2HO4A 2GHTA 3N28A 3N8GA 4GXTA 4UMVA 4O8CA 2G0AA 4OFZA 1TJ3A 2WF8A 2WF5A 2C8LA 5AM2A 3OCZA 3AR8A 3PGLA 2W43A 5ALYA 3DAOA 1TJ5A 5AK6A 1Z4JA 1TA0A 3D6JA 3AR4A 3AR2A 1ZRNA 4Y2YA 1QQ6A 1LTQA 2JAWA 3RF6A 4EENA 5AKGA 4DWOA 4F71A 1TJ4A 1L7PA 2FPUA 2Q4RA 1NF2A 1Z5GA 2EARA 1K1EA 5ALFA 2YBDA 2FPRA 2WHEA 5ALDA 5AIBA 2C88A 4G63A 3A1CA 4KNWA 5A3RA 1WZCA 1J8DA 2YMMA 3I28A 1JUDA 5AI0A 1MH9A 1U7PA 2WF7A 3KDPA 3W5DA 3WK5A 4UW9A 4NABA 4C4SA 5AVTA 1Z4NA 3ESRA 3ZVMA 4BEWA 4QJBA 3WKEA 2MU1A 1NNLA 4L6CA 2PKEA 2NO5A 2HI0A 5A3QA 3ZUPA 4UM5A 2QYHA 1SU4A 5ALQA 3ZW7A 4Y2SA 2C8KA 4HGQA 1YV9A 3EF0A 3WGUA 2G06A 3WKCA 3WK8A 1YDFA 2WF6A 4YCLA 4BNDA 3ESQA 3P96A 4L6AA 3DDHA 5AW5A 5AK4A 3N1UA 2IOFA 1S2OA 1ZD5A 5ALRA 4JB3A 2I7DA 3WKDA 4BX0A 3E81A 4Y2XA 3IJ5A 4J2TA 4BKMA 5AVQA 2HSZA 2YN4A 1RKUA 3QUCA 3U7HB 2I34A 5AW8A 3L1VA 5AVRA 2B0CA 3HLTA 3UM9A 3U26A 2GHQA 3B8EA 2FEAA 1T5SA 1RLMA 5ALTA 1ZJJA 2G07A 4EX7A 1Z5UA 4AP9A 3AR5A 2IA5A 3SLRA 4CF4A 2B1QA 3NRJA 2FDRA 5ALWA 2C9MA 4UARA 2OM6A 2P9JA 4ZEWA 4B6JA 5AI8A 3U7FB 3N5KA 1IWOA 2ZG6A 2ZBDA 3FGOA 1YMQA 5AKEA 3SMVA 2IYEA 2C4NA 3MN1A 4IFTA 4XOUA 4L57A 3QYPA 1QQ7A 2W4MA 1Z88A 4CNQA 3L8EA 4EZEA 5AW1A 3QU7A 1AQ6A 3NANA 3L8HA 2IOFK 4Y2PA 3I6BA 3OTQA 1Z4IA 4YCNA 2B8JA 4BX2A 3CNHA 1VJ5A 3PCTA 3ZU6A 1ZS9A 4Y2RA 3DNPA 4H1WA 2GFHA 2RAVA 3K1ZA 3KBBA 5IT0A 1O08A 4Y2TA 1WR8A 3R4CA 3NUQA 2BDUA 4HGRA 3UMCA 5AKKA 3NAMA 4KX5A 4UMEA 5JJBA 5AW6A 1Y8AA 1T9ZA 5AI6A 3QU2A 1NRWA 4CF5A 2WFAA 3KC2A 1Z4QA 3MC1A 3L0CA 3E58A 1QH9A 4XE5A 3OCWA 1ZD2P 5AW0A 3NASA 3NALA 2CN1A 3ED5A 4DFDA 3SF0A 4G9BA 5ALHA 5AVZA 3ZTYA 5AVSA 3DV9A 3U13A 2HOQA 5ALMA 4XPZA 1WPGA 3W5CA 2AH5A 3FPSA 1LVHA 3L0YA 3QU9A 3SKYA 3QGMA 3FZQA 4IG4A 5ALJA 2OA0A 2JAOA 3TLMA 4F72A 1SWVA 2YMQA 4OD0A 4YGYA 5AIAA 4KN8A 1L7MA 1Z4PX 2YMPA 5AKXA 3ONNA 1Q92A 2I55A 1Z4KA 1Q91A 3WK9A 5AM0A 1RDFA 4UAUA 4QQFA 1YJ5A 5AW2A 5IS2A 4I9FA 4BYGA 1XVIA 2HCFA 3U19A 1N8NA 3A1EA 4KYTA 3I1YA 3FM9A 3B9BA 5AESA 5ALKA 2PQ0A 1VFPA 4Y2QA 4FFDA 2FUCA 2FI1A 5AW9A 3L0BA 2YJ5A 3VAYA 3HYCA 3R09A 4OHFA 1RPZA 2BDEA 2CFRA 1QQ5A 4Y2UA 4YIHA 4Y2VA 3AR3A 3WK4A 1SWWA 3KOOA 3EPRA 3WGVA 3QU4A 1RMTA 5AVUA 1U2TA 1VJRA 2B8EA 3OPXA 4NAVA 3ZTWA 4YCMA 3SKXA 5IT4A 2EAUA 1ZD4A 4UASA 4UMDA 2HEGA 2GMWA 5AVYA 4I9GA 1PW5A 5ALIA 1N9KA 4UU0A 5ALVA 2ZBGA 3EF1A 2MSNA 2P27A 1T5TA 3A3YA 4YIKA 2HX1A 4AS2A 4CE6A 1Z4MA 5ALOA 5AM1A 2FPSA 1RQNA 3F9RA 5AI9A 3UMGA 3R9KA 5AKZA 2B30A 3BA6A 2OBBA 4EX6A 4BNDB 2D2VA 3ET4A 2I6XA 3L7YA 2O9JA 2R8XA 3B9RA 4FE3A 2YJ3A 5FP0A 3ET5A 4FYPA 2W11A 4GIBA 4UATA 2G1AA 2ZXEA 3OCYA 5AKJA 2FUEA 1RKVA 1RLOA 3WK7A 2WF9A 3ZX4A 5ALPA 1RQLA 1WVIA 2WM8A 3I76A 2NO4A 5AK5A 5AKHA 2HF2A 3J7TA 4ZEVA 4HAIA 2AUTA 2ZBFA 4OCZA 3CZ4A 3QUQA 3OCVA 3OCUA 5ALXA 3U7EB 3QU5A 4UM7A 1EK2A 3SHQA 5ALUA 3ZVLA 5ALZA 1Z4LA 3QUBA 5AM5A 1ZD3A 5AW7A 3FPBA 3U7GA 3AR9A 3M9LA 4E88A 3UMBA 1L8LA 2HF7A 3FVVA 1CR6A 3S6JA 4NV0A 1O03A 2GO7A 4BBJA 3ZVNA 4UMFA 2EATA 4AS3A 4MUMA 5AHXA 1KYTA 2JGAA 5AVVA 4ZEXA 3WKAA 3A1DA 3AR7A 4DW8A 4DCCA 1CQZA 1YS9A 4HGOA 4BEVA 1RLTA 2RBKA 3L8FA 5AW3A 1ZOLA 2R8YA 5ALEA 3QNMA 1U2SA 5AI4A 5A3SA 5AVXA 3IB6A 2B82A 2RARA 4C4TA 2QLTA 4RESA 1J97A 4NFLA 2YJ4A 2YFYA 1RKQA 2I54A 1XP5A 2OYCA 1F5SA
chains in the Genus database with same CATH superfamily
3SE0A 1G5QA 1Z8HA 3UK6A 3E61A 3Q6MA 3LUFA 1VMKA 3JYNA 4EQZA 1Z8DA 2C5GA 4BGEA 3C3BA 2ZJBA 4NS1A 5JOQA 1QIEA 1TB4A 2I8CA 2Q4TA 4MQFB 4BNYA 5KYUA 3Q0EA 2CFSA 3QM1A 4RHXA 1FQKA 4ARCA 2BAGA 2CJYA 3VYSB 6NULA 1TIPA 4IDQA 3ZH2A 1DKOA 4TTQA 1UXOA 1E1MA 2JGDA 2D7JA 2NV2B 4CMIB 5EZQA 1KS2A 7MHTA 2C7RA 2OQ2A 3RVJA 2IJGX 1T2EA 4MB6A 3SS7X 1BU5A 3ZIAA 1WW2A 1KSGA 5ADWA 4NYJQ 3WGOA 1XVLA 2GK3A 3QX7A 3EW7A 4ZVUA 1K7XB 2QORA 1GTSA 1YI0A 4NAHA 2VNIA 1OI4A 1XTUA 2QD5A 1H2BA 1J42A 3I8XA 3N7UA 2JD0A 2FG5A 4HYQA 4J16C 5F2EA 1XLVA 4WLUA 1YJQA 4P53A 4F11A 4TX1A 2RK6A 1PR6A 4RABA 2ZSUA 1RPJA 4YEDA 4JFAA 3E9CA 3SCZA 4EO9A 4QBTA 1E18A 4OTZA 4QLBA 3IA2A 1WPRA 2H54A 3GRYA 5BRJA 2F8TA 3EGIA 1PX0A 1M6EX 4I2NA 3JQEA 4MPPA 3R6GA 3DE1X 2Y1LA 4NOLA 1PAUA 2CGEA 2XRFA 2XXBA 3SG0A 1SUBA 5JARA 1ZQ9A 2IHUA 2HCJB 3C3MA 2GPTA 3C3PA 3FJ1A 4GOJA 4RA9B 4ALJA 3WWCA 3NYQA 4AJEA 4L8YA 3WNVA 5KQRA 1WTCA 5AW4A 4OKNA 2WPDA 5FL3A 1YUNA 1G8YA 3P27A 4JDPA 4BGIA 1FB5A 1P3DA 3WFJA 4B5LA 3JV7A 3VTFA 4L0CA 3EMBA 1J06A 2IHZA 4C5CA 5MFPA 3MLEA 4TRMA 4E12A 1M6NA 2IS4A 2BH2A 3GX1A 3PDWA 3ITDA 4NBKA 4X54A 1N75A 1FTYA 5AJYA 1IEQA 1JMKC 4HB4A 2FV8A 2WQ7A 4ZXPA 5HKLA 3GFSA 2QQFA 4XI9A 4BO4A 1KGDA 1D9XA 1Y3DE 1ZIPA 5FIUA 5MGBA 4RYLA 1VMIA 2JIOA 4F7WA 1DG1G 2B99A 1ZAKA 2CCJA 3PA6A 2FB9A 4PZZA 3ZHUA 1H93A 4QUGA 3HHPA 3HBMA 2DFDA 3T1HB 1D2AA 2HRZA 3BMQB 3C45A 4CNBA 5EY5B 1ZHHA 3N28A 3ZKWB 5JR3A 1IB0A 1YKSA 5K01A 4Y1RB 3ONVA 4CQNA 3NDRA 4NXMB 1BS2A 4O8CA 5I3CA 2AIRA 1OHHA 2OOKA 3NJ8A 4JASB 4E70A 5DZSA 3MCWA 4H18A 4I55F 2AOUB 2HLDA 4H2DA 2G9NA 2UKDA 1Z5PA 3HN2A 4J07A 3NHSA 4WOPA 2XKKA 2IDMA 1ACMA 5GV7A 1BCRB 1J70A 4NCIA 2AMJA 3LWDA 1PJ4A 4TXMA 4AZWA 4RY9A 4G5GA 1XR3A 4RJLA 3VYVA 2ZUFA 2G76A 3OKAA 3C97A 1Z38A 3ZHRA 3M1AA 3I4LA 2PPVA 3RF6A 4MQEB 4EENA 4NNOA 4F5YA 1W93A 3G0IA 1UQRA 4I3FA 1VPTA 3GCGA 3UUWA 3IIJA 4MX8A 2XBUA 2AOWA 4DQDA 1BVUA 4YMHA 3OZVA 4AIIA 2Y1OA 4EPVA 1JHDA 2B7BA 1BHJA 3BG5A 4PHFA 3DBRA 1R6TA 2WHEA 4D8UA 2E21A 3V8VA 4B4DA 4R01A 3NGXA 1DXHA 1KOFA 2Q3JA 2F3PA 3A1CA 3I28A 4FDUA 4M36A 5IBRA 3E2PA 1NXQA 4PO8A 3W04A 1N2CE 4DDVA 1RLJA 5DYYA 2V7PA 4CCWA 4TLLB 3W1WA 4MW5A 4DBLE 1M73E 4KXYA 3P9ZA 3W5DA 5JZBA 3DA8A 5BMVA 1P91A 1Y4UA 3NPAA 5FJJA 3BEDA 1EHIA 4EY6A 3PD0A 2IS2A 3B5IA 4NFSA 5K6AC 2ID7A 5I47A 4LY0A 2C0QA 2O4CA 4R7TA 2YXEA 4K1XA 4QU9A 4GBED 3WIDA 1NUSA 1OZHA 3UBMA 3A3OA 4KTVE 5FWXA 4EGFA 5CXSA 2LCIA 1SCDA 4P7KA 2WJ6A 5DBHX 3TZ6A 4B31A 4PIVA 1TO6A 1YKGA 4J29A 3ZW7A 5C3MA 1A2QA 2IIVA 1A04A 2I66A 5FBQB 4BRZA 1B0AA 5M29A 4M2LA 1MX3A 4DV7B 1R0XA 4MZXA 3UB4A 3TQCA 3CEHA 4EB8A 2R6GA 2RGBA 3LECA 2AXNA 4Q3CA 4ZEOA 4LFBB 4GM0A 3O26A 3IV6A 3RSZA 3T5PA 4BC1A 3NV7A 3WWOA 1L9XA 3EGDA 1HI9A 4FKZA 4GXRA 3WLFA 1Z16A 1DIBA 2VDLB 3MMXA 3JR3A 1NVAA 1K0FA 3GBVA 3I6QA 4FMCF 5DCWA 4A7PA 5BVGB 3BL8A 3BXXA 1O5TA 3AERB 3IHWA 3KOWA 2YRXA 4IL5A 2ATEA 2OB1A 1T9AA 2YR0A 4A2CA 4OGGA 1DOAA 1ST2A 1M8PA 5A4FS 3KWFA 4LQDA 5L3ZA 1B1CA 1T3LA 2FP4A 2XMPA 2YWRA 4DAOA 3LTNC 1DEKA 1JWAB 2YHBA 4ZOEA 3A7EA 1HL3A 1PJAA 4GVPA 4TQUS 3V7FA 5EHXA 1G7CA 3HO1A 4ZCSA 4YMLA 3BWBA 3SM3A 1G60A 4Z2YA 2ZXUA 2J6HA 2WZCA 1A3CA 1RWPA 2CKMA 2SECE 3EXHB 3N76A 2GHQA 2OVBA 2FEAA 1OWNA 5K2OA 3LGAA 3WDKA 2IYLD 2J0UA 2R3SA 4FVTA 5EIFA 3CV3A 2R6JA 5ES3A 3T06B 3DVLA 4ARZB 2JDID 1OIXA 1KYVA 2G07A 1JPUA 3E8XA 4N40A 1ZDMA 3OTWA 2BV3A 5FOTA 3SEAA 4CU5A 1JILA 3SIWA 1BEUB 2X1LA 3SLRA 4CF4A 3KJFA 4ZZ0A 1C1DB 4GXQA 4Q7JB 4RMJA 4H7KA 3PE6A 5BSTA 1V16B 1VC2A 1YOVB 3X1KA 1JXQA 1PDWA 1XU7A 3JRXA 2C3OA 3WYEA 2IF0A 3FFXA 5BQFA 2D0DA 3G9QA 5K99A 2ACVA 2WU3A 2AK3A 1IWOA 1U99A 4JBHA 1X38A 2CHGA 1KMHB 1U3VA 1VE6A 2VF5X 2AVDA 2BGIA 2GAAA 2J33A 2X1HA 2NN3C 4MIOA 2G1PA 2CL0X 3AERA 2J41A 4XWAA 4RTKA 2J30A 1DFHA 1E66A 9LDBA 2D3WA 5JY1A 3FVRA 2BHSA 3MGBA 2AQHA 2AD1A 4H60A 2G5TA 3DMPA 2BEVB 3PPYA 4FBMA 4H15A 3CKLA 4H3SA 1BSVA 1OFHA 3MMNA 4ZT5A 3GUZA 1I30A 2V4UA 3GPBA 3LC1O 4U2DA 4QGSA 5JADA 4D9CA 2VSNA 4Y1GA 5B58C 4U6NA 3QKRB 3EIEA 4FLMA 1AMNA 1X7ZB 2PUHA 4C2AA 4DNPA 4MW0A 5C1OA 2ST1A 4HTAA 3MRTA 3VOAA 4DR5B 3L4JA 4DV5B 5KTOA 4ZHQB 2IRWA 3F46A 2VDKB 1RPAA 2L42A 4IEEA 5TR9A 3MJFA 1U0HC 4KQ6A 3LF1A 2RAVA 1KZ7B 2EVWX 2I8AA 3D4NA 4J6EA 4W1SA 3ZXUB 4H1WA 1XCBA 4EMTA 1KYYA 4Z4GA 2GT1A 2QX4A 2VT6A 1CWUA 2E89A 2ZUVA 3NTLA 4E33A 4EA8A 3OSZA 4FYWA 3AT1A 4HRAA 1KSFX 1IQ0A 3H5OA 4HB2A 3TJMA 3MF4A 1F2TA 1UMCB 2A30A 3IUBA 1W0CA 1KQFA 1NJFA 2YWBA 5BSEA 2QTZA 1IZYA 3TW0A 2Z30A 4FQ7A 5KX5A 2CDBA 2RKOA 3SN6A 1ZN9A 2CNBA 4OSOA 2CMHA 4GOMD 1TUEA 1CIJA 1XTZA 4B3SB 5D1HA 4CIWA 2ZYRA 4LRUA 5EKDA 2IK8A 2RSLA 4XX1A 4AY5A 1E0AA 1NLFA 3E7XA 4HXEB 2PRKA 4FB4A 1VDZA 3FZYA 3FCOA 1KEWA 1ATZA 1ZLXA 3FPFA 3Q41A 3WI7A 4B9EA 3O75A 1KRHA 1W7AA 4JJGA 3R8XA 1Y4AE 3RHFA 3USES 5LQNA 2RAUA 1EWYA 3LRPA 3K9QO 4IW3B 3L4KA 1TQ8A 4I36A 1UKBA 2WQZA 2BR3A 3KU4A 4QPCA 2W2KB 4EFDA 1TEZA 3FFTA 1LDGA 4RDCA 3C74A 1N0WA 4R9VA 1FNCA 2NTJA 4CV1A 5EE5B 2WQ6A 1KAHA 4DM7A 2H4XA 3FPSA 3PT5A 2BTQB 1X1RA 4I4NA 3I62A 4PZDA 4V39A 2JGFA 1E8MA 3S44A 4LC9A 2FCAA 4ZQBA 3VPXA 2OGUA 3AHJA 4TYYA 1X39A 4MWEA 5CHYA 5LB2A 3I1IA 3ZWCA 2Z1DA 4DUPA 5KUTA 3T4PA 1SHLA 5J5CA 1AQUA 2QY9A 3BD8A 4U5XA 1N5RA 5DTIA 4XVHA 2DWOA 3HFSA 4L75A 2Q6IA 3RVNA 3FDXA 1U2EA 1E3MA 4ZAZA 3A6KA 3S8YA 1A9PA 3Q40A 2OL4A 1J5XA 3DDNA 4ZC8A 4OAQA 1FQJA 2OK8A 4B6QA 3DMDA 3ZCUA 4I9FA 2HL6A 4X3CA 2PSDA 4A1OA 2E1PA 2AC7A 1XVIA 1YVDA 3QKIA 2UUCB 3LW8A 2IOYA 3L7NA 2P5TB 5CD1A 1J8YF 5LDGA 1D6SA 1SZPA 1FYVA 2F1IA 2FHSA 3AFIA 3UJHA 4ZGWA 3ADPA 5KCZA 3O8LA 4DOMA 4NH0A 1TUIA 2NMVA 5JRJA 2GM5A 4I5EA 4WZZA 5KKCA 3Q10A 1NVVQ 1RTTA 3E03A 4FDMA 4V3CA 1O57A 2G9ZA 1LPSA 2JATA 4MULA 3L0BA 1NKSA 5E2AA 3BRWA 3IOEA 4FCVA 2QTVA 4F2DA 4DVJA 4PGAA 1W1IA 3PPXA 1Y9ZA 3TEFA 1MPTA 4BMXA 4BQFA 2SKCA 4E2WA 2ZZNA 4X6UA 1H8ED 1RP1A 4L76A 5JCPA 4QWWA 2P2LA 3ISVA 1U3WA 2IQIA 3KNZA 1DEHA 3HFRA 2CJFA 4QSMA 4U4AA 3GFPA 4BAGA 2FXIA 1AQNA 2BKAA 2DWPA 3LI2A 4PPFA 4XEUA 5DMHA 1KHTA 5BWLA 3SEQA 1SVNA 1DLJA 4CLRB 4Z4IA 1NU6A 1SU6A 4PS1A 4IJUA 5EEGA 3UT5B 3TTYA 3UJ9A 4F12A 1A2BA 1RE0A 3TLGB 2FWJA 4G4JA 4AUEA 5CBPB 2P4QA 1O5OA 4G86A 3KAJA 1BKSB 1HDIA 2W4QA 2IY9A 4C2UA 3IEVA 3PT9A 1YBMA 3JYLA 4UMDA 4NDZA 4U7GA 2Z2KA 1SOVA 1IBLB 4Z99A 3TMYA 1N6OA 3O95A 1QBGA 3ESZA 4FILA 4MR9A 2HQ1A 4WNIA 5ALVA 1U8AA 2IIQA 1KY4A 3ZD6A 2QXYA 1D0IA 3T1NA 1DUIA 1P7ZA 2CBGA 1EA5A 1HF3A 1P39A 3AP2A 3D6UA 2JAPA 3E0XA 5FBZA 3UKDA 4CM5A 1UZMA 1L7DA 4DR4B 2HX1A 1QB8A 4AS2A 7GPBA 2BISA 3CZ9A 1SD5A 2H1IA 2F55A 1KHHA 1PDOA 1RQNA 1UMCA 1R88A 5D84A 3M5WA 4ZYUA 3AB8A 1TTPB 1WV1A 3TOVA 1SCNE 1EEXB 2YYZA 1O96B 1PQ4A 1ECJA 1ZCJA 2ZB3A 1SVWA 2F62A 3A31A 5B53A 5LXTF 4A6XA 3S2EA 2IIPA 1PVOA 4HXGA 1WUYA 3IERA 1ZUIA 2WIDA 4GG1A 1XROA 2C2KA 1N6NA 3C3JA 3LPDA 3O1JC 4PBRA 3DOUA 2NTVA 2OCAA 1DAKA 3WGZA 4L9SA 4W82A 1RLOA 1ZK3A 4YRAA 3IPAA 4IEIA 4KFUA 3UIEA 3I9LA 1HQKA 2ZQZA 3OOWA 4Q3EA 1RM3A 1N3LA 1JA0A 3FJOA 2VNSA 4U2GA 3K71B 4R2WA 2F8SA 1G5FA 4GPD1 2R62A 4IF4A 3QRWA 5GY7A 4PPQA 1TCAA 2F00A 1DP4A 1NRJB 2RHTA 2VP9A 3I23A 4LMAA 4R16A 3UMVA 4F7DA 2Z5VA 1ISPA 1E1QA 1UMBA 4KIGA 1M72A 1NN1A 2YW2A 2GCEA 3OSUA 1MTZA 3DBHA 3LY7A 4TM7A 3TXAA 1N6PA 1A4UA 4EUSA 2ZAIA 3L40A 3LNCA 3MYYA 1WABA 2ZUEA 3FWNA 2P0AA 5JAQA 1VKHA 5LQAA 2W2MA 1V25A 4IJWA 5JH7F 4AJOA 2H4YA 2HSGA 3LGSA 3O8OA 4GYYA 4MQBA 5FNZA 2DUWA 3IHKA 1CEYA 3A3KA 3ESAA 3S6JA 4DXAA 1REQA 3NHFA 4UTPA 4GPAA 2Z2IA 1FDUA 3U48A 4ATNA 1OH8A 1JKJA 4M54A 5AJXA 3AIIA 4RANA 1AX9A 4BWVA 5AVVA 2CXHA 3KT0A 4NCKA 2BKEA 4NULA 1E60A 4PHHA 3WKAA 1J9ZA 1VHTA 4D4LA 4E2ZA 1CUIA 2JVIA 4B3IA 3EGEA 1YUBA 2YFHA 3BB3A 3DNFA 3I32A 5A04A 2VRCA 3CUKA 3LQFA 1GLVA 5KMGB 5AW3A 3OF2A 1NR5A 4S0ZA 2ZJ2A 1VL8A 3WGHA 4MHSA 2H4JA 3DOJA 3ZWOA 4G0UA 2FEPA 2HWKA 1OVGA 2V7XA 3CSSA 5BSMA 3IAEA 5BR8B 3VUFA 4C4TA 4ZT2A 1L5QA 2IZ7A 3AIKA 1IOZA 5TB5A 4ERXA 2B4QA 1NBWB 3KQHA 4URUR 1XP5A 2XMCA 3EDRA 3M6AA 4KPEC 1QHXA 4FPXA 4NVRA 5C34B 5HK9A 2HK9A 3HYLA 3RSQA 3EEQA 1F3OA 1OFUX 2QRMA 4KLRA 4UZEA 2AZMA 1L3CA 4RV4A 4QM6A 3KFVA 3EA5A 4ND4A 2R1VB 3PL5A 4AKTA 3QQPA 4D4JA 5JBIA 3J80A 1MQSA 1IM8A 2V65A 5I9NA 1I6WA 4M1WA 5DVZA 1CJMA 3RR2A 1CUGA 3EBOA 3PRKE 4HOYA 1UJCA 3CA8A 4RHEA 1WMFA 3FKJA 4TROA 4WXPA 5BW8A 3QELB 1OWLA 5PGMA 2RGRA 1KPIA 5F3RA 3U56A 3T1TA 1DWUA 1NVMB 2RCYA 1B41A 4HDMB 3DXFA 3FG9A 1NONA 4CHTA 3K15A 4YPOA 3IT0A 1HT1E 1GGFA 5K3BA 3K8ZA 1UCFA 2HQBA 3DZKA 2PEYA 1Y7LA 3FOZA 4ZI7F 2NVBA 1P1FA 4HN2A 3HK2A 3PGA1 2AGVA 1MR3F 1XTVA 4JITA 1ZVKA 1T3GA 1QO7A 3B82A 2RB5A 3AP3A 1JKFA 1JR3E 1X14A 3OZSA 4FOOA 4MUJA 4URZR 1CULC 1XCMA 1NRXA 1GU0A 3I53A 3HC7A 3LBFA 5K2MA 1C0EA 4IOJA 2GETA 2MSCB 2WFLB 3ZLTA 3A2LA 4JI5B 4K6OA 4KN5A 4LZZA 5DHPA 4EEKA 3ESYA 5EZYA 4ES6A 3D4LA 2VSYA 1VI5A 2PX0A 3AEXA 3FHLA 3TM4A 2FCRA 1IY2A 2AFIA 1L2TA 2R7MA 3RK1A 4CMKA 3FLEA 5HSGA 4ZVVA 3ROPA 2AXPA 2OC9A 3CF2A 4Z5XA 5KO2A 1D2EA 2ZRHA 3LQKA 1KEZA 1ENYA 3OZIA 1ZIDA 5T8KA 1WDTA 1V2HE 3D3QA 4DBVO 2RC5A 4H9GA 2OBNA 2R1VA 4K6KA 3AOEA 5LA6B 1JDJA 4E03A 3OU6A 3ZWPA 2Z95A 2O3UA 1WNFA 2A5YB 3SMQA 1X7HA 4M8IA 1SHUX 4W9RA 3A9WA 4JVMA 2R1TA 4JLBA 1RRCA 1XMPA 3K3PA 3WYFA 4RADA 4X93A 1QZZA 1ZGGA 2Q3FA 4JR0A 3AEQB 4KQJA 4UNRA 3UQYS 1O97C 1SXHA 2C3PA 2YRWA 2H0AA 4X1YB 4PLFA 4UD2A 5LP6A 1TMYA 1GZUA 3OQNA 4CCYA 5LZ9A 3VH3A 1NE7A 1XUOA 4AC9A 1BCRA 5CU7A 5IW8A 3TLEA 1KWKA 1YRHA 2QX6A 3PXAA 3JSAA 5FOUA 1V5IA 2W6NA 3L8CA 4E0BA 1SR8A 3W6PA 2GNAA 1HM5A 2XDWA 4LNUB 2WWWA 2VDOB 4H7PA 4N5NA 3DWEX 1VYHA 4QFCA 3P0JA 1O4VA 3RJTA 5F33A 1J23A 2IXTA 3JYQA 3G17A 4D80A 5G1OA 3LUCA 2YWXA 4MYHA 1ELOA 4PBTA 5FA8A 1IUNA 3DTVD 1U0TA 5GVSA 5IH7A 3JWHA 2ZBVA 3O92A 3BWDD 4DYVA 4C30A 2HHJA 3I58A 3HCFA 3VR6H 4HGYA 3BRWD 1UH5A 3OHSX 4XVRA 1NC1A 1P6XA 2ZR0A 4PN7A 3CKYA 1EP3B 1Z18A 3HJAA 3NWPA 3B1VA 1GUFA 5DRTA 1C8BA 3SZ3A 3U40A 1C9MA 1T8RA 3IQIX 2BGJA 3N2KB 2BEVA 3LYLA 3SAJA 3X2SA 3T5MA 1N5MA 4UDYX 3IEMA 3I5MA 4N9QA 2B4RO 3ENKA 1MGPA 1EG7A 4YDSA 5E0KB 3KQYA 5A5VA 2GYVA 3MBIA 4O1HA 5I51A 4X85A 5SY6A 1OUMA 1G9TA 4WDRA 3E9MA 3DHYA 3QXJA 2J0SA 4BE9A 4D74A 4B8ZA 2ZSKA 1HEIA 2BFFA 1K66A 4Y7DA 3P2JA 4MMXB 2IW1A 1BDHA 3TSWA 1I4OA 1VHLA 1NOJA 1E92A 2QZ4A 3U4CA 1NL3A 1C29B 2CJPA 2E1RA 5FOXA 5GZ3A 4LJ5A 4E5YA 3JQ9C 2C7VA 4KC0A 3SI7A 1FP1D 1TCCA 3EIOA 3DUFB 4B6PA 5GINE 1CJTC 5HQTA 2GPBA 3T99A 3ZV4A 4A82A 2Y05A 3EXHA 2PUDA 3VMMA 3VV2A 4PTLA 2PA0A 1XDUA 2Q1YA 2Y1CA 2NO5A 3X1MA 1BMTA 1D3AA 3JZIA 3NEPX 3R6LA 2JBAB 3GT3A 4KR6A 4BUCA 1TAUA 4K87A 1AHIA 3D43A 2EP5A 3IAM1 3F7MA 5J9FA 3DXYA 4H4EA 5LQKA 4JT2A 2GRJA 1LS6A 2VN8A 1WLSA 1E20A 3MJHA 1YR2A 2OHGA 4OA8A 5K0FA 1UXIA 1G9SA 3BKXA 3QE2A 2ALJA 4YCLA 4KR7A 4URFA 1JA1A 2XNKA 3TECE 1ZW6A 4P81A 1PJLA 2HRCA 5E8JA 3I73A 1G5RA 4IIXA 2F48A 1JDSA 3H2ZA 4K9OA 3T7CA 1USIA 4P3OA 4CJXA 3DFUA 2HCBA 5LUBA 4OJNA 4XB1A 4OP2A 2QNIA 1DXQA 3G2LA 2VVTA 4QUHA 3RRFA 4BKMA 2PX3A 2HIHA 4BQQA 5B6PA 1EE1A 3MJ4A 5LWHA 5KOJB 2O5CA 3QVVA 1PS9A 4TT3D 4DABA 3JAKA 3T38A 3GG9A 4UPVA 4CLOA 4LZNA 5K20A 4PN3A 2BFMA 3OEYA 3U7HB 1U2QA 2E6UX 2GN1A 2QK4A 1DC4A 3GEMA 3KUUA 4P34A 5E3IA 3ZNNA 2ZUWA 4PPYA 1LB1B 2QQEA 1ILEA 3ABOB 3AI1A 5GP1A 1SVSA 1X1QA 3RBAA 3B8EA 2IFTA 2MYUA 3V7UA 4Z1MD 1TPYA 1PN3A 2QKYA 3BF7A 5GPBA 2XOKD 8ADHA 1S7GA 4RF5A 2ATCA 4I4TB 4KO2S 1US8A 1XGKA 3CIFA 4US1R 4KWTA 5E4JA 5K8UA 1G19A 1JV2B 1Z5UA 2ONYA 3DC2A 4MV6A 2AN4A 2ZSBA 1HDCA 3DMYA 2B1QA 3ZE6A 1V9CA 3O4FA 3UMRA 2CSUA 3ESDA 2YZKA 2QTAA 3PFKA 5AVSA 2VOJA 1EFRD 3UAXA 1E6WA 3LKDA 1O6FA 4MDHA 3TZQA 2J4CA 1J0XO 3UANA 1NHGA 3ENQA 4KRGA 4ZGBA 3R8FA 2I3GA 3E23A 3IBGA 1TYCA 3KQOA 4FWBA 2C4KA 3FZGA 3KKEA 1R6VA 1XQYA 4QOIA 1EDEA 2PX6A 4PXYA 2RJ3A 3NG1A 3DE7X 5IH3A 1KF0A 1PGJA 4MARA 1W4RA 4ECEA 5JSKA 2OKCA 5AXAA 5EIEA 4HMOA 1U04A 1V8OA 1KZ4A 4DDUA 3HPRA 2P2SA 4HZUA 2NO6A 2J9FA 3C3AA 3NANA 4I50B 2R00A 2YUTA 3IX7A 5LYJA 2F3QA 4A10A 4FW8A 1Y82A 4UE2A 3PHLA 4XOIA 1AK9A 1RI2A 2JJMA 5C1PA 1IOVA 1ZMOA 3KB1A 4PF1A 4GDFA 4HDNA 3IKVA 4LQLA 2MCFA 4YR9A 4JXZA 1YB6A 1BJKA 4JXXA 1ZBQA 2IS1A 2FU5C 3VOTA 4HWSA 4ANFA 1KOJA 2D5LA 4FYMA 1VRVA 4CMAA 4FHZA 3DB1A 1VB3A 2IE8A 3FDJA 3TBHA 4ARAA 3FMOB 1AKWA 1WHTA 1YHYA 1GAQA 1A69A 1MA0A 3FPAA 2GFHA 1QJCA 4R54A 3U3JA 4A4DA 2PT5A 1FVXA 1XTKA 3DLTA 5BP7A 4K9QA 4XIFA 5JPCA 3CUSA 1USUA 3KZKA 4XWGA 4UNIA 3O73A 1YOVA 2EWVA 4QARA 4C6TB 4DA8A 3DVQX 5LXTB 1UP4A 1Q17A 5CMLA 1JYSA 1N0HA 3GXOA 3ZHXA 3O1HB 2AUNA 2AMVA 2BFEB 4FNMA 4MYCA 3FGZA 3Q6IA 3B7GA 2O5EA 4QO8A 5FLYA 5IVDA 3H2SA 4ZO9A 1DAHA 2O1WA 3EZ9A 4ZV9A 1X1SA 4KQIA 3PNOA 1IHPA 1T9ZA 3AQ4A 3L8ZA 3RU2A 4BE7B 4IWXA 2XD9A 2ZPUA 5GWXA 4BRWA 3DCYA 4C4AA 3MNFA 4CIXA 2OMKA 4I50F 1GQ2A 4JX8A 3L0CA 4GZLA 4QYSA 4DDKA 1Q14A 4JMLA 1PGNA 1A77A 3NT4A 1ID1A 2J3MA 3SBXA 1NNSA 1SU8A 1UDCA 3ZY3A 1YJ8A 2I3ZA 4E5MA 1BHSA 2J07A 1RQRA 1ZI8A 4UTNA 1L9KA 1NJ5A 1VDMA 2XKBA 3GFOA 4RVOA 3CW8X 3SQLA 1KH2A 1H2WA 3CEMA 3Q6NA 4CFZA 1E0KA 3PLRA 3SF0A 1NNEA 4FYHA 3W77A 4PWZA 2W71A 3DC7A 1NLMA 2ANBA 5EZYF 4N54A 2QE7D 1ZGJA 2ZT5A 1RAFA 3W5CA 2OV6A 4DRXA 3CLVA 3SKYA 3CZMA 3HJGA 4QTZA 4ZOLB 1WBDA 1XMSA 3VR0A 2P3QA 2R7AA 2YMQA 3BZWA 4A6DA 5GJVC 1M1XB 3INNA 3TG2A 1PFGA 1YCHA 2PH1A 5DJ5A 1KO5A 2ZITA 4ZV7A 3KOZA 5EQDA 1I14A 1D8AA 3ONNA 3OIFA 5KHAA 3IHTA 1CLEA 1RYNA 3G5MA 1RLUA 4IVPA 1Z4KA 3H5RA 4D5EA 1HT3A 4NNPA 4C6TA 1Q77A 4YJ3F 4E5UA 3QXSA 1TVCA 3RKRA 2F43A 1RCTE 4AZSA 1GQFA 2AKEA 1Y63A 2XNDD 3G3EA 5J47A 3BMXA 3NHKA 3O1LA 3RUDA 4W7SA 5ITWA 3WSWA 5E9JA 2Q9AA 1V96A 4TMXA 3I1YA 2C07A 1QDUA 2Q2WA 1A0OA 2Y76A 3OA2A 4PZUA 3ZXSA 1MO4A 4WEQA 1PWEA 2BJVA 1QYRA 3T35A 5L3SA 3B9BA 4DLAA 2GJ4A 2QAIA 5LZ5A 3IQGX 1ULBA 2F64A 4BAZA 4BFYA 5I8PA 4LQCA 4G5QA 2FUCA 1RRFA 2IYPA 2VF7A 4WKGA 4O5AA 3NKFA 3L3BA 3Q7TA 2VLBA 3NVAA 5F4ZA 4DA7A 4ZOAA 1EUZA 3BCHA 1OOEA 1QLHA 3NTVA 4F6RA 4RGBA 3KPWA 4C01A 1G6Q1 3ST7A 3OOHA 1O95D 1EAMA 4LUCA 3TO5A 1H6BA 3K9WA 4ZP1A 2D74A 3AETB 3QUAA 2QP4A 3O8BA 1J0EA 1KK3A 3MZ0A 4OHOA 3AVTA 5FBKA 3PUXA 1XTSA 4PC1A 2IHBA 1IEXA 2N42A 2ZCVA 2ZRMA 4JOQA 4KXNA 3G49A 1N6HA 2VQ6A 1ZJYA 1WUHS 1ZC4A 2ZRKA 4IXTA 4CKCB 3OPXA 2GYUA 2DBRA 3ICCA 4PFKA 2NU6A 3LK7A 3OPMA 4IZIA 3TFWA 3EAQA 3TE7A 4I55B 4LBYA 1S1MA 1W581 2J87A 4MJ3A 5ALIA 4MLZA 1IOLA 3DEFA 5EIWA 3HTXA 2RE8A 1FLVA 2FN8A 1IG0A 2Y8EA 3FVQA 3WL6A 4EZBA 2E7ZA 4ZCPA 4F38A 1GTVA 2Z6VA 4X71A 2PK3A 4EA7A 1P80A 1QOZA 1UPTA 3L6RA 5T3UA 2XUPA 2XE6A 4ID3A 1Z4MA 4RKWA 4TSRA 3E1SA 1A96A 1Y5MA 4RVNA 5CBKA 2I7TA 3F9RA 1EE9A 1HGXA 2H2AA 3FNEA 3P2EA 2IF2A 5E6SA 5FWAA 2ZI5A 4KZKA 3R9KA 1U4SA 2QU7A 5JCJD 5LLTA 3G8CA 3HFJA 3LPMA 4GW3A 3ZY6A 4C7MA 4Z2AA 3P0FA 5C8YA 3S99A 2YV4A 3KZ1E 4MK4A 4AJJA 4M1KA 1JHVA 4H35A 1EGVB 3C8HA 4M7WA 4MRAA 3CH4B 4WBNA 5EYPB 5HJ5A 2PL3A 2C84A 4MUNA 5KU7A 3WBKA 4Q37A 3QSGA 4DG8A 2F59A 2WWYA 3GZTB 3G89A 5K3AA 1QAOA 1VMDA 2NUPB 1FSFA 3NGMA 4HWRA 3D3JA 3FDZB 5AKJA 4CUZA 2FUEA 4N7MA 4CXMA 3NATA 3TTXA 2V8OA 1KYIA 1XRNA 3B89A 2HJVA 2C4HA 4BB0A 5CPFA 2W37A 3QHQA 1AKYA 3QA3E 1WMDA 2FQ1A 1KP3A 2SHKA 4MVJA 1R0RE 2OZEA 2REQB 3U9TA 5SYMA 1CEQA 1NAIA 5LM3A 3E7WA 3LA6A 5KOJA 4HDKA 2ADFA 3FNIA 1XZLA 1QIKA 1MABA 1WCIA 3MTIA 3R0VA 3LPCA 5FBVB 3OJLA 1TXGA 5TPZA 4KACA 3ZVLA 4EGJA 4YQFA 1TQ2A 2GFQA 2Z2ZA 4CKCA 2C59A 4BCDA 1R4NA 4PX3A 1L4YA 3RCBA 5CVVA 2X1MA 4DCSA 3BE8A 2JW5A 4YJ2A 4LDZA 3HZZA 1CF2O 4GZ3A 4R3WA 3TR0A 5JQGA 4YV2A 2EWMA 1EWRA 3T3PB 1D1PA 2DPLA 4R3NA 4KB5A 2QUBA 5JYDA 3QBDA 2Q9BA 3WICA 1CB0A 2DBVO 1WXGA 3VO1A 2DQZA 3AU9A 3LBHA 1YJXA 1M2VB 2FEKA 1X7XA 3IALA 2A2ZA 3RYTC 4CV0A 1C3XA 3UWSA 1CVLA 1UWVA 4UAJA 1RXUA 4TKMA 4BQPA 2C2BA 3B3JA 1GZSA 5E2IA 5IULC 5AVXA 5HCUA 1J25A 2FSIA 2PPLA 4N6NA 1F2DA 1EQ2A 1RQGA 1J97A 3AGPA 5DRYA 1X8LA 1QOQB 3PRHA 2B7LA 3HO8A 3MCTA 2I54A 3DNPA 2H1CA 4W1QA 1FYWA 3ADOA 2EF0A 4I8DA 2P6RA 2ADOA 1ESCA 4BGVA 1XZNA 2E3JA 1JBQA 3WFIA 2XJ4A 2NU9B 1A76A 1W35A 1Q7TA 4HC4A 3GO4A 1U1EA 4LTNA 1ORTA 1ARZA 1T6YA 2FVXA 1FSGA 2C92A 1DJQA 3BHJA 2AFVA 2HLDD 3BULA 3W5SA 1V26A 2AA3A 3OFJA 4A6EA 4DZRA 1JIXA 2QXUA 1ABEA 1AXRA 1OILA 2B1JA 4XLLA 4CM8B 3KTOA 5A9SB 2UZ0A 4HEA6 4Q00A 4G1VA 4Q34A 3T0IA 2X22A 2IXDA 3I8SA 1EDBA 4FCTA 5LP6F 3PP8A 3QUTA 2QTHA 5CCXA 1RAGA 2VZ9A 5FAXA 4QQRA 3HO6A 1L7BA 1B6RA 3LA8A 5I01A 1GNTA 4CR6A 1PLKA 1JGTA 2H2WA 3AUJB 2PJDA 2ZIWB 3BUSA 4HPJB 5JYEA 2BUCA 2ZBQA 3B1XA 1M2VA 1BW9B 3LLVA 2NO1A 3ETJA 1E2GA 3I34X 3MQ4A 3PYLA 3KD3A 1CRQA 4IO0A 4LDQA 5JCXA 2GVNA 2UVDA 2ZATA 4RVGA 1EFUA 3LC0A 1FNNA 4JUCA 3VUEA 1BDMA 1XKLA 2QUKA 3JARA 3WWZA 4B6JA 3PI6A 4LJLA 5CB4B 2PRJA 3TLGA 4Q1DA 4L16A 2QEQA 1NI4A 4TKLA 5TARA 1F6BA 2BE9A 1VIYA 4RE5A 3CBGA 3GAMA 5FUQA 2PT9A 8MHTA 2VK2A 3KYJB 4TTPA 1AXEA 3C8UA 1HNNA 1XXHE 1W96A 2UXDB 1CV2A 5DWQA 2AFIB 3CLRC 3JZFA 3THRA 5TQ2A 3L0IB 2W00A 3W5JA 3VSBA 4A92A 4JYPA 2YJGA 3BHNA 2GJAA 4IY1A 1TTTA 1MOSA 3I2HA 2XGOA 3ZU3A 5AKIA 3GIWA 1JIQA 4TXLA 1CE8A 5B1IA 5BN4B 2P6UA 4E4YA 1N6LA 2QVZX 3ZI0A 1KBQA 1YZFA 1Y3CE 1Q7EA 3CZPA 3BSSA 1TT5B 3E9EA 1G7RA 1LCIA 3EDYA 3I39X 4QNRA 2LPMA 4RYDA 1KEVA 2IYFA 4XJSA 2IXGA 3OX3A 1Z45A 4HPWA 1PGQA 3EPJA 2C2HA 3QYFA 4LRTB 4O8ZA 4QPJC 3R9XA 1KR5A 4G07A 5CA1B 2GTIA 4PLPA 2BFBB 2PD6A 3KP1A 4KXWA 4UMVA 3WNBA 1KEEA 3FZNA 1RWKA 3K2EA 3L46A 4QLAA 5FCDA 3NBXX 2PV0A 1YTUA 3JWJA 1U8YA 1Z7BA 3REFA 3GUYA 2QG4A 4DCPA 4DSTA 5CB4A 1BRTA 5ESXA 3DCIA 3ZE0B 1YDEA 1ZX1A 1ZMRA 3A4YA 1I3OA 3PGJA 4UUAA 1TA0A 1ZR2A 1X9IA 2QRJA 4C7KA 1YVRA 3TI9A 3I9KA 1ZIXA 1D2GA 4MJXA 5IXYA 3SP1A 3A1WA 1QH1A 2Y9MB 3KYCA 3IILA 3U4IA 3A6EA 3NS7A 2C2OA 3EVDA 1DKMA 3G8YA 4JFRA 2NOAA 4D8WA 3W9BA 2ODTX 1T3ZA 1THGA 3GW8A 3VVMA 1JHXA 2H1HA 2XE8A 5EWLB 3MTGA 4RTLA 4RNDB 4H59A 2AYYA 3R7NA 2PE5A 3REQB 4LGYA 1WZCA 3PBKA 1Z75A 1H65A 4WV3A 4HDQB 3P9SA 1MAVA 1CTQA 1NF9A 2QYOA 3PHIA 4M0FA 1JEAA 3H1GA 4FDLA 4WERA 3UGJA 1MIHA 2CLFB 4FHDA 4ESEA 1VYUA 1Z9BA 2RHHA 3FWKA 4AM8A 4ZK6A 1K2WA 4NG4A 3HEBA 2YV2A 4PSCA 4MOWA 3IEUA 3I5XA 5C1BA 2J67A 4G8CA 3OOSA 2OUIA 1OPXA 2Z2YA 2X23A 4JR1A 4DHEA 3NWEA 2CLLB 4RIFA 1WF3A 1Z4NA 4NI5A 4EUEA 1JJIA 1ZH6A 2Q2VA 3IT2A 1B76A 3CWCA 2ZIXA 4UUQA 2P7HA 1D1QA 2O3TA 2YWHA 3GEGA 3ER6A 1D6NA 4HGZA 4PGGA 4OI0A 1ZXBA 2I22A 3ID6C 4GICA 1TEHA 3MWLA 3BF8A 1LSJA 2VDNB 3QY0A 4PINA 1AHHA 1CHNA 3HBAA 3KYBA 4U6SA 4YRDA 1BMDA 2XAAA 4R1OA 4HS4A 1O6GA 1AF7A 2QSJA 4DQUA 1O95C 1WHSA 3PKZA 2JD1A 4IMJB 4MO2A 1XEWX 2QF7A 3CSUA 1SH7A 3DXZA 5KYWB 4IVRA 2BGGA 2IV7A 2R6ZA 4I81A 3PQ4A 4P98A 1CEXA 3E3OA 1XMVA 3WNZA 3ICQB 3K30A 4X5OA 4OB8A 5KNCH 4ZCIA 4MVXA 5KYVA 1M74A 2VEOA 4KSBA 1PI3A 3BN3A 5DBIA 4M1SA 4YJ2F 5CVJA 1DRWA 2AG1A 3UJAA 2C4VA 1SOWA 3GNSA 3NXKA 4EYKA 2JAHA 5ESWA 2EGGA 2QJOA 3DP7A 4L8WB 4WZBB 3WLEA 4FWTA 3LGXA 1TJNA 4TXJA 2Q3CA 5HBGA 1RKUA 4GUDA 1Z0KA 3O4GA 3B9PA 3BT7A 1DFIA 6LDHA 3R3YA 5FQOA 4ILEA 3ZGXA 1E1KA 2B0CA 3IAXA 1T26A 1NQUA 3NHJA 1MNAA 4FFRA 1LPMA 2ZS9A 4Y6RA 1OASA 5F1YA 5IKEA 1Y9AA 2WTMA 4RD0A 5DHQA 4TS1A 1FTSA 2DPHA 1YXMA 3RASA 2HMSA 1CG6A 1XXHA 2BHRA 1OREA 5LDHA 1IBSA 3E3NA 4FMDF 4DZZA 2MINB 3HRKA 5T6MA 3NRJA 3SQXA 3I0MA 3SQMA 2I62A 3JPWA 4G4IA 4YPVA 9LDTA 3RJ9A 3PD1A 1Y4ZA 1Y1PA 3URMA 4BFVA 2EX0A 1VI2A 2QUIA 1X7GA 4MVJD 4MJ7A 1X8KA 4UCWA 1M8FA 4EVSA 1JVBA 2R11A 4YUXA 4ZTBA 1AK2A 5JSQA 1HE4A 5ELXA 5K0LA 4E30A 1UADA 1PD1A 2E5LB 4P4SA 2X7HA 2BLNA 3HADA 2JI4A 4JU9A 1DEXA 1IE3A 1VBKA 4AN4A 2CHEA 1G291 1QHYA 4I6EA 4DSNA 2QAJA 4YCCA 1QYVA 1CP2A 1P1BA 4D3FA 3QWAA 3I64A 2P4HX 3OHPA 1ZSYA 4BP3A 1F51E 5DBGA 3KYIB 2IBTA 3ZZ1A 1JQDA 3F7TA 4UVDA 1FFGA 1PYDA 3HXQA 1GA6A 4CCYB 2DU8A 1DEAA 1Y33E 4B4KA 1SPXA 5HKKA 4OREX 3B1FA 3LCCA 3WMRA 1YB7A 1UR5A 1V1RB 1WKBA 3Q5EA 4HQNA 4N41A 6REQB 3OY7A 2BGTA 2BFBA 2A5DA 2J9FB 3BCSA 3OO1A 4I5DA 3RIYA 4F9GA 1FPQA 1C7RA 4PTZA 4AZ3A 5DLYA 3FCAA 1DKUA 2D00A 1NP7A 2WI8A 2DR3A 3F8WA 2GZHA 4MWCA 4EW1A 1DMRA 1I1HA 5TMEA 3UMCA 2FMIA 2JFYA 4S3MA 1LQ2A 2BR4A 3QE3A 1ZCFA 4NDNE 4O4HF 3V2GA 1AGYA 4LF9B 2W98A 2WIAA 3NU1A 2B2NA 1OLSA 3MWEB 3R6TA 4FR5A 2QL6A 4L08A 5FBHA 4TRJA 2I3BA 3BE5A 1NRWA 3NIDB 3KC2A 2QUZA 3DEZA 1COWD 2JC3A 1G20E 2PX2A 1UEIA 1U6JA 1H2EA 4Q01A 3H84A 3ADKA 5DCLA 3E3LA 3FE2A 3MTBA 2X6TA 2HD4A 1Y8RA 2ZM5A 4X1IA 3W5VA 3QEBZ 3L5OA 3OEED 4DV1B 2RH8A 4XWWA 1CZHA 1ADBA 3JQ8A 5JAPA 4W5NA 1YR7A 4BGDA 1K7FB 4YJHB 3GPLA 5JZMA 1QLJA 3V46A 3DVAB 2NZVG 2QR3A 3QKSB 2PHZA 5ENVA 3RTAA 4EABA 2ZJ4A 4EQ6A 2Q1TA 4L51A 3IL2A 4DLKA 1HDXA 5U4XA 5FR2A 2NUTB 2QTBA 4DIUA 2FSPA 4E2YA 3KPVA 1LRJA 3FZQA 1N9GB 1ZJ5A 2J5KA 3HU3A 3IPLA 4MUFA 2YC2C 1T2UA 4TL7A 4TLMB 3TIVA 4C9BA 1GD1O 2NZUG 3EARA 4CTMA 5JAUA 4LMBA 3OU7A 1L4EA 4AJ9A 3RW9A 2YH2A 5AKXA 1X7WA 2DUJA 4HXYA 1LPOA 2PA3A 4DXDA 3P26A 4QHYA 5HKAA 5BRAA 1BX3A 2YHIB 4P2GA 5C2JB 1BFUA 1KE1A 3RRXA 4DR3B 3BFPA 5L51A 3TQRA 1QWOA 3BXPA 5A6VA 1N36B 1J99A 5AJZA 5C3UA 2HMVA 4ERNA 1GIAA 2ZULA 1QRTA 1GGMA 3AC0A 3U3RA 1GUBA 2XT6A 3N2GB 3A1EA 5AXBA 4EM6A 1OWOA 2PKYX 3RJZA 1ZHFA 4YX9A 1XELA 3ZKAA 4D8XA 3QTBA 4FFLA 5G1PA 3SJAA 3FM9A 3IVRA 5TLSA 1PQWA 3WBFA 1N5LA 1PVVA 2GBGA 2QRVB 2RKBA 2YIJA 1Z22A 3SX2A 3H13A 2QTFA 4O0LA 4BNNA 2R1ZA 3R74A 2D1SA 3W1EA 2QL7A 1W76A 1S6YA 3THYB 3CLSD 3A2MA 3BTOA 6AT1A 4YMSA 1UQUA 1DBPA 1Y81A 2ZI3A 3KALA 2PXAA 3R5SA 1DDGA 2Y4OA 3AUUA 3D4IA 3NKVA 1XN1A 1FP4A 4MKFA 1G38A 1GPKA 3ZVRA 4X7BA 5B6JA 4GSKA 1W30A 1C5KA 3ERCA 4M9QA 1APBA 2GYWA 4N5MA 3GJXC 1A5ZA 4L02A 4RUKA 4XFDA 3WGVA 5JMPA 3ELYA 1MVLA 2M1XA 1F2VA 4KQGA 3ENWA 2W70A 5IX8A 1QGUB 1JXAA 2G6TA 1DT5A 1ULTA 2B8EA 2BL4A 2CD7A 3BRQA 1RVDA 3PHHA 2H85A 3PTZA 4GQBA 4XZ3A 4XVUA 5MHTA 4JROA 4QUAA 1T13A 3NHPA 1G3QA 2FMFA 2GNOA 3LDHA 4HNHA 4DCGA 3EYWA 5HIMA 3TNFA 3EUWA 1PW5A 4R0VA 3V9PA 4B85A 3NNDA 3FPHA 2G04A 4DA9A 1DTEA 2HNKA 3N8HA 2XT9A 1BMFD 1W9MA 4G84A 2MSNA 3LOUA 4KUGA 3UGTA 2EEZA 4PV7A 1J9EA 5HA5A 1B74A 2WUFA 6YASA 4OMDA 2BF7A 1KMNA 1SN7A 2M6RA 2HXSA 4WJKB 2GJSA 5ALOA 1CS0B 2W0MA 2HTFA 3CGGA 4H0NA 4ZU3A 2IPNA 1H0RA 3H11A 1TA4A 1JN0A 1NF3A 1ODIA 1T0HB 3UK2A 5AKZA 4DR7B 3H2HA 2YC4C 3DCJA 1K6XA 2CWDA 2XR1A 3DD1A 2GCIA 4YXWD 4K2AA 3L7YA 4QOSA 3HKCB 4HFJA 3X1YA 1VLZA 3B1ZA 3TCKA 2QG6A 4V2IA 2QR5A 2WHPA 3RIEA 2WW8A 4BKOA 2ZRJA 1UDRA 1KSJA 4KI0A 4MR7B 1AGPA 2G1AA 4F96A 3TOZA 3OTIA 1H2HA 1J49A 3PD7A 5JIBA 1YIOA 1NQXA 2C3YA 2NO4A 1RAIA 1H6DA 3D2LA 3RWOA 1JIIA 1S4MA 1ZA1A 1FDWA 3HXPA 4KOAA 4OUKX 3UHFA 4TYNA 1TEVA 4FCCA 3TBKA 1XT6A 4BFSA 3VQTA 1ISSA 4TMVA 4DUZB 3WGKA 5CTJA 1M8KA 1DIRA 3QU5A 4AG3A 3KZVA 4JP2A 4LXGA 3IJPA 2IU0A 4K6MA 1SCKA 5B6IA 3PNPA 5KKNB 4CQLA 4XDZA 1KWGA 4BFTA 4CM4A 1TZCA 2XCIA 1JSCA 3TNYA 1BA3A 5HOQA 1ULHA 1QZUA 1D2NA 1K97A 3LP8A 2VFAA 5I6DA 4M7RA 4HNQA 4CV2A 2R6HA 5FUMA 4G36A 5DW3A 5EWLA 1GFSA 2C7GA 1O03A 2GXSA 3N9IA 4BBJA 4EJSA 5CUQA 4HD8A 1S8FA 4WCFA 3WNCA 5K0GA 13PKA 2FRVA 3I5UA 5LFAA 3KTFA 4M0DA 5JPDA 1GTZA 2AC4A 1F0YA 1XFAA 4Q6WA 1NBHA 4NAUA 2PLNA 1EPUA 2XZDA 4PPNA 3ND8A 3WP1B 5NULA 1ZKMA 2YDXA 1V0JA 1AH2A 2NYRA 4RU1A 4AMGA 1W29A 3HSSA 3KKLA 4MPRA 1FMCA 4MLCA 4JOCA 3IC5A 4V0RA 4ZARA 4DLYA 4Z9XA 2Q8PA 5CGQB 1NFFA 5DV9A 3GT7A 1ZGBA 1NC3A 4LTMA 4WLFA 3VMFA 1C7ZA 3H65A 1U28A 1DJMA 4CEJB 2FUKA 3ANNA 1U11A 4QEDA 3GLFA 3E5NA 5H3LA 3AJ8A 3K94A 1JG4A 2AQ8A 3EVGA 5IDQA 5JUWA 2WJPA 2OYCA 2IUEA 1NX6A 4J91A 1LLDA 3HY4A 2VJLA 2NXCA 5EVJA 4MPJA 1Z62A 1OLUB 3VNSA 5DNDA 3ZNQA 4E32A 3DR3A 1NSYA 4R1QA 3UJ3X 2N0SA 4F5WA 3STTA 2IZ1A 3E5MA 4XLTA 3Q8XB 1KU0A 2FK7A 2XADA 1RP7A 2NQ8A 2I3DA 2XUAA 3BWMA 3DPIA 2XUHA 4HHEA 1OYYA 4KXQA 5HG0A 3WS7A 3M1YA 4B83A 5JECA 5AK0A 4D26A 3PNYA 3QE0A 4FINA 4LXXA 5JJKA 1UKYA 2IOHA 3R44A 4ZVOA 3HR8A 2I2BA 1F6DA 1KZ1A 1YS6A 2XUKA 4O4JB 4QOEA 4L0DA 4UHKA 5T4FA 4AU1A 2YASA 4ZCMA 4S1VA 3NIGB 1N1MA 3R75A 4DV0B 1XHLA 4XPIA 3MT0A 4JY7A 1TX4B 1FUUA 3HM9A 1BGVA 4CTJA 2ASEA 1ZVMA 2ZOSA 3LCRA 3SF8B 5C4MA 5FPYA 5KWJA 4BNLA 3G1TA 4KNVA 1WAMA 1Z5ZA 4LJ6A 2AE2A 1GG8A 3A4NA 3KU1A 1NULA 1YZGA 1DARA 4WADA 3MJEA 4EG8A 2EBUA 3KWLA 1Z5OA 4FE4A 2QT9A 4FJ1A 2IV2X 1ECGA 5A62A 1TYBE 1ZRMA 3UV7A 1OWMA 4Y9UA 2WSLA 1BXRB 1AURA 2O4UX 1BE6A 1RNLA 3VR2A 4J3NA 2FKNA 3R3HA 1POWA 3BGIA 3L5KA 3UJDA 4S2EA 5LD2B 3ZNOA 4GT1A 3TGWA 1S3GA 4CL8A 1FFXA 2HEIA 5DI3A 2HUNA 4I8XA 5J2UF 1L6RA 1FRFS 1Q74A 3LL7A 2XEDA 2R8EA 1E3LA 1ZH0A 5J40A 1C3JA 1Q6ZA 4XQ0A 3DHNA 5ALNA 3D54D 5EP1A 2HUPA 3EWIA 1GA4A 2WAXA 3I4FA 1LTHR 4DJ5X 5THKA 2V6BA 1JH9A 2XE4A 3QXGA 4Y9TA 1OX5A 1OE0A 2Z09A 4LF6B 5FV7A 3KHUA 1YNSA 1R27A 3A4MA 4ZCTA 5DM4A 2HIAA 3WHPA 5C8YF 2AOXA 4OJYA 1ZIOA 1RADA 4F9EA 5KYXB 1IQRA 3G82C 2QYTA 4CDNA 2G77B 1BH2A 4BDTA 4HZGA 2CXRA 2H5LA 4LKRA 3KK0A 4V0KA 3T7EA 5JS2A 3WHIA 4B79A 2VCEA 5CDGA 5HTOA 1SQSA 3ZU2A 1VIAA 3AEYA 3OURA 3VU3A 4BQNA 3D1LA 3BWVA 2G5GX 3RD5A 4B17A 1IEWA 3WGYA 2BD0A 4CT5A 1M1YA 2JHFA 1XTIA 1LU9A 4LGVA 3FWZA 2O2IA 1X0XA 1YJCA 4JBLA 2EP8A 3VXKA 3EMDA 5H82A 5KNLA 3F9CA 3NTQA 2PL9A 2TS1A 2WF5A 2C8LA 4M1QA 2WSMA 1LA2A 5JQGB 1D2HA 1FLNA 2X5KO 2GEKA 4R2MA 2B5WA 5BVHA 1GA1A 2IPXA 1V11B 2B83A 4MA0A 5AK6A 1TCVA 3JTEA 3IR6A 3DULA 5JS8A 5EA2A 3EZYA 3TNDA 1G6OA 3IR5A 1JYFA 4WE3A 3KVOA 3O6VA 3HABA 1IZZA 3QMWA 4DUGD 4LAFA 3STYA 4K0KB 5F23A 1M6YA 2AEFA 5B4TA 3TS1A 1Y7PA 5KZMB 3T9CA 3A28A 1NQAO 5IASA 3A9VA 1BVRA 1T43A 2DR0A 3NH9A 1XMJA 2CUKA 3RYCA 4MQFA 2Y0CA 1IPHA 4RY0A 4WL0A 4YRRA 2NUPA 2AL7A 1U7PA 1E4OA 1E9VA 4R2JA 4BNKA 2GA9A 3ILVA 2H0QA 5TEWA 1T10A 3IUNA 3QI7A 5DGTA 4ABTA 3E22B 3KSMA 4PX2A 3ITNA 3OQIB 1BMFA 2GAFA 1Z2OX 4FX2A 5TQ0B 3DHVA 1OIWA 3SR0A 1WZIA 5EGSA 3L7LA 3WK5A 3ZDXB 1US8B 5B2ZA 4P84A 4QBHA 3IEPA 3UG6A 1O94C 1NW6A 4S35A 4ITRC 4OLJA 3COJA 1U8UA 1N25A 1NTRA 1KJNA 2UVPB 2IU3A 3DS8A 2V45A 5DYTA 2YZ2A 2RHDA 3RU7A 1M67A 3WO0A 4HFRA 1J1UA 1H1LA 2X0EA 3UGQA 5B3KA 1XAIA 3AEUA 3TINA 1RFLA 1DXYA 1USVA 1X1BA 3UFXA 4UM5A 1I80A 4GI5A 2YXNA 3C5CA 2DPGA 5K3CA 1Z63A 2OILA 4M7OA 4HEA1 1L5YA 2Z6QA 2IODA 2FF7A 3SOPA 2FSVC 1EM8B 3MK31 3AV0B 3OQ1A 3ESXA 1T9CA 3CLRD 1ZG3A 2DHEA 2JCBA 4G5XA 1FFHA 1YFZA 2IEAA 2NZJA 4QEZA 4LMRA 4A3SA 5DBEX 1YO6A 4IOLA 2YIVX 2Q6TA 3ESQA 3PQ7A 2V0NA 1RTKA 3D31A 1XWWA 1G21B 1F20A 1Y5NA 3D6FA 3DDHA 4MV8A 5TGZA 5AK4A 3RVPA 3D6AA 3UAZA 3IDSA 4FFSA 1BZYA 1PV1A 3HEAA 3KWJA 3PDIB 3QPBA 4GI1A 5FNVB 1WDMA 3E9RA 5JH7A 5K4GA 1U0JA 4QBFA 3TW4A 4EY4A 4YRNA 4GOND 3EGXA 3QPVA 4J1NA 3E81A 3N0XA 2ZROA 4RQTA 4TV8B 5EE9A 3C8MA 5D01A 2FW9A 1RM4A 2JKYA 2IVZA 3G9TA 2Q3EA 3NBUA 4FXPA 4RNCA 2IHJA 4F2WA 1ULUA 3GEHA 3WLRA 3D3NA 3HDGA 2XIJA 3DMFA 3IKLA 4OHBA 4HNTA 1BROA 3GRRA 3WQBA 3I0ZA 2WT9A 1YB4A 2JFFA 3E5RA 2ONJA 5ULLA 2I6TA 3SJBA 1K8XB 4EKYA 1UPBA 1E5VA 1AUVA 1AUPA 1UBEA 4KBGA 4OUDA 5H8WA 2VSXA 3L7CA 4DLLA 2QV0A 3DF9A 2VNJA 1XZBA 1V5EA 3F1LA 4ND8A 5FHQA 3KSRA 4PO1A 4B73A 2IGBA 3P8ZA 4LJ7A 2RGAA 1UJMA 2YN0A 3M4YA 3QLUC 1O8BA 4BUJA 1XC7A 1JKJB 1OCEA 3PHGA 5FO1A 3CO5A 2V9CA 3O4VA 4F6RB 4XM1A 2GJ8A 3BGWA 1CJCA 4NMHA 5D00A 4ZGGA 4OJKA 1NXTA 3VKHA 1TYAE 3M4NA 3WLSA 3KYDA 1QR2A 4NZYA 1XRMA 4L5IA 1TAHA 2ASVA 1MC8A 2WM3A 5COAA 5KVQA 4CG0A 5DH9A 1E4EB 1M2WA 3A9SA 1KDRA 4Z4CA 1Z2AA 1AZTA 5KVAA 2UYCA 1O87A 1NN5A 3JD1A 2XB6A 3MWKA 2PDAA 1SXGA 3HG7A 2V03A 1EVIA 2R8RA 3PUYA 3RQSA 1GCOA 3ELWA 2A88A 3MQ2A 3WRXA 5GZ1A 2DT5A 2WWHA 3VO8A 4BLUA 2B94A 2A92A 2HIMA 4J0KA 4NMMA 2YNMD 1ORHA 1UWCA 3GRZA 3INRA 3V4ZA 1YK0A 2JCYA 4J2HA 4DNXA 2DULA 3BB4A 1FNBA 4K3VA 1Z2PX 3D81A 5HJEA 3K0AB 3FTFA 2BP7A 3MUNA 5IDVA 2FUG1 3HBFA 5C8VA 5C5DA 1HQCA 1PR9A 1XJ0A 2DHRA 3AK4A 3IIMA 2JNWA 1AKMA 3VSAA 3AY3A 3BORA 4R9RA 3HLKA 4UJ5A 3WG9A 3TQFA 2FF5A 4BFXA 1L4KA 1LFAA 2YQ4A 2R8PA 5IYZB 1F0KA 3AKEA 4X8MA 3S7ZA 4Z4FA 1T8TA 2AW5A 4V1CI 1VE9A 2ZYDA 5ECWA 3FCSB 4K9KA 5CLJA 3R4CA 1XZEA 1DADA 3PKIA 1FX1A 1E2IA 1JQAA 4Y6GB 3TKYA 1S89A 1JZSA 2RGGA 4N0DA 3NTRA 4WLVA 2H5JA 2PFKA 2OZVA 3MHPA 2G36A 3LLCA 4KAAA 5JEEA 3K2BA 3DE5X 4ENPA 4RTNA 3DFIA 5K05A 4IGEA 1L4MA 1OXBB 3ETGA 5EJGA 2O8FB 1ADYA 5G0UA 4EITA 1N0UA 5JNTA 3DFZA 2KB0A 5LXTA 5JSZA 2PGNA 1FFXB 4OK6A 4IZHA 4G0ZA 4HDSA 4N8SA 1KPGA 1Z4QA 3NYWA 4LDPA 2WJJA 3E58A 4ENQA 2AYXA 1ZAYA 5EE3A 2MMGA 2QM0A 4CCAA 3K0FA 5AJTA 1LGYA 3OLQA 4IBOA 1J21A 2CXXA 4M8NE 1ZD8A 3HDYA 3LPAA 2HK7A 1F1BA 4FEEA 4QDKA 2YVUA 1JHMA 3SYNA 4F1WA 1NW7A 3L0ZA 1XRLA 5LLSA 3HJRA 5A0VA 1DQYA 1UWLA 1RPTA 5JMWA 1T4GA 1VL5A 3O47A 4UBJA 2ORYA 2E4VA 1MXFA 1RCFA 4XPIB 3VU8A 3W2FA 2QX9A 3M89A 5JBNA 3ITEA 3QLUA 4XTRA 3RTEA 1T3SA 2JFQA 3IGFA 3NKLA 4PQEA 3HVJA 1F4PA 1NYLA 3NHWA 4LE2A 1HDRA 2NSDA 5C8XA 3G9ZA 3H9QA 4J8PA 4U9IS 1QAQA 3F73A 1ZW1A 1PJBA 2HRDA 3RV4A 4EGSA 1EVJA 5BY2A 1U63A 1M1ZA 4IXMA 5LIRA 4YT5A 1TUBA 3MA0A 1ZRSA 2MOKA 1MC4A 2P9ZA 4PLVA 4PHCA 4CTOA 4OXYA 1YCFA 4W6QA 4A2QA 1TYZA 5I4CA 3TDNA 4AZTA 2HR1A 4BXOA 1CNFA 1AZLA 2ZE8A 4FZVA 5B7PA 1UT5A 2A35A 1O8CA 2X2OA 4O63O 4WXHA 1Y7TA 4CDRA 3FDFA 5EL0A 3OF3A 4GPEA 4M0UA 2UU9B 3SVLA 4H1TA 1HK7A 1M1UA 3NBQA 1R0SA 3A04A 1A7JA 2VG8A 2H5EA 2PLAA 4PVCA 2C7QA 1HSZA 1VBNA 2FWNA 2HF9A 3JYOA 1XVUA 4ZD6A 1VFPA 4HY3A 1XPRA 1WLYA 2IX9A 4Q02A 1E1CB 3U4QB 3W0LB 4IJVA 2FUG6 1AB6A 3OWHA 4FIDA 1J90A 1O89A 2X40A 2LGJA 3JTMA 3MUFA 4O4IA 2DHQA 2E82A 2WJIA 4CLOB 1Q1AA 3M4XA 1I13A 1ONNA 4OM7A 2D2EA 1RLIA 2J0EA 2H7YA 1E69A 1SURA 3A1TA 4M53A 4N7JA 1V3TA 1RKBA 4Q6BA 4WOBA 3FMVA 3HB9A 5ILGA 2OCDA 1C80A 1L8QA 3IDAA 4KE8A 5TSDA 3W8NA 4A91A 4B8YA 1X7DA 5C5IA 1SQ5A 2RH4A 3HN7A 1KI7A 2WKSA 4OHPA 4QUBA 2XVZA 3D7LA 1GILA 1QO0A 3CUYA 3I9V6 5AVUA 3RUIA 2D0OB 2W90A 1TUBB 1SB8A 1VE3A 2FZVA 2ZUSA 3HJHA 5FD8A 1ESDA 1NWHA 2QZZA 4M37A 4D43A 3DZFA 2PH5A 3D0KA 2EAUA 4DQXA 2G4CA 3D2BA 2X5OA 3I30X 1R0YA 4H6WA 1XK7A 2ZR9A 2X15A 2PCJA 3T8YA 3ZJUA 3L18A 3FUVA 4NMXB 3WLLA 2F3SA 2ZJ5A 1A9QA 4DA0A 1CFZA 4KR0A 3HXOA 1MKYA 5E1OA 2FQQA 1UM9A 2FHPA 4XTCS 5CR9A 5EERA 3KSDO 3U3MA 3UHPA 3LQRA 4CE6A 2WWIA 5AM1A 5JALA 3ASVA 3EUFA 4BX8A 2FPSA 2A86A 3G2HA 4BU1A 2VP5A 3UWOA 1IRIA 4KO1S 3B1YA 2HA5A 2BFWA 2B30A 1NXWA 3L7IA 2W9XA 2VHEA 4WX2B 1X74A 2EFHB 3QBJA 4RZXA 2JH9A 1ISIA 4M4SA 4FBLA 4Y1RA 3STVA 2WUWE 3KKNA 4DLBA 1EUQA 1ODCA 1LPBB 3WSTA 1F9AA 4KFSA 4LW8A 4PZCA 4IKOA 4F1KA 1AG9A 3G7UA 3OZUA 3HV0A 4BP9A 4QOFA 4NDAA 4X6YA 4DSAA 3IIEA 5HR5A 1PZXA 4JU8A 4OSEA 5FTWA 1I9CA 4BJ3A 3LQYA 1Y9EA 4YMUA 2ZJ1A 3EEYA 1HKUA 3FBGA 3I76A 3KJXA 2QSUA 3RHZA 4MW6A 2P1RA 2JLYA 5LQMA 1OW3B 2KW5A 2ZWIA 3EFHA 3B60A 5BURA 1Q0SA 4PGHA 4LEIA 3EDCA 3KVYA 3K0EA 2DKOA 2IU4A 5IXJA 4B47A 1GJRA 1CUXA 3K9LA 1HFKA 2QMUA 3EJWA 4MV3A 5KAPA 1JTFA 1M10A 3OKFA 1SK8A 2HSWA 3ICVA 4MMYB 3TL3A 3ZJ5A 2O52A 4NC9A 4BLWA 2PY6A 4O6VA 5ITZA 1LVGA 1XDZA 4ZT6A 3LXUX 1T1EA 3LDAA 2RGWA 2DUMA 4P0QB 4L2IB 1T5LA 1GV1A 4ZVKA 3VYRB 5JV5A 2MJLA 2J08A 2PVSA 2HF7A 3KVNA 4C4ZA 4EOGA 4IRXA 1P0MA 1U9JA 1SXIA 3DAPA 2LCQA 1WCWA 3WNQA 3DBOB 2ZIGA 3EQ6A 3RUCA 4LMPA 1GDDA 3CX7A 4X00A 1YR9A 3ZJTA 2OD7A 4JBIA 1OBVA 3HKBB 1GNQA 1WB9A 4BLSA 1PTJA 1FP6A 3CE9A 3KTDA 5I4IA 1R0BA 3M3PA 4GE3A 2QD2A 5BSUA 4DW8A 1AGNA 1EIZA 4GI2A 4QFBA 4JT9A 4BVKA 5K0EA 3F2IA 4N6GA 2WTAA 2I4NA 3CZ5A 4P8RA 4YP7A 1E4EA 2BHTA 1I1NA 3L8FA 1ORDA 1EFDN 2VUHB 4NYIR 3HV2A 5JSUA 3DMHA 3IE1A 3EZ6A 5K8TA 1XAHA 2W6JA 4NL4H 4Z8YA 1JR3A 3BMCA 3EOZA 3V1LA 5I45A 3ZHSA 2NV0A 2XZOA 1TQDA 4TWIA 1QH8A 3VHXB 1LQUA 2IXFA 4AZ0A 1UZLA 2OHVA 4MGHA 3SHOA 4BKQA 2IH2A 4JENA 1QKKA 1UFQA 1L4BA 1VLLA 3GY0A 4M87A 5FLKA 2PO7A 4B45A 2AG5A 3TPCA 4C7VA 4EL0A 1HDEA 1LV8A 2C58A 2COEA 2NNWB 2XB8A 2EFCB 1KGSA 3DBVO 2X4DA 2DTEA 3NH6A 5FNVA 4U2FA 5FX2A 4HCJA 3ZWVA 2NYVA 1IJFA 1L5MA 4HDNB 9GPBA 4YRPA 1SPBS 1K3UB 1YQQA 3JQ8B 2DLCX 1P2GA 2DTDA 2JK1A 4DV3B 4A15A 1WCV1 1UKAA 5HDQA 2QD3A 4Y3UA 1FXSA 1KJZA 1VJDA 3ZH9B 5K8VA 2P30A 3B1WA 3L05A 2X5NA 1D0VA 3K9BA 5CDFE 2R1TB 3GPCA 3N07A 3DV2A 1Q0UA 5HM6A 3Q7SA 3FNBA 2NUTA 3SZOA 3C7TA 5IMBA 4KPUB 1LPNA 3E53A 2H2HA 4IG9A 5GQSA 1EDOA 2VBFA 1OLSB 2FN7A 2JZOA 3SQDA 5HIAA 3L1HA 3MTJA 2IHKA 4L3OA 1DC8A 3EQ7A 1M5UA 3CBQA 3GJ8A 3JQDA 2R5WA 3BKWA 4ZVRA 3RFUA 1I3KA 4D0SA 3OLCX 5C9ZA 1ZCAA 1WPQA 3MB5A 4HXFB 1YACA 2AG8A 4WZ6A 1V8FA 1UPXA 4WA8A 2GKOA 3HU1A 3ZWDA 1EFCA 4CM9A 3SSNA 4A0HA 4NCHA 2AW3A 3BL6A 4GC9A 4LZWA 1B26A 3JVEA 5C80A 2RHGB 1XZAA 5FYDA 1K7SN 2D4HA 4G1FA 2F1RA 3PRJA 2QL5A 3C41J 3CONA 4OHMA 4UXIA 4X41A 4Z7JA 3ZW9A 5C7OO 3LFTA 3U81A 5DIZA 5CXXA 3RAGA 5AKYA 3R0JA 1CUDA 3VDQA 3ADBA 4U3JA 2X0NA 1KI4A 5ED0A 4YCSA 1RWMA 4RETA 1RXYA 2DE0X 1LJUA 4P35A 3V4VB 4N01A 1U81A 4P7FA 3CEPB 3IJEB 5BN4A 2B34A 4QHSA 3CJRA 1JJVA 3K72B 1TK9A 3CNLA 5EVCA 3INGA 3UWKA 3FA2A 1VMAA 4BY9E 1L8OA 4BMPB 1K7CA 2ZAMA 3HUUA 3H87A 4EJSC 1T9DA 4RPJA 2X8JB 2ZCJA 3EXEB 2PX5A 4B4VA 2YMLA 1SBHA 2J9RA 1MQ8B 1MHPA 1S8OA 3GDWA 3AVUA 4DTCA 5C7IO 1SXJB 4OFBA 1KBOA 4U2EA 5ICGA 4CMGA 5HZGA 5IAAA 5KTTA 4YNBA 4IOKA 3T6KA 4ECAA 2IYZA 2GHTA 5C8DA 3ROKA 1D6JA 1W88B 2QRKA 2G0AA 3H5VA 4JHXA 3SYRA 4HYEA 4MPDA 1XQWA 3ZBQA 2YVQA 3QVOA 4M8SA 3QMVA 5CX1B 3C70A 3TLAA 2FWBA 2CJWA 2C61A 4MWZA 3AF0A 1WETA 2AHRA 3O8QB 2YVAA 4KVAA 1FBTA 1YDHA 4RGYA 1MUUA 1S5PA 3AJDA 5FPSA 1F06A 5PNTA 1PSZA 4G25A 2GK4A 3WLMA 3ZWWA 5FA6A 1UANA 3A6LA 1L7PA 3SZGA 4QTYA 2XDQA 2ZSEA 3BIFA 1UFRA 5DSZA 3OJCA 3AF5A 1S4QA 1OA0A 2EARA 4XSGA 3F5SA 3WIBA 4B7XA 4B80A 1K6JA 2IPOA 1R0ZA 3E9NA 3FRJA 3PJGA 1YFLA 5HM8A 1GUZA 2UZ3A 3A6FA 3BREA 3ASYA 4XJXA 2EF1A 2AQIA 3GRKA 5EPUA 5A4DA 1J8QA 4G85A 4X9XA 4JI2B 3P2IA 1JFRA 3FNHA 3VISA 4AKEA 4EVRA 4BMOB 1IG3A 1XDSA 1FTGA 2WV9A 1I2AA 1TM2A 1D4ZA 4HEHA 5KAMA 3UA3A 3U4AA 3QF4B 5LNK6 1Z8FA 3KDPA 2VRCD 4ZVMA 4MQ5A 3GF4A 1I51A 2PL1A 2VF8A 2ZBPA 1W2GA 4GQAA 5EMKA 4ZAYA 1KI6B 1Z2DA 2HW8A 1CQIB 3O7MA 3PHCA 4C4SA 2Q2NA 3R77A 1R8SA 4LCEA 1MB0A 4FGUA 2FFBA 3QF4A 4JC0A 4NZOA 4RCVA 1R3DA 3ZIAD 2BKLA 3INTA 4BEWA 1GPAA 3KAPA 2PKEA 1C9NA 1EVLA 1FYDA 1KAOA 2O19A 3T3GA 2IKQA 2GCGA 3IMEA 1LLFA 4P3YA 2VSOA 3KG2A 4IHAA 5FBWB 3HXLA 1MEJA 4HGQA 4RAQA 4XRRA 5JD5A 4KNYA 2VZEA 4ILKA 3GWZA 1SEPA 3WK8A 1QGOA 2HZBA 1V7PC 1I94B 4K28A 3AILA 1N1GA 2OHOA 2Q2QA 3F7OA 3QFHA 3SX4A 3JASB 4B09A 1P1JA 3JU3A 2J1LA 1RAEA 3N1UA 5ALRA 3E7DA 4KXXA 1KBZA 2FFQA 1KO4A 4ALLA 4LE0A 4GWKA 3GLIA 3LPLA 4KFTA 1B2RA 3CZRA 2Q29A 4M46A 3VVLA 5ANRB 1WDLA 4J9VA 5G02A 2J3LA 2OSBA 1SG9A 3B8HA 1E6KA 3QUCA 4M0EA 1S2MA 3HY3A 1JEJA 2WHXA 3ACDA 3QX8A 4GKVA 5AOVA 4D3XA 2CDCA 3B7WA 4YLGA 5KWIA 5KC8A 1Y5LA 1JEDA 2V7WA 2H1OA 4TVKA 3FJYA 4JP5A 1UT8A 1Q6YA 1W44A 1FDSA 3R4VA 4FQ5A 5B2EA 3GD7A 5TT1A 4LY3A 3U3XA 1SUCA 2GTHA 3H9JA 4DGQA 3UMJA 4CEHB 3QXCA 4NU0A 2V3VA 3A0UA 1GNSA 5THXA 4BNZA 2ISSD 4Y6OA 3IDZA 4XVQA 3PQ6A 4JJFA 3ZBPA 1NW8A 2ZRPA 3VYUB 4UTVA 2XTMA 5DBOA 2NT3A 3ETEA 3MFQA 4IIJA 4I9UA 4JC8A 4U9UA 1L5HA 3S8MA 3MTEA 4BJHB 4LRSB 1CR4A 2IDJA 1RYBA 2P8JA 4IIJF 5F12A 3LO5A 2CDNA 1VHJA 2ZWAA 4D9HA 8ATCA 2EP7A 1R0KA 3BDVA 1X1TA 1XQXA 2L69A 1TM7E 2AB0A 2K2QB 2D0PB 1HE3A 3C3XA 3EA0A 2EGUA 1UMDB 1T0JB 4L72A 1QIHA 4R5HA 2RI0A 2O57A 1KDTA 4DMHA 1Q20A 1UXHA 1E0JA 3OFNA 2FSUA 3PEFA 3EVBA 4FP9A 4RD3A 4C3OB 2QQ5A 4KSYA 2GF0A 2FZEA 3ORSA 2R86A 3RHTA 2O2HA 2WVGA 3I6BA 1R0WA 4ZCQA 2UYGA 3FFWA 3HVHA 3H75A 1XNGA 2Q1WA 3A7DA 1PR2A 4QGBA 4CFSA 4TS3A 4HAVA 1EFRA 3BK7A 1EA7A 3V8MA 2ZYUX 4Q9KA 4C78A 1AGRA 4KGVA 1ECBA 1Y7HA 2YV1A 5JDIA 2VH2A 1WRBA 3ROXA 4QODA 1VJ0A 1HL7A 1Z6AA 4JUAA 4WIAA 2GI4A 1CUFA 4M98A 5G1NA 3V1NA 2JJ1A 4Z0HO 5KYTA 3WGNA 2H29A 4G37A 4BB5A 1OGYA 4NZMA 5JI2E 1C9JA 3R0XA 5EG5A 1Z74A 1EUDB 2ZI9A 4Q7KA 2ZYSA 5JZSA 4G8DA 5D7BA 3WQSB 1JXOA 1XZMA 5J5AA 3H2KA 3N8KA 5EPOA 2EX1A 4IFEA 1OQAA 5IDXA 1JG6A 2R47A 3ECSA 4OLFA 5TGDA 3TIXB 1QH9A 3BXFA 3I2KA 1U8TA 3D2AA 3Q5GA 4HF7A 1XHFA 1MF7A 4EGCB 2RONA 3FLBA 5JE8A 1OIVA 2ZYAA 3UJ6A 4F8JA 8AT1A 5FTJA 3Q8KA 1JE0A 1IAQA 3FW1A 3VTAA 2BBWA 2I6FA 1CQPA 2CN1A 1S9DA 2QE7A 2VPXA 2MSDB 4EHFA 1CS4C 1A7UA 1W9HA 4Q9HA 1T5DX 2PCLA 4UM9D 3T1OA 4YT2A 1LSUA 2ZRFA 4NENA 1W85A 5IT4A 3IO5A 2XTNA 1RR6A 2G9QA 4MDYA 1JNXX 3I52A 4R0NA 4M9UA 3FOFC 2JIDA 1KI6A 1JQBA 1WB6A 1P9WA 1ZONA 1E58A 1NASA 5G4KA 3RFCA 3ZHCA 2CXPA 3C0KA 2CLOB 4RVUA 3N8DA 3D6HA 4B7UA 4QU8A 1XP8A 5JWOA 4IS2A 2WB2A 5G4LA 5HIJA 3AF4A 1Z3IX 4HQKA 4XDYA 5IHXA 1GKYA 3LOPA 4BRSA 3MXOA 4TT8A 2Z98A 3OX2A 1Q22A 3IMKA 2X77A 3VKWA 2VSQA 1LJLA 4JBWA 1EZ1A 1J4AA 4Z9AA 5AM0A 2W2PA 3AF1A 4B33A 1E2JA 1JSZA 3CZQA 5CYOA 3IQFA 3W6UA 3WHLA 5KOHA 4RC9A 3OE4A 2VDVE 4YALA 1B4DA 5GAJA 2WSBA 1V4BA 4XIGS 4PRZA 4E11A 2CL6X 1PQYA 3A6GA 3PNQA 4BMYA 2WDZA 2JJ2D 2NTEA 2C42A 1QQBA 3BMOA 2J0UB 4ND2A 1QPBA 3IDQA 4WBXC 1PFWA 3F1KA 4ZEMA 5KCMA 3O8QA 1SBZA 2WIBA 4KXMA 4X8HA 5AW9A 1Q7BA 4BKRA 2J5QA 3HWRA 5AHOA 2B69A 5FWYA 4R8VA 5JISA 4B3TB 1JMVA 3LCJA 2LXNA 5J2TF 5JT1A 3LX8A 1CRZA 1ZM9A 3BSYA 4HLCA 4MW4A 3MWDA 4P3XA 1LPAB 1P31A 3AV3A 4LBWA 4D56A 1EUCB 3GFQA 1VYTA 1MX5A 3EISA 2W58A 5IC4A 3LT0A 3LVFO 3TSYA 2PMKA 2PVPA 1YOBA 4DLNA 1CDDA 1P81A 4UKDA 4NU5A 1ZYUA 2H7CA 1NQWA 1KDZA 3C1TA 5IC5A 2C7BA